Prochlorococcus marinus MIT 9515 uid58313

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|123965249|ref|YP_001010330.1| hypothetical protein P9515_00141 [Prochlorococcus marinus str. MIT 9515]
    MNQFLSRRSFILIPAMSILKFFLKPKKVLASSTASEEDWNLSKEEWKNKLSPESYYILREEGTERAFSSQLNNEKRKGIF
    ACAGCNQHLFTSDTKFDSGTGWPSFWDPINGSVETKVDFKLIVPRTEYHCSRCEGHQGHVFNDGPLPTGKRY
    CNNGLALK
    FIAE

    >gi|123965324|ref|YP_001010405.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9515]
    MALRVGDVAPEFKLKDSFEKDVSLKDFKGKRIILYFYPKDNTPGCTKEACNFKENWDLLKQNNFVVIGISKDSSASHLKF
    IEKFDLPFVLLTDPEPFKVSSDYDSYGLKKFMGKEYMGMMRNTFLIDADGKVEKIYLKVKAAIMADHIISDLGLR

    >gi|123965365|ref|YP_001010446.1| hypothetical protein P9515_01301 [Prochlorococcus marinus str. MIT 9515]
    MENLEVDEKIKTSDDGKGILITNAAIEQVSFLLKNQTDKKALRVGVRSGGCSGMSYTMDFIGGDQINADDKVYDYSLSSE
    QSFKVVCDPKSLLYIYGMQLDFSKDLIGGGFNFVNPNASQTCGCGSSFAV

    >gi|123965394|ref|YP_001010475.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9515]
    MKSIQLNINGMKCGGCVNTVENILKNSDGIENVSVNLLTESAYIEVNKTFQNIDQVLENLNQSGFPSKIYINDFSKKVNK
    VQLEKKKKWVNQWKKLTFALLLLLLSGLGHLAEGGYLNLPILGNLFFHALLATTALLFPGREILIKGFKSFLRNRPDMDS
    LVALGVTSAYITSLLSLIFPSTGFPCFFNEPVMLLGFILIGRFLEERAKYHTGSSIGELLDLQPEMANIYLEENKVKSVR
    VHSLKPGDEIQLLAGDRVPADCTVIEGNSSLDVSHITGESKPINVRPGEHLLNGSLNLNSTLRLKVIKVGDDTSLAKLVN
    LIESVQFNKPPIQRIADQIAGKFTYFVLFIATSSFFFWWKGAKQIWPDLLIHDHHGLIDASNHTLHNSLGSNAENFLSLA
    IQLSIAVLVIACPCALGLATPTVITVASGKAAKKGILFKGGDKIEMASKINHIIFDKTGTLTKGEPFIINYINSDDNLYL
    LKVSASLESQSRHPIAKALVKEANKQNLSLLPIKSIHTESGRGISGDLESIDGVINIGSIEWLISKGVIIDSESQKMLET
    QENKSHSVIGVSINNELLGFILLGDLLREDSISSVQKLRKDNYKINILSGDRKETVVELAKKIGSPEDEIKWDLLPEMKL
    KIIENLKENYKVAMIGDGINDAPALAASNLGIAVGSGTQIAKANADVVLMGDHLSGLPYALSLAKRTIRKIKQNIFWAFG
    YNLIAIPLAAGILFPKYGILLTPSIAALLMATSSITVVINALSLE

    >gi|123965443|ref|YP_001010524.1| glutaredoxin [Prochlorococcus marinus str. MIT 9515]
    MSTVEIYTWRFCPFCIRAKSLLEKKNITFTEHKIDGDDDARELMTKRANGKRTVPQIFINNKSIGGCDELYELEKEEKLD
    LLLN

    >gi|123965475|ref|YP_001010556.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9515]
    MEIIETDVAIVGGGPAGCTCALYTSRSNLKTVIIDKNPSVGALAITHQIANYPGVPVDISGEKLLTLMREQAVQYGTDYR
    RAQVFGIDVGKDWKTVYTPEGTFKAKALVLASGAMGRPASFKGEADFLGKGVSY
    CATCDGAFYKNREVAVVGANKEAIEE
    ATVLTKFASTVHWITSSDPKQDNEEAKELMDISNIKHWSRTRLLEILGNDMGVNRVIVKNKQEEGPINIDLDGVFVYMSG
    SKPITDFLGDQIALKEDGGVIVDDFMSTNSDGVWAIGDIRNTPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS

    >gi|123965510|ref|YP_001010591.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9515]
    MMQSGNKESFLNLSQKSILILSFTLIIGSLLLFKNLVFQPNFLLKKFGELTIDPEIAFTNKKPTFLEFYAEWCEVCKEMA
    PSVADIKEEYEKDINFVFLNVDNPKWEKYIRNFNVNGIPQVNLFDEDANLEVTFIGKQQEKTIKESLDNLYEHSQSNLQI
    LNTEFSKIRDNKNYQTSPRSHG

    >gi|123965570|ref|YP_001010651.1| selenide,water dikinase [Prochlorococcus marinus str. MIT 9515]
    MTINHLVLIGGGHTNVLLMRKWLMNPKLMPEIPISIISRDTDLVYSAMFPSVISKSISLNDSLIDIRSLAKKAKISFIQN
    EVLNIDFHLKKICLKNRPSIGYSKLVLNYGSQTKISGEFEDLVNNQIAFPIKPFFKAYELIKNEDKNDSEPEKPFIIVGS
    GLAAIEIAFALRKRWEKRSLKILCKTYKIDTKISKSLYRSNIELVKSLPVDYGKILLCTGNSSPLWVQSYNSELDSKGRF
    LTNQNLRLKNFSGIFATGDCAVIETSKRPSSGIFAVKALNILAANIQQDIKGKSLKRWYPQKIGLQIVNSYPRKIPKAFA
    FYGDVVFGPSFFLWYLKNKIDEGFIKKFRILEPKMNHKIREGEEMDCRG
    CAAKIPQNILNKSLRSAQLENFATSPEDAVQ
    IYNNNQETILQSVDGFPALISDPWLNAKITVLHACSDLWACGAKLSSVQALISLPKVGKDFQSYLFTHCLKGIKTTVEEQ
    GGELIGGHTFESRSLVDKPYSLGIDISLTVQGVLRNGAKPWFKSGMQKGDILLMSRPLGVGIFFAAQMQNINLKDSSEEI
    MKNLVKSQQPLIEQIYFLQDKFGETFINAATDITGYGFMGHLKEMIDSSNLSRKDNNLEPINVLLDLLAFKAYPGVFELI
    RKGVKSSLFESNKEIIDQILSEKPKNRIISFSKKNKVNSESFKEKISLLLDPQTCGPLLISCDPKYESFLNDEWYKVGEV
    IN

    >gi|123965617|ref|YP_001010698.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. MIT 9515]
    MKIGDKVPLFSLLDQNGTRRTNEGLKSPLVLFFYPKDDTPGCTIEVCGFRDKYDLFKVLGAQVWGVSNGTSSSHLAFANK
    NKLQYPLLCDIDDSLRKTFKVPKVLGLLDGRVTYVIDRNGFVKHIFRDLLNGPEHIKEAIRVLKEIQNQ

    >gi|123965712|ref|YP_001010793.1| putative methyltransferase [Prochlorococcus marinus str. MIT 9515]
    MSSDCCNTDESNKNLKGLDHKDAIQERYGSAALEKESCLCTPVGFNPVLLEAIPEEVIERDYGCGDPTKYVQKNDIVLDL
    GSGSGKNAFICSQIVGEEGKVIGVDQNPDMLTLSRSASKKFSEKIGFNNTEFLKGSIENLDELNKDLNPLIADKSIDIIL
    SNCVLNLVNPESRNNLLRNIKRVLKGNGRIAISDIVSSKKVPLRLQNDHDLWTG
    CISGAWYEPEFLNDFKDLGFKNLEFA
    ERSNEPWKVIEDIEFRTVTLVGNI

    >gi|123965811|ref|YP_001010892.1| putative arsenate reductase [Prochlorococcus marinus str. MIT 9515]
    MKKVIFYSYPKCSTCRKASKWLDQNNINYKFIDIVKEPPSKKFLEIALIQFSFDIKKIFNTRGKSFKLIDFDIFDLTKKK
    IIELLSNDGKLIKRPFLIINESELILGFNESEYAANFK

    >gi|123965865|ref|YP_001010946.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9515]
    MNKVLSWADLSKFEIDDIDRVNGINNSYSNLRLFGHSEKEVDLTLFRDRHSWCPYCQKIWLWLEFKRIPYKVKKINMYCY
    GQKEKWYLNKVSSGKLPAIDLNGEIITESDNIISLLENEYGTLGSSLLSNDIREARILEREIFRSWCNWLCRKSFSYLDE
    SFSKNKFKESIQKFEKILSSSKTGFIDSQINDSDKIEPGTGDIIFIPYIERMNASLSYYKGFNLRNNYPHIDRWLSLLEN
    LSPYRGTQGDFHTHSHDLPPQMGGCFKDVNDQQILLSNLIDVGEGLGKSEFNQAVDLDYYAKFALKRVLKHKDNIINANP
    YEKDLFDQSLRSALTYMITSEINKVPDKAVMSINYLKNRISVPRDMPVISARLLRQSLNKIGSPNVNSKTDKIPVTHRYD
    QDPSKFKLNQRS

    >gi|123965866|ref|YP_001010947.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. MIT 9515]
    MEFEFDLIVVGAGSGGLAAAKRAASYGAKVAIIEVNKIGGTCVLRGCVPKKLMVYAANNRRNMVSAEGYGLINKEITFNS
    SVLLKNVREEVSRLSHIHSNSLKKLNVTVFEGLGRFKNQNTVEVVCPKTRNILRKVSANKVLISVGGKPKKLEIPGVDLA
    WSSDDIFELQDFPKTLLIVGGGYIACEFASIFKNLGTEVIQIIRGQNLLSGFDKDLSECLKKSMTSLGIDLKFNNQLKSI
    KKIKGKLQSTLVSGSKFLTNNILIATGREPALKELHLDTLNLKMDGIYLDVNEVNQTSNSNIFAIGDIIKRPNLTPVAIE
    QGRVFADNYFADRRRKVNYQNIPKAVFTIPEISTVGLSEEEATEIYSELNIKIFKCSFTPMSNTFKKNKSKCMLKLVVNK
    KNDKILGCHMFGEAASEIIQMVSVSLNAGITKKDFDNTMALHPTISEEFVTMYG

    >gi|123965931|ref|YP_001011012.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. MIT 9515]
    MTTDILYSFRRCPYAIRARWALLICEIELEIREVDLKNKPLEFTNKSRTNTVPILLKKNNKVIEESLDIIIWALGESKKE
    GIKNFYIPKNKEKEILEIISENDNSFKYHLDRFKYSARFTACDKDYHFSEATKFIKKWNRNISKSRWIIGDKTTIADWCI
    WPFVRQYKIACESQKKTNYFESPIQEWLESFEKHKYFKKLMHKYNPWEPANKKVYFPFY

    >gi|123966017|ref|YP_001011098.1| glutaredoxin [Prochlorococcus marinus str. MIT 9515]
    MQPHSLKLGPDSDLIICIKEFSFLNNLYGYVSGVVGNLSKACIQCPGDQKVNIFEGNLEIVSLNGHFNKGVVHLHLSFAD
    ERCNVIGGHLEEGSIVKKGTDILLVSFENKTINISNQNSIKKQARVKAYILKS
    CPWSKRSLRLLDSLSIPHEVVLIENDK
    DFQKVNSLSNHETFPQIFLDDKFFGGYDELSKQAQFDYLNSFK

    >gi|123966166|ref|YP_001011247.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9515]
    MSLRVGQEAPNFTATAVYDQEFKEITLSSYKGKWVVLFFYPLDFTFVCPTEITAFSDEYEKFSALNTEILGVSVDSKHCH
    LAWIQTPRNEGGIGDINYPLVSDLKREICQEYNVLNDDGEADRGLFLINPQGIVMHTTVNKAPVGRNVDETLRILQGYQY
    VAANPDEVCPANWTPGEKTMLEDPKGSKEYFSAL

    >gi|123966218|ref|YP_001011299.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. MIT 9515]
    MKSLFSIFIIIISFFFNFKSVIAFDYAPEVGDIAPSFHLEGINKNIKSKKIWDSNELKGKWVVLYFYPKDFSAGCTLEAK
    GFSKLKKDFSKYNAEIIGISADKEETHESFCSEQSINYTLLSDPNGTISEKYGSWIPPYSDRNTFLISPKGEIVFRWISV
    LPINHAKEVLNVLKKNI

    >gi|123966271|ref|YP_001011352.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9515]
    MFKFLKKIMNKNETISENKNNFLHRILNTNIREEPNSQEDSIIFGCGCFWGAEKCFWKLPGIVTTSVGYAGGEKKNPTYY
    EVCSGITGHAEVVKVVWNINELDISDLLKMFWECHDPTQKNRQGNDMGTQYRSTIYYTNKNSKDIINLSKEAYQKELTAN
    NFGEIETEIKMIDTYYYAEEYHQQYLAVEGSRQYCSASPTKVKLGNFNGSNYRLPKEIWDNFNWDIDKCVLRSNNKPIEI
    NK

    >gi|123966324|ref|YP_001011405.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9515]
    MVIDVQNTPVLSADGKSKKLGEFSKDVILIVNVASYCGNTAQYEDLQKLHKIYSKKGLRILAFPCNDFGNQEPDSLSKIQ
    NFCTTEYGVEFEIMEKVHAKGNTTEPYTTLNKVEPKGDVEWNFEKFLIGRDSNVIARFKPSVKPFDDNLIAAIEVALDS

    >gi|123966384|ref|YP_001011465.1| thioredoxin [Prochlorococcus marinus str. MIT 9515]
    MSSAPAVTDSSFDKEVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSSTLSKHL

    >gi|123966418|ref|YP_001011499.1| sulfurtransferase [Prochlorococcus marinus str. MIT 9515]
    MKKNNYKIVSLYSFFSFQENSIIELKQNLLRIEKENDLSGLLIIASEGINGTICAEEKIIENILNLIKNIVGNNQLNIKV
    SYSKEKIFKKLKLKIKNEIVTMGVPEINPLEDAGTYIDSFNWNKLIKDKDTIVIDTRNHYEVSIGSFKKSINPNTKNFSE
    FPQWVDNNLDNHLGNENSKNIAMF
    CTGGIRCEKATTLLKNKGYKNIFHLKGGILKYLEDISKEESLFEGECFVFDKRVAL
    DHELKKGSYSICHACGMPISIEDQTKVEYIEGIQCHFCINKFTDEDRKRFEERQKQINKLKVKNQEISNN

    >gi|123966435|ref|YP_001011516.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9515]
    MENLTKNKIQKLIDSSPVMVFMKGTKLMPQCGFSNNVVQILNSLGVEFDTFDVLSDFEIREGIKEYSEWPTIPQVYLKGE
    FLGGSDILIEMYNSGTLKEKIEIELAS

    >gi|123966521|ref|YP_001011602.1| hypothetical protein P9515_12881 [Prochlorococcus marinus str. MIT 9515]
    MSQKPESLKDKETKNFSEFSQLADFSLMNSLKADPHSTKNGNDHRPRPVYSGHYVPVTPTPIPEPKYIAHSKTLFDELGL
    SSDLTKDKKFCSFFSGDIEVSEYPMRPFGWATGYALSIYGTEYTQQCPFGTGDGYGDGRAISVFEGLFNEKRMEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQEFMHALGIPTSRSLILYVSGTEIVRRPWYSKGSKYYEPDIMLDNHAAITTRVAPS
    FLRVGQIELFARRVRSNSHNEAFNELKLIVQHLIDRNYKEEIDPSKSFAEKIIKLAYLYRERLISLVSNWMRVGYCQGNF
    NSDNCAAGGYTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPFAAEINFKMFCLSLKPLLLENKKDIEKLEQIKNDFSK
    VMNKKIQLMWARKLGLEKYEETLTHELFNLMFTSKADFTIFFRKLSNIPENISSLKKSFYVPLTDELEQKWNIWLKKWQD
    FIKKEIDIKEISKSMRQVNPKFTWREWMIVSAYEDAEEGNYSKIKELQTILSNPYEEQSLETEQKYDRLKPNQFFNYGGI
    SHYS
    CSS

    >gi|123966548|ref|YP_001011629.1| putative thioredoxin reductase [Prochlorococcus marinus str. MIT 9515]
    MEMIKKEENIENLVIIGSGPAGYTAAIYAARANLQPLLVTGFNSGGIPGGQLMTTTFVENFPGFPDGVLGPELMDLMKAQ
    AERWGTNLYESDVISIDTSKRPFELKTLEGIIKTNSIIIATGASANRLGVINEDKFWSKGISA
    CAICDGATPQFRNEELA
    VIGGGDSACEEAAYLTKYGSKVHLLVRSEKLRASAAMIDRVKGNSKIEIHWNTKVEKAIGTDWLDKIEAINTEKGYVEIK
    VKGLFYAIGHTPNTKFLDNKIELDKKGYIACKSGRPETSIDGIYAAGDVVDSEWRQGVTAAGTGCMAALAAERWLAEKNL
    SKIIIREKAEPEKTLPSSSFNEEETDENTFDLNSKWQKGSYALRKLYHESNKPILVIFSSPS
    CGPCHVLKPQLKRVINEF
    DGAVQGIEIDIDKDQEIAKQAGINGTPTIQLFKEKLLKKQWQGVKQRSEFKEAIQNII

    >gi|123966692|ref|YP_001011773.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9515]
    MTDLNFDFDLIVIGAGYGGFDAAKHAAGKGLKVAIVESGDMGGTCVNKGCVPSKALLAASGKVREIANYEHLSRFGIHAS
    PVRFERSKIADHANNLVSNVRENLTKTLKRSGVEIILGFGRLEGNQKVGVRDKNGIDKIFTCKNTVIASGSSPFVPPGIN
    LDNRTVFTSDEAVKLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALENIMPTFDPDITKIAKKNLIQSRDIDTKS
    NVFATKITPGCPVKIELTDAKSKEIVENLEVDAVLVATGRSPNSKNLNLDSVGIETVKGYIPIDDQMRVINGKKIIPNVW
    AVGDVTGKLMLAHTAAAQGTIAVDNICGKNIEINYGSIPAATFTHPEISSVGLSETDAKEKAIKEDFTLGVVKSYFKANS
    KALAELESDGILKLLFNKDSGKVLGAHIFGMHAADLIQEIANAISRNQDVIQLASEVHTHPTLSEVVEVAYKQAASQVK

    >gi|123966727|ref|YP_001011808.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9515]
    MTYFFSLIIVFSIIVNPINTFAEEVTLAGGCFWCLEHDLESLKGVNSVISGYSGGNLQNPTYENHDGHQEVVLVDYDSEE
    VALSEIYRIYLRNIDPLDGEGQFCDRGNSYRPVIFFETSDEKNEASKSLLSASKELGVKLEQINVELKPKSQFWEAEDYH
    QDFAIRNELKYKFYRFSCGRDQKLDKIWKDNARSMNAWSQE

    >gi|123966769|ref|YP_001011850.1| flavoprotein [Prochlorococcus marinus str. MIT 9515]
    MDPFNLVVVGGGAAGFMTAVIAAENGVKRIIILEGSSKLMEKVRISGGGRCNVTNASWIPNELVENYPRGGIKLLESFNR
    FAAGDVFDWFEKRGLNLKIESDNRVFPVSDSSLDVISCLKKSAITKGVEISTRFFVKEIVKTADNLFNIFDSKKNLIIAK
    NLILSTGGHPSGHKLAKNFGHRIIRPVPSLFTFTTEKTKLNECSGVSIKNIDIEIQLNNKSFKNRGDLLITHWGFSGPAV
    LKLSSIAARELFDQKYKFNLLIRWSDLEYKELKEKIDNLKFNNGKLKLINLRPLPLLPKRLWVFLLNKMEINKEKKWSDL
    LANEREKMINSLMKDIYNISSKGPFGEEFVTSGGVSIDEVNFKSMESLICPGLFFSGEVLDVDGITGGFNFQHCWTSGWI
    AGKAVSKQLVK

    >gi|123966989|ref|YP_001012070.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. MIT 9515]
    MKISIDHKSDSLTLDEEDRYKRHLTLNEIGLKGQLKLKRSSVVCIGAGGLGSSVLIYLAAAGIGTIGIVDNDQVEKSNLQ
    RQIIHETNTVGDLKIDSAQERIRRLNPNIEVITFAERINSNNILDIINQFDIVCDCSDNFGTRYLINDACLILDKPLVFG
    SVQGFEGQISVFNLKKNSPNLRDLLPESPLKNNIPS
    CEEFGVIGVSTGLIGVLQANEAIKIILKKGQILDGKILIFNLLN
    MNIKTLTLKADKFTNTINDLSEFEDFYKDIECQDNIKINKIDSTTFETLYRSNYNNLLIIDVREKEEFNKYSIKGAISIP
    LNNLDQKPHLEFIKQESLDKEVFTL
    CQAGKRSEKASKILMKFKISSKSIEGGIANIKQLIFH