Prochlorococcus marinus MIT 9313 uid57773

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33862289|ref|NP_893849.1| hypothetical protein PMT0016 [Prochlorococcus marinus str. MIT 9313]
    MPITALLLSRRSLLIATIAGAFGVYRRPAAAFAATRAEDLDWSLSNEQWAKCLSPEAYRVLREEGTERPFTSSLNKEKRV
    GIYHCAGCDLPLFSSAAKFDSGTGWPSFWEPLAGAIQTKVDFKLIIPRSEYHCRRCGGHQGHVFNDGPRPTGKRY
    CNNGV
    ALTFRPAR

    >gi|33862398|ref|NP_893958.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9313]
    MSMAINISQIVVRTPEGAEKSLSEYSGTVLLIVNVASRCGFTKQYKGLQALQNTYGPQGLKVLGFPCNDFGAQEPGTLEE
    IKSFCSTTYGASFELFDKVHAMGKTTEPYTTLNQTEPAGDVAWNFEKFLVGKDGTVLKRFKSGVEPESTELKAAIDQALM
    A

    >gi|33862608|ref|NP_894168.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9313]
    MSEASFDFDVIVIGAGYGGFDAAKHAADDGLKVAIVESGEMGGTCVNRGCVPSKALLAASGRVRELADAEHLSGFGIHAA
    PVRFERQKIADHANQLVATIRSNLTKTLQRAGVTILRGHGRLEGSQRIGLREKSGVDRLLTARDVILATGSDPFVPPGIE
    TDGRTVFTSDEAVNLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALDRVMPTFDPDITKMAARHLIEGRDIDARA
    GVLASKVIPGCPVRIELAEMKSRELVDSLEVDAVLVATGRVPSSKGLNLESVGVETNRGFVPIDDSMRVLVNGKPLPHLW
    AVGDVTGKLMLAHTAAAQGTLAVDNIQGHSRTIDYRSIPAATFTHPEISSVGLSEADAKDLAAKDGFELGSVRSYFKANS
    KALAELESDGLMKLLFRKDNGEVLGAHIYGLHAADLIQEVANAVARRQSVAQLATEVHTHPTLSEVVEVAYKQAAKQLAK
    AVVASASAS

    >gi|33862660|ref|NP_894220.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. MIT 9313]
    MALQVGDKAPAIDLVDQNGNKRRSNDLKGKVLVLFFYPKDDTPGCTAEACSFRDNYSVFENLGSEVWGVSGDDDISHRQF
    AERHGLPYALLSDKDNTLRRAFEVPRTLGMLPSRVTYVIDGQGTIRHIFNNLLDGPAHMREACRVVEEIKKKR

    >gi|33862743|ref|NP_894303.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. MIT 9313]
    MEHPFDLIVLGAGSGGLAAAKRAASHGAKVAIVEGDRVGGTCVIRGCVPKKLLVYGSLYREQLEVAPSFGVELSDAQINA
    GVLLANVRQEVDRLNTLHIDLLAKNGVELVTGWGSFTSPNSVAVSRNGAIDASQELHGDHILIAVGGRPHRPDIPGAELG
    WVSDDMFMQSSFPDRVVVVGAGFIACEFACILHGLGVEVIQLVRGDHLLRGFDRELSTAVQDGMQEKGIDLRFGENPAAL
    KGQPGDLVLSTQSGERFSCGGVLLATGRRPFLQGLNLDAAGVVLEGRRISVDANQSTNIPHIFAVGDVTDRINLTPVAID
    EGRAFADSVFGQKPRQVNHDLVASAVFSQPELATVGLTEEQSIDRYGKDQVKVYRARFRSMAQALPKRGPRCLLKLIVAR
    NTDRILGCHMVGEHAAEIIQMAAIALGMGATKADFDRTMALHPTVSEEFVTMT

    >gi|33862744|ref|NP_894304.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9313]
    MPAAASTKALDWQALAELTVPEADRINGPTNAQATLRLFGQSEKALRVTLYRDHHAWCPYCQKVWLWLEWKQIPYRIRKV
    TMRCYGQKEAWFKKKVPSGMLPALELDGRLITESDQILLALEHAFGPLGHRLEDPRTFKLRDLERQLFGAWCRWLCTARL
    NQRQEQAGREQFQIKARMMEQQLSAEQGPWLDPASNTPTSPCPGSADVVFIPYVERMNASLAYYKGFSLREEHPAIHKWF
    KALEELEVYRGTQGDFHTHAHDLPPQMGGCWVASNPKQQELAEAIDCGAGLAELETCWADPENSKTRPEGLALSRVLKHR
    KRLLELNPLGAIRFDQPLRATLTRMALGVSCSPDPGSARGLRYLRDRISVPRDMPLISARRLRQALEQTAQLDSPEMGDP
    IPIHDRFDQNPTPFLTS

    >gi|33862765|ref|NP_894325.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9313]
    MFPSWLTPKASKEAAIPSGTQQHAVLGTRLNDPLTTDQEDALFACGCFWGAEKGFWKLPGIITTAVGYAGGHQEQPTYQE
    VCSGRSGHTEIVRVVWNKSVIDYSDLLKLFWECHDPTQGNRQGNDRGSQYRSAIYTTTIQQIELAQASRDSFQQLLSKAG
    FGAITTEIKADQQFHYAESYHQQYLAKPGSRPYCSAMPTQVALNDFPGANFKLPVSVWQEYDWSVSHCVLRSGNEKIKL

    >gi|33862785|ref|NP_894345.1| hypothetical protein PMT0512 [Prochlorococcus marinus str. MIT 9313]
    MRSLPLKLAPGSDLLISLQKIAQEQNSSGFVLGVVGNLSRAAFQCPGQSGPTVLEGNLEIITLNGTVSPNSVHLHLSLSD
    SACQVWGGHLEPGTLVLKGADLLVGLLDQSLPQEPSDPSQAPRVEIAVLPG
    CPWSTRALRMLGSLSIPHTVKSIDNDASF
    KAFNQRSELNTFPQVFIDGELIGGYDELSKMHASGQLETLR

    >gi|33862901|ref|NP_894461.1| hypothetical protein PMT0628 [Prochlorococcus marinus str. MIT 9313]
    MIALHQTAIQDHPYQWRSKWNEMNETHIEANHLTMNQPTPTPISAKDLHRWLSDSSSLPICVDVREDQELELAPFPADVL
    HLPLSRSSDWMETLPQLLPNDRPVVVI
    CHAGIRSWNFGTWLLEQEISYQVWNLEGGIDAWSINVDSSVPRY

    >gi|33863026|ref|NP_894586.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9313]
    MTTNECLRVGQQAPDFNATAVVDQEFKEISLSQYRGKYVVLFFYPLDFTFVCPTEITAFSDRYTDFSSRNTEVLGVSVDS
    QFSHLAWIQTSRKEGGLGDINYPLIADLKKEISTAYNVLDDEAGVALRGLFIIDPDGVIMHSTINNLPVGRNVDETLRVL
    QAFQYVQSHPDEVCPANWTPGEKTMKPDPVGSKEFFASIN

    >gi|33863134|ref|NP_894694.1| hypothetical protein PMT0862 [Prochlorococcus marinus str. MIT 9313]
    MISVLPSNDTSATAFRSEVFPELHRDNLRTLQVNLGYRCNQSCAHCHVNAGPTRLEMMDPQTMALIPKVLDQYQLECLDL
    TGGAPELHPGFKDLVIQASCLGVEVIDRCNLTILTEPGQENLAAFLAKHRVTVVASLPCYEAENVDQQRGKGVFERSLIG
    LRQLNQLGYGKNDEQLILNLIFNPQGPQLPPPQAQLEEAYRKELKQRYGIEFTRLFTIANMPIQRFATQLTMSGQRESYQ
    QLLEGAHNPDNLKTVMCRSLISVNWQGQLFDCDFNQQLSLHLKGPVQHLRDLLDVEIQWPGQPITVGPHCFGCTAGNGSS
    CGGALQSEGEVG

    >gi|33863283|ref|NP_894843.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. MIT 9313]
    MKRSELLRVITGAAVLSISQCLGRPSQALAMEGKLPALDAQAPDFELEAAAQEGALAEKLQRDAFLGSWLVLYFYPRDFT
    SG
    CTLEARGFQRDLSDFKAAGAAVVGVSADGTEEHVSFCSSEGLGYTLLSDPGGVVSERYGSWSSPFSQRHTFLIDPDGI
    LRARWKDVSPSRHSQDVLRALKELQQS

    >gi|33863309|ref|NP_894869.1| hypothetical protein PMT1038 [Prochlorococcus marinus str. MIT 9313]
    MTMTTISCCYKGNLRCEALHTPSGDRLSTDAPIDHEGKGEAFSPTDLVATALGTCVLTVMGITARRKGWRIEGAAVDVEK
    IMTSEGQRSIQALKLRISMPPELSDEQVKLLQRVVDT
    CPVKRNLEEGIAMEFSWS

    >gi|33863326|ref|NP_894886.1| hypothetical protein PMT1055 [Prochlorococcus marinus str. MIT 9313]
    MNLQDDQTSADLFQVATFYSFTAWTEVTIACLLHDLLSLGDEHQLMGTVLLAEEGVNGTICGSVDGVSALLERLESDLIE
    GLFELKISWTPEQAFRRFKVRRKAEIVTMGLAGLNPSKTVGTYVDAHEWNDLIDDPDTLLIDTRNDYEVAIGEFKGAINP
    QTKCFRDFPAWVEQQLRSMVKAQTPARIAMY
    CTGGIRCEKATSYLIEKGFTNVHHLRGGILRYFEEVSQTESRWQGECFV
    FDQRVALNHQLSPGVHCLCHACGMPLTPEDQTMNSYLPGVQCRHCVDQFSDTDRIRFAERQRQMEHSSRK

    >gi|33863366|ref|NP_894926.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9313]
    MDPTTKTRIEALIQSSPIMVFMKGTKLMPQCGFSNNCVQILNSLGMSFETFDVLSDMEIRQGIKDYSNWPTIPQVYVKGE
    FIGGSDILIEMYNAGELAEKLEIALNS

    >gi|33863398|ref|NP_894958.1| thioredoxin [Prochlorococcus marinus str. MIT 9313]
    MSNAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFESKIKVFKLNTDENPNVASQYGIRSIPTLMV
    FKGGQKVDTVVGAVPKATLSGTISKYL

    >gi|33863441|ref|NP_895001.1| methyltransferase [Prochlorococcus marinus str. MIT 9313]
    MSSSCCSPSASGPGADALDQTQAVEERYGAAAHAQEACLCTPVAFDLSLLKAIPREVVERDYGCGDPTRWVKPGDTVLDL
    GSGSGKNAFICAQLIGSAGAVIGVDRNVEMLNLARQAAPVVAERIGFANVRFVEGAIEALEAPQVDGSPLIADRSIDVVL
    SNCVLNLVNPADRKNLLANIRRVLRPGGRLAVSDIVCDKPVPLALQQDPELWSG
    CISGAWQEEAFLQDFRALGFEKVSYA
    DRSDQPWQVVEDIEFRAVTLVGQLPDD

    >gi|33863456|ref|NP_895016.1| alkyl hydroperoxide reductase/thiol specific antioxidant [Prochlorococcus marinus str. MIT 9313]
    MPFPQNVPDVTFKTRVRDESVPGSNPFRWQDLTSAEIFKGRKVVVLALPGAFTPTCSSNHLPRYEELHAELVAQGVDQIV
    CLSVNDAFVMFQWSKHLGTKNIFMLPDGNGEFTRKMGMLVEKSNLGFGLRSWRYSMLVNDCNIEKMFVEPGFSDNADGDP
    FEVSDADTMLAYMKGVQSAGVSSPCREFQG

    >gi|33863524|ref|NP_895084.1| putative arsenate reductase [Prochlorococcus marinus str. MIT 9313]
    MLNSIRIYSYSRCATCRKALTWLQEHQIVHDLFDIVETPPSREMLSGASKQLASRKLLFNTSGVSYRALGADAVKAMSDD
    EALDALASDGKLIKRPFLITENGSVLVGFKPDVWAEALLP

    >gi|33863659|ref|NP_895219.1| hypothetical protein PMT1392 [Prochlorococcus marinus str. MIT 9313]
    MSHPSESSAAPCVTTVDEFAKLADYSLMDSLNTDPDSTVDGDDHLARQVFSGHFVPVTPTPLKNPEYVTHSSTFFNELGL
    NNELAFNENFCKLFSGDLSATREPMRQVGWATGYALSIYGREYTQQCPFGTGNGYGDGRAISVFEGIINGKRWEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQEYMQALGVPTSRSLTLYVSKSETITRPWYSQHSQSTDPDILVENPVAISTRVAPS
    FLRVGQLELFARRARSNTHPRALEELRMIVSHLIEREYKSDINQTLSFTVQLVKLARLFRDRLTLLVANWLRIGYCQGNF
    NSDNCAAGGFTLDYGPFGFCEIFDPKFQPWTGGGKHFSYFNQPIAAEANYHMFWKALRPLLEEDAKALKEFDQVRDGFEQ
    AMDKQIQKMWAAKLGLKEYNSNLFEELLQLIINSKVDYTIFFRELSHIPNNLSALKKSFYIQTSQQIDEQWKSWLQSWRD
    LVLNKGSSTETSKTMKLTNPKYTWREWLIAPAYQQAEEGNYSLVKELQEVLSHPYDEQSKEIEDKYYRLKPKVFFNAGGI
    SHYS
    CSS

    >gi|33863675|ref|NP_895235.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9313]
    MKTTFRPLRRWWIAIFLCVALLGLPLQVLASVEEAVFAGGCFWCLEHDLEGLTGVISSESGYTGGDLPRPTYRQVSSKTT
    GHQEAVRVRFDAAQISYAELLRSYWRNVDPLDGDGQFCDQGDSYRPVIFTRDDQQASEARESADAAALELAQPMSNLRVE
    IKPLSEFWLAEDYHQNYAELNSIKYNFYRYSCGRDRRLDQLWGDRARTGVPWQRPDQANLRKK

    >gi|33863818|ref|NP_895378.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9313]
    METIEADVVIVGGGPAGCSCALYTSRADLKTVILDKNPDVGALAITHQIANYPGVSSEMSGEALLALMREQAVSFGSDYR
    RAQVFGVDVNGEWKTVYTPEGTFKARALVVATGALGRPASFKGEAEYLGRGVSY
    CATCDGAFYKGREVAVVGANKEAVEE
    GQVLTKFASRVHWLTTSDPKEDDAHAQALMTQPNVQHWSRTRLMLIEGDDAGVTGIKLKNRTQETEQDLAVEGVFVYMSG
    SKPITDFLGDQVAFKEDGGVVVDDFMATTVDGVWAIGDIRNTPFKQAVVAASDGCIAAMAIDRFLNSRKGIRVDWVH

    >gi|33863853|ref|NP_895413.1| methionine sulfoxide reductase family protein [Prochlorococcus marinus str. MIT 9313]
    MSRSDSSASDSVDWIKLSPEEWQARLTREQYQVARKGGTERAFTGAYWNHKAAGMYCCVCCGAPLFSSATKFDSGTGWPS
    FSDGVKAGAITTHRDTSHGMERTEINCARCGAHLGHVFNDGPAPTGQRY
    CVNSASLDFSEEAEV

    >gi|33863889|ref|NP_895449.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9313]
    MTLKIGDPAPDFNLPNQDGTLVQLASLRGQRVVIYFYPKDDTPGCTKEACNFRDQWERFEANDIKVLGISKDGATSHTKF
    IKKYQIPFTLLSDAEPCPVASSYESYGLKKFMGREYMGMMRHSFVVDPKGNLELIYLKVKAATMADQILKDLGLD

    >gi|33863986|ref|NP_895546.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. MIT 9313]
    MRLRIWDSGKGIASGTLSPMGLHETVDVDLSPDELERFSRHLTLPEVGMNGQKRLKAASVLCVGSGGLGSPLLLYLAAAG
    VGHIGIVDFDVVELSNLQRQVIHGTSWVGQAKTHSARARILEINPHCQVDVYEKALRRDNAFEIIQPYDIVCDCTDNFPS
    RYLVNDACVLLGKPSIYGSIHRFEGQATVFNLDAESPNYRDLVPEPPPAGLVPS
    CIEGGVMGILPGLIGLIQSAEVIKII
    TGIGTTLSGRLLVVDALAMTFREMALRPSQPRVVIDQLIDYQDFCGSGADKPAHEKVAGLESISVKDLKSLLDLGAEDFA
    LVDVRNPNEAEIACIAGSELIPLNKIESGEAIEKVRQLASGRRLYVY
    CKLGGRSAKALTTLKRHGIEGVNVTGGIDAWAK
    EVDRSLPRY

    >gi|33864093|ref|NP_895653.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9313]
    MTGSSPSSTLGQGQRLILLFTALGLAVVLFLLRGGLNAEAPLEQLARRSLDPDVALTNGRPTVIEFYADWCQACREMAPA
    MLKTERDREDQLDVVLVNVDNPRWQDLVDRYDVNGIPQLNFFDNKGKLQGLSLGARTQEQLQQLTDALIQNQPLPNFAGV
    GAISNLNASQERTEKQNDLEAIRPMSHG

    >gi|33864175|ref|NP_895735.1| selenide,water dikinase [Prochlorococcus marinus str. MIT 9313]
    MTADHLVLAGGGHSHALILRRWAMRPQLRPAGLITLINRHSTTLYSGMVPGLIAGHYRHSEIAIDLRRLTDRAGVALIIA
    EITAVETHHNRLLLAKRPPIHFQRISFDVGAETFNKDPYLERSQAALAMPIKPLEPALAWLEQQDSQRLLNDSTPLTVIG
    AGLAGVEVALALRQRWPKRPLNLQAHHGQPRPALKQALSRAAIVVVPSGTPLSGPALLCTGSQAPAWLATSGFPVDPFGR
    VRTTKTLQVINHPHCFAVGDCAVIDKAQRPAAGVWAVQAAKPLAQNLERLSRRQPTRPWQPQQLALQILGSQLTSGRFTA
    WAFWGDLIIGPHPWLWYWKEAIDRRFMGSFNELPSMSGVLKRQESMACRG
    CAAKLAEKPLNDALKQAGLGALGQQPEDAA
    LIASTSSGDSLLQSVDGFPALISDPWLNGRLTTLHACSDLWASGAHVISAQAVITLPKVSSELQQELLVQTLKGIQSTLE
    PQGAKLIGGHTLEARSIPPKPINLGIQLTLSVNGKVASGRVPWSKGKLQSGDVLLLSRPIGSGVIFAAAMAGKAHPEDLD
    AALAQMTISQHNLLAALRSLEERHKGMQTIHACTDITGFGLLGHLGEMLSASNHQRHRAGLQPLRLILEAAAIPSLQGAL
    LLLKAGYSSTLAPANRRNWHLLNPSINGEAAPIEIALNDVTPGSEHHQALLELMVDPQTCGPLLLACSTKIASELLRDGP
    WQRIGQVQPM

    >gi|33864234|ref|NP_895794.1| hypothetical protein PMT1969 [Prochlorococcus marinus str. MIT 9313]
    MTSTTHPATHHTATDGKGIQITNTAMQQLARLCLEKGNDQVLRVGVRSGGCSGMSYTMDFVPSADIQEGDEVYEYTATDG
    ASFRVICDPKSLLYIYGMQLDFSTEMIGGGFNFTNPNASQTCGCGSSFAV

    >gi|33864256|ref|NP_895816.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9313]
    MSRNDRPLAHPSVALDIEGMKCGGCVQSVERILLEQPSVARASVNLVARTAWLDLNDPGQSLEPILAALATRGFSAQPRN
    TGSLEQLTPSTRDSLGAWWSQWRQLMVALVLLLLSVLGHLAAGGHLELVIVGALPFHAGLATVALLGPGRPILVGGARAA
    LALTPTMDTLVGLGVSSAYLASLVALLWPQVGWPCFFNEPVMLLGFVLLGRFLEERARFRTGRALQQLAQLQPDTARLLA
    GDGTIREVRVGALRPGERVQLLAGDRIPVDGMVLEGHSAVDVSCITGEPLPLEAAPGIELTSGSLNLEATLLLEVRHVGA
    ETALARIISLVEQAQARKAPIQGLADRVAGRFCYGVVSLALLTFLFWWQLGARLWPEVLHASGQGLVHGYGHHVPLGGVA
    ETSLGLALQLAIAVLVVACPCALGLATPTVITVASGQAARRGWLFRGGDVIEMAASLRQVVFDKTGTLTLGRPLVAGVVG
    TKKPDQLLQLAASLEQNSRHPLAHAVLQEAQRHRLSLLSTLATRTYPGSGLAGELEGVEGTVRVGTPEWLQAEGVHWTAE
    LQADVELSSLQGQSVVAVALGEEPLGLVAIDDRLRPDVSVALDRLREQGMTLAMLSGDRRQAVERLGQQLGFQPHQLGWQ
    LLPDQKLERLQRLRKAGLLAMVGDGINDAPALAAADLGIAVGTGTQIAQDSADLVLLGDRLEGLPEALLLARRTMAKVRQ
    NLTWAFGYNLIALPIAAGLLLPGFGLLLSPPIAALLMALSSITVVVNALALRTT

    >gi|33864327|ref|NP_895887.1| glutaredoxin [Prochlorococcus marinus str. MIT 9313]
    MAKVEIYTWQSCPFCLRAKALLDRKGVSYQEHAIDGDQAARAVMASRAGGKNTLPQIFIDDLSIGGCDELHALEGAQKLD
    GLLQGKV

    >gi|33864368|ref|NP_895928.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. MIT 9313]
    MSLMSNPLLYSFRRCPYAMRARWALLASGLLVNLREVALNNKPLELLQASQKGTVPVLIAADGTVIDESIDIMHWALQQA
    DPFDGLRSGKTGEQKTIQQLIEQNDGPFKYHLDRFKYACRFKGEDAEEHHNMARNILVEWNARLVQQESSDFYGCLIGES
    QSLADWALWPFVRQYRLADPSSFDCDQDLQAIKRWLQDFLQHPLFGRLMTPVKPWLPEHHPQTFPADSSLVKTDQPLFHL
    ALIEDWQDACTQGVYQFSTRGLKLKEIGFIHLSYQHQLESTYHQFYRDRGQVLSLKLNPEQLSMPLRAEPSSAGELFPHL
    FGALPLSAVELVETYP

    >gi|33864149|ref|NP_895709.1| hypothetical protein PMT1883 [Prochlorococcus marinus str. MIT 9313]
    MQSHPEPALKGCFPNMALTPSTMLPLGTPLPAFELKVVPGTNLEIDGGLGALNTIKTSNLPTKPLLLMTLCAHCPFVKHI
    EKELTHLDQDYGDSVQLLAIASNSLITHPQDGPEQLAAQAKQQGWRFPYLLDTDQSLAKALQAACTPDFFLFTPSPQGLQ
    RLCYRGQLDNSRPGNDAPVTGSDLRAALDAVLNGQDVSPHQQASIGCNIKWHPGQEPPWFG