Prochlorococcus marinus NATL2A uid58359

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|72383179|ref|YP_292534.1| methionine sulfoxide reductase B [Prochlorococcus marinus str. NATL2A]
    MFGLLNTLFGFTIKPKSAFASSKSMENYKTLTDTDWENRLPKDAFYVLRKEGTERPFSSPLNDEKRKGVFRCAGCGLALF
    SSTTKFDSGTGWPSFFDHLPDAIETKTDFKLIVPRTEYHCRRCGGHQGHVFNDGPRPTGKRY
    CNNGVALAFEVDS

    >gi|72383279|ref|YP_292634.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. NATL2A]
    MTLCIGDSAPDFTLPNQDGVNISLSSFQGSRVVIYFYPKDDTPGCTKEACSFRDNWELFKSNNIQVLGISKDASKSHIKF
    IDKHKLPFTLLTDSDPCPVAASYESYGLKKFMGREYYGMMRHTFVVNKDGKIELIYLKVKSDNMANQILNDLKLN

    >gi|72383305|ref|YP_292660.1| thioredoxin domain-containing protein [Prochlorococcus marinus str. NATL2A]
    MGPSRLKSRRRQDLGSKWARVAIAILSTVGVIDTGSITLNKWGIIGNLNCPGGLGGCDKVLNSPWGTFFQTNNFSIPLSL
    IGLISYLLILLMAIFPLIPILKNQKNNISKVAWWGSFYISTSTFIFSLILISVMIFKIKAFCFFCLLSFLISLSVLLLNI
    IGGSWEDYGKLFFRGFLMSVAVLLAGLIWSSSVDPAIKEVSNNISGMPPAVIAISSPDKIKLAEHLTKEGAVMYNAYW
    CP
    HCHDQKEMFGKEAAEKLNLVECAKDGFNNKRELCEAKGITGFPSWEINGSIDSGVKSLEELADLTNYKDSKDF

    >gi|72383321|ref|YP_292676.1| hypothetical protein PMN2A_1485 [Prochlorococcus marinus str. NATL2A]
    MIESNAPPTTHKAQDGKGVLITTPALDQLSRLCKEQGSGKLLRVGVRSGGCSGMSYTMDFVSDDDIQKDDEVYEYSVGTS
    SFKVICDPKSLLYIYGMQLDFSTDLIGGGFNFTNPNASQTCGCGSSFAV

    >gi|72383333|ref|YP_292688.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. NATL2A]
    MSNKKIAQSKKSILLDIDGMRCGSCVQAVEKILKNHPNINNASVNLVTKTALVEIKEPNYPFSDVIQTLTSKGFPTTERP
    DQTITKNTELERNENQNLWNKWRQLIIATSLLILSGLGHLVEGQQISFPLIGSLPFHAALATFALLGPGKSILNAGLKSA
    IMLTPTMDTLVSLGVMSAYIASIIALIWPTVGWPCFFNEPVMLLGFVLLGRFLEERARINTGTALKELAKLQPETANLIL
    DNNEIREIRIGALKPGEKIQLLAGDRIPVDGLVIKGNSAIDISSLTGESLPLEATPGVELPSGSLNLESTITLEVQKIGS
    ETAIAKIISLVEEAQARKAPIQGLADKVAGMFCYGVTTLALITFLFWWRIGTRIWPEVLEVSNAGFMHSHNLHDHLMNTP
    QTPIGLSFQLSIAVLVVACPCALGLATPTVITVASGEAAKRGWLFKGGDVIEMASKISQIIFDKTGTLTIGRPLVVGCWK
    NNELERNFMLQLAASIEQESRHPLAQAIIQEAHKKEIKLEKVSSSTTYPGKGLAGKINNLEGLIRVGTPEWIKSEGIEWN
    AMIENNFKLSKRKAQSIVAVALDNKLLGFFLIDDQIRKDAFLSINKLRSRGFSLSLFSGDRDSAVLSIGEKLGFSSKQVT
    WQMLPSDKLNKLNLLKNNGLVAMIGDGINDAPALAAADLGVAIGTGTQIAQDSADLVLLGENLEALPNALNLSKQAMLKI
    KQNLAWAFGYNLIALPIAAGLLLPSSGLLLSPPLAALLMALSSISVVLNALSLKSK

    >gi|72383366|ref|YP_292721.1| rhodanese-like [Prochlorococcus marinus str. NATL2A]
    MNQNIPLNISPKELNKILEDDSSEKPFIVDVREDNEIAIASFSFSVLHLPLSKAANWSDKIVELLPKDQPVVVICHAGVR
    SLNFGIWLLEQGIAKSVWNLVGGIDAWSTDVDQSVPRY

    >gi|72383383|ref|YP_292738.1| glutaredoxin, GrxC [Prochlorococcus marinus str. NATL2A]
    MNRSIPDSGITTVEIYTWRFCPFCLRAKALLNEKGVQFTEYSIDGDDGARTKMSERAGGRRTVPQIFINGKSIGGCDELY
    ELERNNELNELIGIRN

    >gi|72383414|ref|YP_292769.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. NATL2A]
    METIETDVVIVGGGPAGCSCALYTSRADLRTVILDKNPDVGALAITHQIANYPGVSSEMSGEALLKLMRDQATQYGADYR
    RAQVFGIDSSGDWKTIYTPEGTFKAKALVVASGAMGRPASFKGEAEFLGRGVSY
    CATCDGAFYRDREVAVVGINKEAIEE
    ANVLTKFASKVHWITSNDPKPDDHHAQDLLSKPNVNHWSKTRLMQIEGNDGGVTGIKVKNRSIDTHQNLALEGVFVYMSG
    SKPITDFLGEQVAFKEDGGVLVDDFMSTTVEGVWAIGDIRNTPFKQAVVAASDGCIAAMAIDRYLNSRKSIRVDWVHA

    >gi|72383444|ref|YP_292799.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. NATL2A]
    MIDKSNSDTVIGSRQKIFLVILSFFLVVSLFFFRTGFKANEMLNQLAKNSLEPEIALSNGKPTVFEFYADWCEACKEMAP
    DMVNAEKLNSNKIDIVLLNVDNSRWFDLIDKYDVNGIPKLTFFDDQGEFKGFSLGVRKYSELNEIFLALINNSELPSFTK
    LSNSSNLISKNNLKVLNNSIKSEGPRDHS

    >gi|72383503|ref|YP_292858.1| selenide,water dikinase [Prochlorococcus marinus str. NATL2A]
    MFSDHLVLAGGGHTHALVLLQWAMNPKLKPAGMITLVNKASTTVYSGMFPGVIAGKYKIDEILIDLRKLALKAGVSFVMA
    EIEGINLKEKKLLLEGRPEIEYSLLSLNIGTKTNINSKLFNRGDKDLAVPIKPFSESYKFIVDQDIHKNDSSAKPFVIIG
    GGFAGIEIAFSLRKRWPKRPILLKVKSGRNINKNLLRNLKALDIEITQKQPSILYPKLICTGNKSFNWLKDSGLPIDENG
    RVLTKKTLQVLNYPELFAVGDCGVIKDYPRPSSGVWAVRAAKSLANNLEFITKGLKLEEWKPQRKAIQLLDINIRKKKSK
    AFISWGEVIIGPFDFLSSLKELIDKQFISKFDLVKDINSDMSSEEDMIKCRG
    CAAKLAFTPLSSALKKVDLIESSKDDSI
    NIGILNSDKTLIQSVDGFPSLISDPWLNGRLLAFHSCSDIWACGGSVISAQSLINLPSISNNLQQELLYQVLEGINSALT
    IQGANLIGGHTLESRKISEEPFSLGIESSLTVNGVIDDKKYFWPKGGMRNGDEILISRSLGTGIIFSAFMNGQVKPYILD
    NVLKEMNKSQHEIVNYINQLTNLNPRSKIVNACTDITGFGLLGHLSEMLESTNSDQLKMNSEPFKVNLELDKIPLYDGVK
    ELLDKGFESTLAPANQIFLKNIDGDKNLRFELTSNDSCSNRSFYNAMLKILVDPQTCGPLVVCCSSIYSEKLIQQGPWIK
    IGFISK

    >gi|72383681|ref|YP_293036.1| hypothetical protein PMN2A_1845 [Prochlorococcus marinus str. NATL2A]
    MKLFSYSSCSTCRRAIKWLKYNDIPFELIDLLKSPPSKEMLISASELYGDRKYLLNTSGVVYRSMGSDAVKKMSDNDLFE
    QLILEPRLIKRPFLYKSSKCFLVGFKEEKWAEKLL

    >gi|72381842|ref|YP_291197.1| fused glutaredoxin-like domain/phycoerythrin related domain-containing protein [Prochlorococcus marinus str. NATL2A]
    MNPTRNAMSWEELAIYAADPVDQINGLNNPYSSLRLFNKNESQAIVTLYRDNHAWCPYCQKVWIWLELKNIPYRIKKVTM
    RCYGEKERWYLKKVPSGMLPAIEIENHVITESDEILFVLEEIYGPLGQSLNENKVLEHRRLERELFSSWCNWLCRNSLFQ
    AQEEQKKENFKNVANKFEKELQKNASRWLTPVSTKNGEKPGSADVIFIPYVERMNASLAYYKGYSLREEHPIINIWLKNL
    EKLEEYRGTQGDFHTHAHDLPPQMGGCFTYSNKNQQLFAQEIDIGAGLGQLELVDFKVDQKSEQHFEALALERVIRHKER
    IVSVSPMKNKLFDQPLRAALTSMISKKDCRPEENSASALRYLRDRISVPRDMPLLSGRLFRQALERTANIDGSDLGPKIP
    TRNRLDQNPIQFN

    >gi|72381843|ref|YP_291198.1| NADPH-glutathione reductase [Prochlorococcus marinus str. NATL2A]
    MKSSFDLIVIGAGSGGLAAAKKAASYGASVAIVEGDLVGGTCVIRGCVPKKLLVCGSSLLESFLSATSYGFDFDNIKIKS
    EVLLANIRKEVQRLNELHENFLNKANVELFKGWGEFRNSNCVEVKDRKNGETLNELYGERILIAVGGRPKRPSIEGASLG
    WTSDDMFLLKSFPKKITIVGAGYIACEFACILHGLGVEVTQLVRGDRILRGFDFELSSALTEAMKNKGVNISFGEQISSL
    KGTPGSLIIKTNAGKEFDSNGLLFATGREPFLDGLKLEQVGIEILENKIKVDSEGKTNISNIFAIGDVTDRINLTPVAID
    EGRKFADRNYGESDHKVNYNFVPYAVFSQPEIASVGMTEEKAIQSMGKDNIKVYRSIFRPLSKSLPKTGSKCILKLIVDK
    NNNKVLGCHMIGDNASEIIQMASISLMLGAKKSDFDNTMALHPTIAEEFVTMR

    >gi|72381909|ref|YP_291264.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. NATL2A]
    MKHNILYSFRRCPYAIRARWALLNTNQPVELREVELKNKPIELIQISKKATVPVLKTSLNKVIDESLEIMIWSIKRSNMN
    ELFGDKNNDISKEILSLIEINDNAFKYHLDRFKYASRFNIEESETHRSEAMKILLSLNNRLKVYSNEGKPLFLVDAKESL
    ADWAIWPFVRQFRIADTINFDQNYEIQYLRCWLNYFFTHEKYPIVMKKNEPWSKKNEPLFIG

    >gi|72382094|ref|YP_291449.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. NATL2A]
    MIKKIIKYLTLIIDKLYSVKSIEKTNKKLQHTILKNDLTAKLKDNEQEILFGCGCFWGAEKGFWRLPGVITTSVGYAGGE
    KENPNYREVCSGLTGHTEVVRVVWNNNEIDLSDLLKLFWECHDPTQGNRQGNDSGSQYRSAIYTTSKEQLSKAIESKNSY
    QIELKNNGFGIITTEIENDIKFYFAEDYHQQYLAKPGSRPYCSAMPTKVTFKNFSGANFKLNEKIWSNYNWDITHCILRG
    ENTPIESNL

    >gi|72382144|ref|YP_291499.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Prochlorococcus marinus str. NATL2A]
    MKRSEFIKSFILFSSILFIKPSRLFASINSVKIGKKAPNFLLNGYNKNSPNKKQWSLDDFSKKWLVLYFYPKDFSSGCTL
    EAKNFQDNLSKYNKINASIVGISADSEEEHESFCTSENLGYTLLSDANSVISKSYDSWLDPYSKRNTFLINPEGIVVYKW
    IGVRPIGHAQEVLKELTKQQKIYA

    >gi|72382192|ref|YP_291547.1| thioredoxin peroxidase [Prochlorococcus marinus str. NATL2A]
    MTTNECLRVGMQAPDFATTAVVDQEFKDITLSQYRGKYVVLFFYPLDFTFVCPTEITAFSDRYSDFSSKNTEVLGVSVDS
    KFTHLAWIQTPRNEGGIGDINYPLVSDLKREICQSYNVLNEDGEADRGLFIINPSGIIMHSTINKAPVGRNIDETLRVLQ
    AYQYVESHPDEVCPAGWTPGDKTMKEDPKGSKEYFSAL

    >gi|72382377|ref|YP_291732.1| hypothetical protein PMN2A_0538 [Prochlorococcus marinus str. NATL2A]
    MSSTEAMPKTRTFSEFAKQADYSLMDSLKADPQATDDGDDHLTREVFSGHYVPVTPTAISKPEYVTHSKTLFNELGLSQE
    LALDELFRRLFSGDISVATAPMRPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRWEMQLKGGGPT
    PYCRGADGRAVLRSSVREFLAQDYMQSLGVPTSRSLTLYASRSETVRRPWYTKDSNSINPDILVETPAAISTRVAPSFLR
    VGQIELFARRVRNNEHQDAMKELEMIVKHLIVRNYKKEIDPTLSFSNQVVELANSFRERLTSLVANWMRIGYCQGNFNSD
    NCAAGGFTLDYGPFGFCELFDPRFQPWTGGGEHFAFFNQQVAAEANYQMFWGALRPLLNGNAESLERLDSIRDGFTTVMN
    QKMENMWAKKLGLVTYDAPLVNEMLRLMVHTKVDYTIFFRKLSSIPNKLTDLKDSFYLPISEETESKWISWLQRWREQVI
    SKGDQNEISAKMKSINPKYTWREWLITPAYEKAEEGDYGLIKELQAVLDEPYEEQSLEIQKKYDRLKPKKFFGAGGVSHY
    S
    CSS

    >gi|72382427|ref|YP_291782.1| hypothetical protein PMN2A_0588 [Prochlorococcus marinus str. NATL2A]
    MIYPKTLQLESGSDLLNSLQALATKENKLGYVLSVVGNLSIAKFQCPGKGEATTIKNHLEIIGLNGTISPNKCHLHISLS
    DGECKVWAGHLEEGTIILKGADLLIGFLDETISKKEVNTNQQAVEIFILPD
    CPWSSRAVRMLRTLQIPHEIKVIENDEDF
    NSLHKRSNYSSFPQIFIDEEFIGGYTELSELHASGKLSSF

    >gi|72382478|ref|YP_291833.1| glutaredoxin-like protein [Prochlorococcus marinus str. NATL2A]
    MDSNTRSKIESLINSKPIFVFMKGNKLMPQCGFSNNVVQILNSLGMSFETFDVLSDMEIREGIKEYSNWPTIPQVYLKGE
    FMGGSDILISMYNSGELKEKLEIALAS

    >gi|72382493|ref|YP_291848.1| rhodanese-like [Prochlorococcus marinus str. NATL2A]
    MKKDDRLKKFKYKVAAFYNFISIIDEEILLIKEELTKLATNQKIKGTILLASEGVNGTICGPENAIVQFIETLEKLLKVS
    DINVKYSWSEKQAFRRFKARKKKEIVTIGLKEINPTKSVGKYIKAGEWNQFLEDPNSVVIDTRNEYEIKIGNFAGALNPQ
    TSSFREFPAWVQKHLKPLIEENPSLKIGMY
    CTGGIRCEKATSYLIEEGFSDVHHLEGGILKYLEDVSSENSLWNGECFVF
    DQRVSLDHELLPGSHRMCHACGLPISPEDLKKPTYIKGLQCDACVNKFTDSDRARFAERQRQIDEIMKRLPENSIWPSS

    >gi|72382530|ref|YP_291885.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
    MSTASAVTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVAPIVEEISKDFEGKIKVYKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSGTISKHL

    >gi|72382566|ref|YP_291921.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. NATL2A]
    MKLKVGDQIPSFSLKDQKGNIRTSNNLKKSLVLFFYPKDDTPGCTIEACGFRDKYDLFKILGAEVWGISNGSTQSHLGFA
    NKNKLQYPLLCDQNNILRNQFGVPKKLGFIEGRVTYIINSEGVIKHIFEDLLNGPAHIKEAIKALKKLQ

    >gi|72382597|ref|YP_291952.1| thioredoxin reductase [Prochlorococcus marinus str. NATL2A]
    MPAENKELKTENLVIIGSGPAGYTAAIYAARANLQPLIITGFEKGGIPGGQLMTTTFVENFPGFPNGVQGPELMDLIKAQ
    AVRWGTNLIEEDAISIDLSKRPFSIVTTTQKIKTNSLIISTGASANRLGLKNEKLFWSKGISA
    CAICDGATPQFRDEELA
    VVGGGDSACEEAEYLTKYGSHVHLLVRSRKLRASAAMADRVEANPNITIHWETELLDVLGNDWLEKLKVKRRDTNQEEEI
    LAKGLFYAIGHTPNTSLFTNQLSTDSKGYLLTQPGRPETSLEGVYAAGDVADSEWRQGVTAAGSGCKAALAAERWLTKNN
    LATLIKRVELEPSKADTTKILEVSNEANFDPEKTWQKGSYALRKLYHETEKPLFVVYTSSS
    CGPCHILKPQLHRVLNESK
    GKAIGVEIDIENDQDIAKQAEVSGTPTVHLFKNKELKKQWKGVKTRSEYKAALDELIN

    >gi|72382626|ref|YP_291981.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. NATL2A]
    MPLKLGDQIPDFSLSDQLGVSRTNKQAKGRPLVLFFYPKDDTPGCTAENCGFRDKYDLFKLFGAEVWGVSGDDEASHRSF
    ADKNKLPFPLLCDTENSLRRAFGVPKVLGLLDGRVTYIIDSKGVIRHIFNDLLNGPAHVNEALRVLGEIRN

    >gi|72382703|ref|YP_292058.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. NATL2A]
    MSEISFDFDLIVVGAGYGGFDAAKHAAEAGLKVAIVESRDMGGTCVNRGCVPSKALLAASGKVRELADVPHLSEFGIHSA
    PVRFERKKIAEHAKNLVETIRKNLTKTLERSGVEILRGEGRLEGNQKVGLRETNGVDRIFSARDIILATGSDPFVPPGIE
    IDGRTVFTSDEAINLEWLPRWIAIIGSGYIGLEFADIYTALGCEVTMIEALDKVMPTFDPDITKIASRNLIDKRDIETRA
    GVFATKVKPGCPVEVELTDAKSREVIEELQVDAVLVATGRVPSTENLNLQSVGVETTRGFIPIDDQMRVLVNEKPVSNLW
    AVGDVTGKLMLAHTAAAQGSIAVENILGKAIEIDYRSIPAATFTHPEISSVGLSEEEAKDLAKNEGFELGIVRSYFKANS
    KALAELESDGIMKLIFNKETGEVLGAHIYGLHAADLIQEVSNAISRRQRVNDLAKEVHTHPTLSEVVEVAYKQASLQIKK


    >gi|72382743|ref|YP_292098.1| methionine sulfoxide reductase A [Prochlorococcus marinus str. NATL2A]
    MISMHKIFRRLIVFSILLQLLIACPLQAFAESEEAIFAGGCFWCLEHDLEKLDGVVSAESGYSGGDLINPTYQDHSGHQE
    VVKVVFDSDIISYKDLLKQYWVNIDPFDNNGQFCDRGYSYKPVIFTSNQEQKRDAKESQETISVGLNIPLEQLKVDIVES
    KVFWLAENYHQDFAVKNPLKYNFYRSSCGRDNRLKKVWGEYKY

    >gi|72382776|ref|YP_292131.1| redox protein [Prochlorococcus marinus str. NATL2A]
    MHTEAKHSLSGSVIHTDAPTDHDGEGKDFAPTDLLASSLGTCVITIMAIEAKRRGWKLGNIKIDVYKTMTSEGPRKIKTL
    VLEIFMPADLDSQTYKILQNTAEDCPVKLNLECSIDIKLKWH

    >gi|72382979|ref|YP_292334.1| rhodanese-like [Prochlorococcus marinus str. NATL2A]
    MEQSQNEANLSSEEIDRYARHISLPEIGIKGQEKLKTSSVACIGTGGLGSPLLIYLAAAGIGRIGIIDFDVVEYSNLQRQ
    IIHTTDSIGLLKTDSAKQHIRKINPSCRVDLFNQKLTSSNALEILKAYDVICDCSDNFPTRYLINDACLILNKPNIYGSI
    ARFEGQVSVFNLKEDSPNYRDLIPTPPPQELIPS
    CSEAGVMGILPGIIGTIQAAEAIKIITNIGYPLNGRILIFNALKMQ
    FKELTLKSNPENKNIHKLIDYKSFCSEVKVKDEVECDIESISIKELKVLLSQSSKEILLIDVRNQNEYNQCSITGSLLMP
    LSSIESGKAIDEIKILTAKKNLYVLCKSGKRSLLALKHLNKFGIIGINILGGIDAWNSEKN

    >gi|72383047|ref|YP_292402.1| glutathione peroxidase [Prochlorococcus marinus str. NATL2A]
    MSVNISKVEVFSFKNQKITFDHYKGNVLLIVNVASKCGFTKQYKALQYLQDKYESKGFKVLGFPCNDFGNQEPGQLEEIK
    EFCSTTYGVNFQLFQKVHAKGKTTEPFTTLNQVSPSGDVEWNFEKFLINTEGDAVARFKSSIEPDSPEVTQAIEKLLD