Prochlorococcus marinus NATL1A uid58423

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124024727|ref|YP_001013843.1| hypothetical protein NATL1_00141 [Prochlorococcus marinus str. NATL1A]
    MFGLLNTLFGFTIEPKSAFASSKPMENYKTLTDADWENRLPKDAFYVLRKEGTERPFSSSLNDEKRKGVFRCAGCGLALF
    SSTTKFDSGTGWPSFFDHLPDAIETKTDFKLIVPRTEYHCRRCGGHQGHVFNDGPRPTGKRY
    CNNGVALAFEVDS

    >gi|124024857|ref|YP_001013973.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. NATL1A]
    MTLCIGDSAPDFTLPNQDGVDISLSSFQGSRVVIYFYPKDDTPGCTKEACSFRDNWELFKSNNIQVLGISKDASKSHIKF
    IDKHKLPFTLLTDSDPCPVAASYESYGLKKFMGREYYGMMRHTFVVNKYGKIELIYLKVKSDNMANQILNDLKLN

    >gi|124024885|ref|YP_001014001.1| hypothetical protein NATL1_01721 [Prochlorococcus marinus str. NATL1A]
    MGPSRLKSRRRQDLGSKWARVAIAILSTVGVIDTGSITLNKWGIIGNLNCPGGLGGCDKVLNSPWGTFFQTNNFSIPLSL
    IGLISYLLILLMAIFPLTPILKNQKTNISKVAWWGSFYISTSTFIFSLILISVMIFKIKAFCFFCLLSFLISLSVLLLNI
    IGGSWEDYGKLFFRGFLMSVAVLLAGLIWSSSVDPAIKEVSNNISGMPPAVIAISSPNKIKLAEHLTEEGAVMYNAYW
    CP
    HCHDQKEMFGKEAAEKLNLVECAKDGFNNKRELCEAKGITGFPSWEINGSIDSGVKSLEELADLTNYKDSKDF

    >gi|124024903|ref|YP_001014019.1| hypothetical protein NATL1_01901 [Prochlorococcus marinus str. NATL1A]
    MSESSAPPTTHKAQGGKGVLITTPALDQLSRLCKEQGSGKLLRVGVRSGGCSGMSYTMDFVSDDDIQKDDEVYEYSVGSS
    SFKVICDPKSLLYIYGMQLDFSTDLIGGGFNFTNPNASQTCGCGSSFAV

    >gi|124024916|ref|YP_001014032.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. NATL1A]
    MSNKKIAQSKKSILLDIDGMRCGSCVQAVEKILKNHPNINNASVNLVTKTALVEIKEPNYPFADVIQTLTSKGFPTRERP
    DQTITKNTELERNENQNLWNKWRQLIIATSLLILSGLGHLIEGQQISFPLIGSLPFHAALATFALLGPGKSILNAGIKSA
    IMLTPTMDTLVSLGVMSAYIASIIALIWPTVGWPCFFNEPVMLLGFVLLGRFLEERARINTGTALKELAKLQPETANLIL
    DNNEIREIRIGALRPGEKIQLLAGDRIPVDGLVIKGNSAIDISSLTGESLPLEAKPGVELPSGSLNLESTITLEVQKIGS
    ETAIAKIISLVEEAQARKAPIQGLADKVAGMFCYGVTTLSLITFLFWWRIGTRIWPEVLEVSNTGFMHSHNLHDHLMNTP
    QTPIGLSFQLSIAVLVVACPCALGLATPTVITVASGEAAKRGWLFKGGDVIEMASKISQIIFDKTGTLTIGRPLVVGCWK
    NNESERNFMLKLAASIELESRHPLAQAIIQEAHKKEIKLEKVSSSTTYPGKGLAGKINNLEGLIRVGTPEWIKSEGIEWN
    EMIENNFKLSKRKAQSIVAVALDNKLLGFFLIDDQIRKDAFLSINKLRSRGFSLSLFSGDRDSAVLSIGEKLGFSAKQVT
    WQMLPSDKLNKLNLLKNNGLVAMIGDGINDAPALAAADLGVAIGTGTQIAQDSADLVLLGENLEALPNAFNLSKQAMLKI
    KQNLAWAFGYNLIALPIAAGLLLPSSGLLLSPPLAALLMALSSISVVLNALSLKSK

    >gi|124024950|ref|YP_001014066.1| rhodanese-like protein [Prochlorococcus marinus str. NATL1A]
    MNQNIPLNISPKELNKILEDDSSEKPFIVDVREDNEIAIASFSFSVLHLPLSKAANWSDKIGELLPKDQPVVVICHAGVR
    SLNFGIWLLEQGIAKSVWNLVGGIDAWSTDVDQSVPRY

    >gi|124024967|ref|YP_001014083.1| glutaredoxin [Prochlorococcus marinus str. NATL1A]
    MNRSIPDSGITTVEIYTWRFCPFCLRAKALLNEKGVQFTEYSIDGDDGARTKMSERAGGRRTVPQIFINGKSIGGCDELY
    ELERNNELNELIGIRN

    >gi|124025001|ref|YP_001014117.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. NATL1A]
    METIETDVVIVGGGPAGCSCALYTSRADLRTVILDKNPDVGALAITHQIANYPGVSSEMSGEALLKLMRDQATQYGADYR
    RAQVFGIDSSGDWKTIYTPEGTFKAKALVVASGAMGRPASFKGEAEFLGRGVSY
    CATCDGAFYRDREVAVVGINKEAIEE
    ANVLTKFASKVHWITSNDPKSDDHHAQDLLSKPNVNHWSKTRLMQIEGNDGGVTGIKVKNRSIDTLQDLALEGVFVYMSG
    SKPITDFLGEQVAFKEDGGVLVDDFMSTTVEGVWAIGDIRNTPFKQAVVAASDGCIAAMAIDRYLNSRKSIRVDWVHA

    >gi|124025033|ref|YP_001014149.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. NATL1A]
    MIDNSNSDTALGPRQKIFLVILSFFLVVSLFFFRTGFKANEMLDQLAKNSLEPEIALSNGKPTVFEFYADWCEACKEMAP
    EMVNAEKLNSNKIDIVLLNVDNSRWFDLIDKYDVNGIPQLTFFDDQGDFKGFSLGVRKYSELNQIFLALINNSELPAFTK
    LSNSSNLISKNNLKVLDNNIRSEGPRDHS

    >gi|124025094|ref|YP_001014210.1| selenide,water dikinase [Prochlorococcus marinus str. NATL1A]
    MFSDHLVLAGGGHTHALVLLQWAMNPKLKPAGMITLVNKASTTVYSGMFPGVIAGKYKIDEILIDLRKLALKAGVSFVMA
    EIEGINLKEKKLLLAGRPEIEYSLLSLNIGTKTNINSKLFIRGDKDLAVPIKPFSESYKFIVDQDIHKNDSSAKPFVIIG
    GGFAGIEIAFSLRKRWPKRPILLKVKSGRNINKNLLRNLKALDIEITQKQPSILYPKLICTGNKSFNWLKDSGLPIDENG
    RVLTEKTLQVLNYPELFAVGDCGVIKDYPRPSSGVWAVRAAKPLANNLEFITKGLKLEEWKPQRKAIQLLDINIRKKKSK
    AFISWGEVIIGPFDFLSSFKELIDKQFISKFDLVKDINSDMSSEEEMIKCRG
    CAAKLAFTPLSSALKKVDLIESSKDDSI
    NIGILNSDKTLIQSVDGFPSLISDPWLNGRLLAFHSCSDIWACGGSVISAQSLINLPSISNNLQKELLYQVLEGINSALT
    IQGANLIGGHTLESRKISEEPFSLGIESSLTVNGVIDDKKYFWPKGGMRNGDEILISRSLGTGIIFSAFMNGQVKPYILD
    NVLKEMNKSQHEIVNYINQLTNLNPRSKIVNACTDITGFGLLGHLSEMLESTNSDQLKMNLEPFKVTLELDNIPLYDGAK
    ELLDKGFESTLAPANQIFLKNIDGDKNLRFELKSNDSSSNRSFYNAMLKILVDPQTCGPLVVCCSSIYSEKLIQQGPWIK
    IGFISK

    >gi|124025281|ref|YP_001014397.1| putative arsenate reductase [Prochlorococcus marinus str. NATL1A]
    MGKLIFLGFENLKLFNYSSCSTCRRAIKWLKNNDITFELIDLLKSPPSKEMLISASELYGDRKYLINTSGFIYRSIGSDA
    VKKMSDNEFFEQLFIEPRLIKRPFLYKSNKCFLVGFKEEKWAEKLL

    >gi|124025332|ref|YP_001014448.1| glutathione S-transferase [Prochlorococcus marinus str. NATL1A]
    MNPTRNAMSWEELAIYAADPIDQINGLNNPYSTLRLFNKSESQAIVTLYRDNHAWCPYCQKVWIWLELKNIPYRIKKVTM
    RCYGEKEKWYLKKVPSGMLPAIEIENHVITESDEILFVLEEIYGPLGQSLNENKVLEHRRLERELFSSWCNWLCRNSLFQ
    AQEEQKKENFKNVANKFEKELQKNASGWLTPVSTKNGEKPGSADVIFIPYVERMNASLAYYKGYSLRDEHPIINTWLKNL
    EKLEEYRGTQGDFHTHAHDLPPQMGGCFTYSNKNQQLFAQEIDIGSGLGQLELVDFKVDQKSEQHFEALALERVIRHKER
    IVSVSPMKNKLFDQPLRAALTSMISKKDCLPEQNSASALRYLRDRISVPRDMPLLSGRLFRQALERTANIDGSDPGPEIP
    TRNRLDQNPIQFN

    >gi|124025333|ref|YP_001014449.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. NATL1A]
    MKSSFDLIVIGAGSGGLAAAKKAASYGASVAIVEGDLVGGTCVIRGCVPKKLLVCGSSLLESFLSATSYGFDFDNLKIKS
    EVLLANVRKEVHRLNELHENFLNKANVELFKGWGEFRNSNCVEVKDRKNGETLNELYGERILIAVGGRPKRPSIEGASLG
    WTSDDMFLLKSFPKKITIVGAGYIACEFACILHGLGVEVTQLVRGDRILRGFDFELSSSLTEAMKNKGVNISFGEKISSL
    KGTPGSLIIKTNAGKEFDSNGLLFATGREPFLDGLKLEQAGIEILENKIKVDSEGKTNISNIFAIGDVTDRINLTPVAID
    EGRKFADRNYGESDHKVNYNFVPYAVFSQPEIASVGMTEEKAIQSIGKDNIKVYRSIFRPLSKSLPKTGSKCILKLIVDK
    NNNKVLGCHMIGDNASEIIQMASISLMLGAKKTDFDNTMALHPTIAEEFVTMR

    >gi|124025400|ref|YP_001014516.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. NATL1A]
    MKHNILYSFRRCPYAIRARWALLNTNQVVELREVELKNKPIELIEISKKATVPVLKTSLNKVIDESLEIMIWSIKRSNMH
    ELFGDKNNDISKEILSLIEINDNAFKYHLDRFKYASRFNVEESETHRSEAMKILLSLNNRLKVYSKEGKPLFLVDAKESL
    ADWAIWPFVRQFRIADITKFDQNREIQYLRCWLNYFFTHEKYSMVMKKNEPWSKKNEPLFFG

    >gi|124025630|ref|YP_001014746.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. NATL1A]
    MIKKIIKYLTLIIDKLYSDKSIEKTNKKLQHTILKNDLTAKLKDNEQEILFGCGCFWGAEKGFWRLPGVITTAVGYAGGE
    KEKPNYREVCSGLTGHTEVVRVVWNNNEIDLSDLLKLFWECHDPTQGNRQGNDSGSQYRSAIYTTSKEQLSKAIESKNSY
    QIELQNNGFGIITTEIENDIKFYFAEDYHQQYLAKPGSRPYCSAMPTKVKFKNFSGANFKLNEKIWSNYNWDITHCILRG
    ENTPIESN

    >gi|124025683|ref|YP_001014799.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. NATL1A]
    MKRSEFIKSFILFSSILFIKPSRLYASINSVKIGKKAPNFLLNGYNKNSPNKKQWSLDDFSKKWLVLYFYPKDFSSGCTL
    EAKNFQDNLSNYNKINASIVGISADSEEEHESFCTSENLGYTLLSDANSEISKSYDSWLDPYSKRNTFLINPEGIVVYKW
    IGVRPIGHAQEVLKELTKQQKIYA

    >gi|124025740|ref|YP_001014856.1| thioredoxin peroxidase [Prochlorococcus marinus str. NATL1A]
    MTTNECLRVGMQAPDFATTAVVDQEFKDITLSQYRGKYVVLFFYPLDFTFVCPTEITAFSDRYSDFSSKNTEVLGVSVDS
    KFTHLAWIQTPRNEGGIGDINYPLVSDLKREICQSYNVLNEDGEADRGLFIINPSGIIMHSTINKAPVGRNIDETLRVLQ
    AYQYVESHPDEVCPAGWTPGDKTMKEDPKGSKEYFSAL

    >gi|124025991|ref|YP_001015107.1| hypothetical protein NATL1_12841 [Prochlorococcus marinus str. NATL1A]
    MSSTEAMPKTRTFSEFAKQADYSLMDSLEADPQATDDGDDHLTREVFSGHYVPVTPTPISKPEYVTHSKTLFNELGLSQE
    LALDELFRRLFSGDISVATAPMRPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRWEMQLKGGGPT
    PYCRGADGRAVLRSSVREFLAQDYMQSLGVPTSRSLTLYASRAETVRRPWYTKDSNSINPDILVETPAAISTRVAPSFLR
    VGQIELFARRVRNNEHQDAMKELEMIVKHLIVRNYKKEIDPTLSLSNQVVELSNSFRERLTSLVANWMRVGYCQGNFNSD
    NCAAGGFTLDYGPFGFCELFDPRFQPWTGGGEHFAFFNQQVAAETNFQMFCGALRPLLNGNAESLERLDSIRNGFTTVMN
    QKMERMWAKKLGLVTYDAPLVNEMLRLMVHTKVDYTIFFRKLSSIPNKLTDLKDSFYLPISEETESKWISWLQRWREQVI
    SKGDQNEISAKMKSINPKYTWREWLITPAYEKAEEGDYGLIKELQAVLDKPYEEQSSKVQKKYDRLKPKKFFGAGGVSHY
    S
    CSS

    >gi|124026080|ref|YP_001015196.1| hypothetical protein NATL1_13731 [Prochlorococcus marinus str. NATL1A]
    MIYPKTLQLESGSDLLNSLQALATKENKLGYVLSVVGNLSIAKFQCPGKGEATTVKNHLEIIGLNGTISPNKCHLHISLS
    DGECKVWAGHLEEGTIILKGADLLIGFLDETISKKEVNTNQQAVEIFILPD
    CPWSSRAIRMLRTLQIPHEIKVIENDEDF
    NSLHKRSNYSSFPQIFIDEEFIGGYTELSELHASGKLSSF

    >gi|124026177|ref|YP_001015293.1| glutaredoxin-like protein [Prochlorococcus marinus str. NATL1A]
    MDSNTRSKIESLINSKPIFVFMKGNKLMPQCGFSNNVVQILNSLGMSFETFDVLSDMEIREGIKEYSNWPTIPQVYLKGE
    FMGGSDILISMYNSGELKEKLEIALAS

    >gi|124026231|ref|YP_001015347.1| thioredoxin [Prochlorococcus marinus str. NATL1A]
    MSTASAVTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVAPIVEEISKDFEGKIKVYKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSGTISKHL

    >gi|124026271|ref|YP_001015387.1| peroxiredoxin [Prochlorococcus marinus str. NATL1A]
    MKLKIGDQIPSFSLKDQKGNIRTSNNLKKSLVLFFYPKDDTPGCTIEVCGFRDKYDLFKILGAEVWGISNGSSQSHLGFA
    NKNKLQYPLLCDQNNILRNQFGVPKKLGFIEGRVTYIINSEGVIKHIFEDLLNGPAHIKEAIKALKKLQ

    >gi|124026304|ref|YP_001015420.1| putative thioredoxin reductase [Prochlorococcus marinus str. NATL1A]
    MPAENKELKTENLVIIGSGPAGYTAAIYAARANLQPLIITGFEKGGIPGGQLMTTTFVENFPGFPNGVQGPELMDLIKAQ
    AVRWGTNLIEEDAISIDLSKRPFSIVTTTKKIKTNSLIISTGASANRLGLKNEKLFWSKGISA
    CAICDGATPQFRDEELA
    VIGGGDSACEEAEYLTKYGSHVHLLVRSRKLRASAAMADRVEANPNITIHWETELLDVLGNDWLEKLKVKRKDTNQEYEI
    LAKGLFYAIGHTPNTSLFTNQLNKDSKGYLITQPGRPETSLEGVYAAGDVADSEWRQGVTAAGSGCKAALAAERWLTKNN
    LATLIKRIELEPSKAEKAKTLEISNEANFDPDKTWQKGSYALRKLYHETEKPLFVVYTSSS
    CGPCHILKPQLLRVLNESK
    GKAIGVEIDIENDQDIAKQAEVSGTPTVHLFKNKELKKQWKGVKTRSAYKAALDELIN

    >gi|124026345|ref|YP_001015461.1| peroxiredoxin [Prochlorococcus marinus str. NATL1A]
    MPLKLGDQIPDFSLSDQLGVSRTNKQAKGRPLVLFFYPKDDTPGCTAENCGFRDKYDLFKLFGAEVWGVSGDDEASHRSF
    ADKNKLPFPLLCDTENSLRRAFGVPKVLGLLDGRVTYIIDSKGVIRHIFNDLLNGPAHVNEALRVLGEIRN

    >gi|124026422|ref|YP_001015537.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. NATL1A]
    MSEISFDFDLIVVGAGYGGFDAAKHAAEAGLKVAIVESRDMGGTCVNRGCVPSKALLAASGKVRELADVPHLAEFGIHSA
    PVRFERKKIAEHAKNLVETIRKNLTKTLERSGVEILRGEGRLEGNQKVGLRETNGVDRIFSARDIILATGSDPFVPPGIE
    IDGRTVFTSDEAINLEWLPRWIAIIGSGYIGLEFADIYTALGCEVTMIEALDKVMPTFDPDITKIASRNLIDKRDIETRA
    GVFATKVKPGCPVEVELTDAKSREVIEELQVDAVLVATGRVPSTENLNLQSVGVETTRGFIPIDDQMRVLVNEKPVSNLW
    AVGDVTGKLMLAHTAAAQGSIAVENILGKAIEIDYRSIPAATFTHPEISSVGLSEEEAKDLAKNEGFELGIVRSYFKANS
    KALAELESDGIMKLIFNKETGEVLGAHIYGLHAADLIQEVSNAISRRQRVIDLAKEVHTHPTLSEVVEVAYKQASLQIKK


    >gi|124026465|ref|YP_001015580.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. NATL1A]
    MIAMNKIFRRLIVFSILLQLLIACPLKAFAESEEAIFAGGCFWCLEHDLEKLDGVVSAESGYSGGDLINPTYQDHSGHQE
    VVKVIFDSDIISYKDLLKQYWVNIDPFDNNGQFCDRGDSYKPVIFTSNQEQKRDAKESQETISVGLNIPLEQLKVDIVES
    KVFWLAENYHQDFAVKNPLKYNFYRTSCGRDNRLKKVWGEYKY

    >gi|124026499|ref|YP_001015614.1| hypothetical protein NATL1_17941 [Prochlorococcus marinus str. NATL1A]
    MHTEAKHSLSGSVIHTDAPKDHDGEGKDFAPTDLLASSLGTCVITIMAIEAKRRGWKLGNIKIDVYKTMTSEGPRKIKTL
    VLEIFMPSDLDSQKYKILQNTANDCPVKLNLECSIDIKLKWH

    >gi|124026720|ref|YP_001015835.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. NATL1A]
    MEQSQSKANLSSEEIARYARHISLPEIGIKGQEKLKTSSVACIGTGGLGSPLLIYLAAAGIGRIGIVDFDVVEYSNLQRQ
    IIHTTHSIGLLKTDSAKQAIRKINPSCRVDLFNQKLTSSNALEILKAYDVICDCSDNFPTRYLINDACLILNKPNIYGSI
    ARFEGQVSVFNLKEDSPNYRDLIPIPPPQELIPS
    CSEAGVMGILPGIIGTIQAAEAIKIITNIGYPLNGRILIFNALKMQ
    FKELTLKSNPENKNIHKLIDYKSFCSEISVKDEVECDIESISVKELKVLLRQSSKEMLLIDVRNQDEYHQCSITGSLLIP
    LNSIESGKAIDEIKILTAKKNLYVF
    CKSGKRSLLALKHLNKFGIRGINILGGIDAWNSEKN

    >gi|124026789|ref|YP_001015904.1| glutathione peroxidase [Prochlorococcus marinus str. NATL1A]
    MSVNISKVEVFSFKNQKITFDHYKGNVLLIVNVASKCGFTKQYKALQYLQDKYESKGFKVLGFPCNDFGNQEPGQLEEIK
    EFCSTTYGVTFQLFQKVHAKGKTTEPFTTLNQLSPSGDVEWNFEKFLINTEGDAVLRFKSSIEPDSPEITQAIEKLLD

    >gi|124025469|ref|YP_001014585.1| hypothetical protein NATL1_07621 [Prochlorococcus marinus str. NATL1A]
    MISDLVIIGGGASGFMAAITAITNGLRSVVILEGASKVLEKVRISGGGRCNLTNSCFEISDLVNNYPRGEKQLLGLFNRF
    STTEAFDWFQEKGLSLKVEKDGRVFPCSDSSEEVISCLTNVAKNSGVKVLTNSYVKQISKIEGGFNLLVKGDNSFKAKNI
    LICTGGHSSGRRLAMSLGHSIIHPVPSLFSFSTVDSSLKDCSGITLDVQVKLNVNNKKYFEKGPILITHKGFSGPVILRL
    SAFSARNLYDNKYKAELRINWLCMNENEARLKIDLYKLENGKKLVFNYKPFDKLPRSLWKSFLLSLNIDSQLKWAELSKT
    KKESLIKYLIMKTYLIKGRGPFGEEFVTAGGVSLKEINFKTMESKITKGVFFAGEVLDIDGVTGGFNFQHCWTSGWVAGK
    SIVVKYS