Prochlorococcus marinus pastoris CCMP1986 uid57761

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33860575|ref|NP_892136.1| hypothetical protein PMM0015 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MNQFFSRRSFILIPIMSILKFILQPKKVLAAFAASDDDWNLSKEDWKNKLSPESYYILREEGTERAFSSQLNNEKRKGIF
    YCAGCNQPLFTSDTKFDSGTGWPSFWDPIQGSVETKVDFKLIVPRTEYHCSRCGGHQGHVFNDGPLPTGKRY
    CNNGLALK
    FIAE

    >gi|33860639|ref|NP_892200.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MALKVGDKAPEFNLKDSFEKDVSLKDFKGKRIILYFYPKDNTPGCTKEACNFKENWDLLKQNNFVVLGISKDSAASHQKF
    IEKFDLPFVLLTDPEPYKTSSDYDSYGLKKFMGKEYMGMMRNTFLIDVDGKVEKIYLKVKAAIMADHIISDLGLR

    >gi|33860676|ref|NP_892237.1| hypothetical protein PMM0116 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MENVKIEEKIKTSDDGKGILITNDAIEQISSLLKNQTDKKALRVGVRSGGCSGMSYTMDFIGGDEINADDKVYDYSLSSE
    QTFKVICDPKSLLYIYGMQLDFSKDLIGGGFNFVNPNASQTCGCGSSFAV

    >gi|33860739|ref|NP_892300.1| glutaredoxin [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSKVEIYTWRFCPFCIRAKSLLEKKNITFTEHKIDGDDNARELMMERANGKRTVPQIFIDDKSIGGCDELYELEKEDKLD
    LLLN

    >gi|33860771|ref|NP_892332.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MEIIETDVAIIGGGPAGCTCALYTSRSNLNTVIIDKNPSVGALAITHQIANYPGVPVDISGEKLLTLMREQAVQYGTDYR
    RAQVFGIDVAEDWKTVYTPEGTFKAKALVLASGAMGRPASFKGEADFLGKGVSY
    CATCDGAFYKNREVAVVGANKEAIEE
    ATVLTKFASTVHWITSSDPKSDNEEAMELMHSSNIKHWSRTRLLEIKGNDMGVNGVVVKNKQEEGPINLDLDGVFVYMSG
    SKPITDFLGDQIALKEDGGVIVDDFMSTNSDGVWAIGDIRNTPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS

    >gi|33860800|ref|NP_892361.1| thioredoxin-like protein TxlA [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MQSGNKESFLNSSQKSILILFFALIICSALVLKNFIFQPTFLLKKFGQSSIDPEIAFTNNKPTFLEFYADWCEVCKEMAP
    KVEDIKNKYEKDINFVFLNVDNPKWEKYIRNFNVNGIPQINIFDNDSNLELTFIGKQEEDSIKESLDNLYDKFRGDSQIL
    NSEFSIIKDNKNYQSSPRSHG

    >gi|33860860|ref|NP_892421.1| selenide,water dikinase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MLFIHCNEMTINHLVLIGGGHTNVLLMRKWLMYPKLMPEIPISIISRDTQLVYSAMFPSVISKAISLDESLIDIRSLAKK
    SRVAFIKGEVINIDFKLKKIFLKNRPSICYSKLVLNYGSQTKISGEFEDLVNNQTAFPIKPFFKAYELIKNEDEHDSETE
    QSFVIVGSGLAAIEIVFALRKRWKKRSLKILCKLNKVNDKILKTFYKSNIEVVGKLPVDYGKILLCTGNSSPYWVQKYNS
    ELDSKGRFFTDQKLRLKNFFGTFATGDCAVIKTSKRPSSGIFAVKVLNILATNIQKEIKGESLKKWSPQKFGLQIVNSYP
    RKLPKAFAFYGDFVIGPSFLIWYLKNKIDEGFIKKFRILDSNMSQKVNEGGMEECRG
    CAAKIPQSILNKSLRSAQLENFA
    TSPEDSVEIYKNNQDIILQSVDGFPALISDPWLNAKITVLHACSDLWACGVKLSSAQALISLPKVGKDFQSFLFSHCLKG
    IKTTVEEQGGKLIGGHTFESRSLVDQPYSLGIDISLTVQGVLKNGAKPWLKSGMKKGDIILMSRPLGVGIFFAAQMQNIN
    LKDSSEEIMRNLVTSQQPLIDKIYLLQDKFGETFINAATDVTGYGFIGHLKEMIDSSNLLRKDNKLKPIRVLLDLFAFKA
    YPGVFDLIHKGIKSSLFESNKEIFDQIIAEKRNDRIIAFSKKNKVNSESFKEKISLLLDPQTCGPLLICCAPKYEKFLKD
    EWYKVGEVIN

    >gi|33860903|ref|NP_892464.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MQIGDKVPQFSLLDQNGTKRSNNGLKTPLVLFFYPKDDTPGCTIEVCGFRDKYDLFKVLGAQVWGVSNGSSSSHLAFANK
    NKLQYPLLCDKNDSLRKAFKVPKVLGLLDGRVTYVIDRNGFVKHIFRDLLNGPEHIKEAIRVLKEIQNQ

    >gi|33860973|ref|NP_892534.1| hypothetical protein PMM0416 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSNDCCNTDESNKNLKGLDHKDAIQERYGSAALEKESCLCTPVGFNPVLLEAIPEEVIERDYGCGNPTKYVKKNDIVLDL
    GSGSGKNAFICSQIVGEEGKVIGVDQNPDMLKLSRYASKKFSEKIGFINTEFLSGSIENLDVLDKDLNPLIANKSVDIIL
    SNCVLNLVNPESRKNLLRNIKRVLKDNGRIAISDIVSSKRVPLRLQNDHDLWTG
    CISGAWYEPELLNDFKDLGFKNLEFA
    ERSNEPWKVIEDIEFRTVTLVGNI

    >gi|33861069|ref|NP_892630.1| putative arsenate reductase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MLNKLKRVIFYSYPKCSTCRKASKWLDQNNINYQLIDIVKEQPSKKFLEMALIQFSLDIKKIFNTRGKSYKSIGIDILDL
    TQKKIIELLSNDGKLIKRPFLIINESKLILGFNESEYIANLK

    >gi|33861123|ref|NP_892684.1| glutathione S-transferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MNNILSWADLSKFKIDDIDRVNGINNSYSNLRLFGHCEKEVELIFYRDRHSWCPYCQKIWLWLEFKRIPYKVKKINMYCY
    GQKEKWYLNKVSSGKLPAIELNGKIITESDNIITFLENEYGTLGSSLLSKDIGEVRNLEREIFRSWCNWLCRKSFSYLDL
    SFRKKKFRESICKLEKILSLSKTGFIDSPIHDSEKLEPGTGDIIFIPYMERMNASLSYYKGFDLRNSYPFIDRWLTLFEN
    FSAYRGTQGDFHTHSHDLPPQMGGCFKDVNDQQISFSNLIDVGEGLGNLEFNQDIDLGYYAKFALKRVLKHKDNIINANP
    YEKDLFEESLRAALTHMITSEINEVPKKAATSINYLKNRISVPRDMPVISARILRQSLNKIESTNLNTKIDKIPEKHRYD
    QDPARFILKKRL

    >gi|33861124|ref|NP_892685.1| glutathione reductase (NADPH) [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MILKVLEFEFDLIVLGAGSGGLAAAKRAASYGAKVAIIEVNKIGGTCVIRGCVPKKLMVYAANNRRNMLSSEGYGLISKE
    ITFESNILLKNVREEVSRLSVLHSNSLKKLNVKVFEGLGRFLNQNTVEVVCPKTKNILRKVSAKSILISVGGKPKKLNIP
    GTDFAWTSDDIFELKDFPKKLLIVGGGYIACEFASIFKNLGTEVTQLIRGENLLNGFDKDLSECLEKSMTSLGINLKFKN
    QLKSIKKINDGLESTLESGSKLLTDNILVATGREPSLKRLNLDTLNLKMDGIYLEVNELNKTSISNIFAIGDIVKRPNLT
    PVAIEQGRVFADNYFAALKRKVNYENIPKAVFTIPEISTVGLSEEKANEIYSEVNVQVFKCNFTPMSNTFKKNKSKCMLK
    LVVNKKNDKVLGCHMFGEAASEIIQMVAVSLNTGITKKDFDTTMALHPTISEEFVTMYG

    >gi|33861187|ref|NP_892748.1| glutathione S-transferase N terminus [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MTTDILYSFRRCPYAIRVRWALLICEIKVEIREVDLKNKPIEFMNKSRTKTVPILLKKNNEVIEESLDIIIWALSESEKE
    NIKKFYNPKNKEKEILEIISENDHSFKYHLDRFKYSARFNASEEDYHYLEATKFIKKWNKILTNNRWIIGDKPSIADWCI
    WPFVRQFKIACESQKKTNYFDDPIKNWLGYFEKHQQFKKLMHKFDPWKPSKNKEYFDFN

    >gi|33861356|ref|NP_892917.1| hypothetical protein PMM0799 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MRPHSLKLSPDSDLIICIKEYSLSNNLYGYVSGVVGNLSKACIQCPGNQEISKFEGNLEIVSLNGNFNNGDVHIHLSFAD
    EGCNVFGGHLEEGSIIKKGTDILLVSFENETIDISNQNLTNNQSRVKVYILKN
    CPWSKRSLRLLDSLSIPHEAILIESDK
    EFQKVNSLSNHNTFPQIFLDDVFFGGYDELSKQAKHDYLNSFK

    >gi|33861413|ref|NP_892974.1| thioredoxin peroxidase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSLRVGQEAPDFTATAVYDQEFKDITLSSYKGKWVVLFFYPLDFTFVCPTEITAFSDEFNKFSDLNTEVLGVSVDSKHCH
    LAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGIVMHTTVNKAPVGRNVDETLRILQGYQY
    VAANPDEVCPANWTPGEKTMLEDPKGSKEYFSAL

    >gi|33861460|ref|NP_893021.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MKSLFGLFVILISLIFNLKSAIAFDYAPEIGDSAPSFHLEGINKSIKSKKIWDSNELIGKWIVLYFYPKDFTAGCTLEAK
    GFSQLKNDFSKYNAEIIGISADNQDSHDSFCSEKSINYTLLSDPNGTISAKYGSWIPPYSDRNTFLISPEGKITYRWISV
    LPINHAKEVLNILKKNI

    >gi|33861511|ref|NP_893072.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MFEFLKKLMTNNESVSAKETNFLHRILNTDIKQEPKSQEDEIIFGCGCFWGAEKCFWKLPGVITTSVGYAGGEKNNPTYY
    EVCSGITGHAEVVRVVWNVNEIDISDLLKMFWECHNPTQKNRQGNDMGTQYRSTIYYKNDINKDKIYSSKEAFQKELYKN
    NLGIIETEIKKIDTYYYAEEYHQQYLAVEGSRQYCSASPTKVKLGSFNNCNYKLPTKTWDNFNWDIDKCVLRSNNNPIDI
    NN

    >gi|33861562|ref|NP_893123.1| glutathione peroxidase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MLSSIDKFLKLMVVDVQNTTVVSANGEAKKLGQYSGNVILIVNVASYCGNTAQYKDLQKLHDKYSKKGLRILAFPCNDFG
    NQEPDSLTEIKNFCSTKYGVEFEIMEKVHAKGNTSEPYTTLNNVEPKGDVEWNFEKFLIGKDSNVIARFKPGIQPFDENL
    IAAIEVAIDS

    >gi|33861581|ref|NP_893142.1| putative stress-induced protein OsmC [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSKITCSYLGDLKCEAKHLQSGNLITTDAPIDHCGKGENFSPTDLLATSLGSCLLTIMSIKARSNGWELKNIYLDIEKIM
    TKNKERKIAQLKIDIYIPDDLSKEKIDFIKNASEDCPVTRNLSESLDIKINWHNQ

    >gi|33861617|ref|NP_893178.1| thioredoxin [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSSAPAVTDSSFDKEVLQSNLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSSTLSKHL

    >gi|33861650|ref|NP_893211.1| hypothetical protein PMM1094 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSNNIYKIVSLYSFFSFQENSIIELKENLFSIEKNNDLSGLLIIAREGLNGTVCAEEGIIENILKLIKNIVGNNKLNIKV
    SYSKKKIFKKLKIKIKDEIVTMGVPEINPSEDSGTYIDSFSWNKLIKDKNTIVVDTRNHYEVSIGSFKKSINPNTENFSE
    FPEWVDDNLGKYIGDDDSKNIAMF
    CTGGIRCEKATSLLKKKGYKNIFHLQGGILKYLEDMSKEESLFEGECFVFDKRVAL
    DHELKQGSYSICHACGMPISIEDQKNKEYREGIQCHFCVNKFSDNDRKRFEERQKQINKLKDKNQKVYKD

    >gi|33861667|ref|NP_893228.1| glutaredoxin-like protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MENPTKNKIQNLIDLNPVMVFMKGTKLMPQCGFSNNVVQILNSLGVTFNTFDVLSDFEIREGIKEYSEWPTIPQVYLKGE
    FLGGSDILIEMYNAGTLKEKIEIALAS

    >gi|33861688|ref|NP_893249.1| hypothetical protein PMM1132 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MSRKSELLKGEETKNFSEFSQLADFSLMNSLNADPHSTKDGNDHRARSVNSGHYVPVTPTPIPEPIYVSHSKTLFKELGL
    SSDLTKDKNFCRFFSGDIEVAEYPMRPFGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRMEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQELMHALGIPTSRSLTLYVSGTEIVRRPWYTEGSRYFEPDIMVDNHAAITTRVAPS
    FLRVGQLELFARRVRSNSHDDAFNELKIIVQHLIDRNYRDEIDPSYSFNEKVIRLANLYRGRLISLVTNWMRVGYCQGNF
    NSDNCAAGGFTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPFAAEINFKMFCSSLLPLLLENKEDIEKLEKIKNDFSK
    FMSKEMQLMWAKKLGLEKYDETLTNELFNLMVNSKVDFSIFFRKLSHIPDNISFLKDSFYLPSSEELDKEWFIWLKKWQD
    CINKQGDLKEISKSMKQVNPKFTWREWMIVPAYQEAEEGNYNKIKELQTIFKNPYEEESLEIEQKYNRLRPREFFNKGGV
    SHYS
    CSS

    >gi|33861706|ref|NP_893267.1| putative thioredoxin reductase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    METKVKEDNVENLVIIGSGPAGYTAAIYAARANLQPLLVTGFNSGGIPGGQLMTTTFVENYPGFPDGVLGPELMDLMKAQ
    AERWGTNLYESDVISIDTSKSPFELKTLEGSIKSNSIIIATGASANRLGVINEDKFWSKGISA
    CAICDGATPQFRNEELA
    VIGGGDSACEEAAYLTKYGSKVHLLVRSEKLRASAAMIDRVKANSKIEIHWNTKVEKANGTDWLENVETINSHKGNVEIK
    VKGLFYAIGHTPNTKFLNNKIELDKKGYIACNSGRPETSIEGIFAAGDVVDSEWRQGVTAAGTGCMAALAAERWLAEKNL
    SKIIVRETSEPEKTLSSSSFNEEVTNEDTFNLNSEWQKGSYALRKLYHESNKPILVIFSSPS
    CGPCHVLKPQLKRVIKEF
    DGAVQGIEIDIDKDQEIAKQAGINGTPTIQLFKDKLLKKQWQGVKQRSEFKEAIQNII

    >gi|33861854|ref|NP_893415.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MTDTNFDFDLIVIGAGYGGFDAAKHAAEKGLKVAIIESGDMGGTCVNKGCVPSKALLAASGKVREIANYEHLAKFGIHAS
    PVRFERSKIADHANNLVSNVRENLTKTLKRSGVEIILGFGRLEGNQKVGVRDNNGIDRIFTCKNIVLATGSSPFVPPGIT
    LDNRTVFTSDEAVKLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTIIEALENIMPTFDPDITKIAKKNLIQSRDIDTKS
    NVFATKITPGCPVKIELTDAKSKEIVENLEVDGVLVATGRSPNSKNLNLDSVGIETIKGYIPIDDQMRVLNGEKIIPNVW
    AVGDVTGKLMLAHTAAAQGTIAVENICGENIEINYGSIPAATFTHPEISSVGLSETDAKEIASKEGFTLGVVKSYFKANS
    KALAELESDGILKLLFNKDSGKVLGAHIFGMHAADLIQEIANAISRNQDVMQLSTEVHTHPTLSEVVEVAYKQAASQVK

    >gi|33861889|ref|NP_893450.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MKYLFSLIIVFSILVNPINTFAEDVVLAGGCFWCLEHDLESLRGITSVISGYSGGDLQKPTYENHNGHQEVVLVNYDSEV
    VTLSEIYRLYFRNIDPLDGGGQFCDRGDSYRPVIFFENSDEKNEARKSLLSASKELGVNLEKINVELKPKSQFWEAEAYH
    QDFANRNELKYKFYRFSCGRDQQLDKLWKENARSINVWSE

    >gi|33861926|ref|NP_893487.1| hypothetical protein PMM1370 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MNPFDLVVIGGGAAGFMTAVTAAENGVKRIIILEGSSKLMEKVRISGGGRCNVTNASWIPSELAENYPRGGIKLLESFNR
    FAAGDVFDWFEKRGLNLKIEADNRVFPVSDSSLDVISCLKKNAINKGVEISTKFFVKEILKTSDNLFTIFNREKFSIIAK
    NIILSTGGHPSGYKLAKNFGHSIIRPVPSLFTFSTKEKKLNECSGVSIKNIDIEIQLNNKSFKNRGDLLITHWGFSGPAV
    LKLSSIAARELFDQKYKFNLIIRWTNLEYKELKEKIDNLKFNNGKLNLINLRPLPLLTRRLWVFLLNKMEINKDKKWSDL
    LANEREKMINSLLKDKYIISSKGPFGEEFVTSGGVSINEVNFKSMESLICPGLFFSGEVLDVDGITGGFNFQHCWTSGWL
    AGQSVSKLCDKVTN

    >gi|33862125|ref|NP_893686.1| molybdopterin biosynthesis protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MAISTDLNSDFLTLDEKERYKKHLTLKEIGLKGQLKLKNSSVICIGAGGLGSSVLLYLAALGIGRIGIVDNDQVEKSNLQ
    RQIIHETNTVGNLKINSAHERIKRFNPNIEVTTFNKRINSENVIEIIKDFDIICDCSDNFGTRYLINDACLILNKAFVFG
    SVQGFEGQISVFNLNKKSPNLRDLLPESPVKNNIPS
    CEEFGVVGVSTGLIGILQVNEIIKIILKKGEILDGKIMIFDLLN
    MNIKTLNLKSDKLNKNIKNLSQFEDFYKDNECQDNIKIKKINAKEFNTLYKAKLNKILLLDVREKEEFNQCSIKGSISIP
    INKLTQKSHLEFIKKESLVKEIFTLCQFGKRSEKASKILMKFKISSTSIEGGLKKINQVIIG

    >gi|33860661|ref|NP_892222.1| hypothetical protein PMM0101 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
    MALKTLKSKNKKDLKWPKIIIAILSTIGLVDTGSITLKNWGLFNSLSCPGIKNGCETVLNSPWGTLFDNSQFNIPLSLAG
    VITYGSILGFSIFLSLNLVSPKEKLNKIIWWAIFLISCASSVFSILLLNIMFFKIKAYCFFCILSAILSISIFIISMIGA
    KFESREPMFYRGFIVFLTVLIGGLIWSNSVDPSNAIDISKSTEKVSPAITTTSSPQKIKFAKFLSDNNIKMFSAYW
    CPHC
    HDQKQIFGKKAVKELSIIECAQDGKDNQYKLCREKQIEGFPSWEINGEIYSGVKDLNDLAIMTEYDGDSNF