Prochlorococcus marinus MIT 9312 uid58357

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78778400|ref|YP_396512.1| methionine sulfoxide reductase B [Prochlorococcus marinus str. MIT 9312]
    MNQFFSRRTFILIPTMSILKIIFQPMKVLASSFSSKDEWNLSKDEWKSRLSPESYYILREEGTERAFSSELNNEKRKGVF
    HCAGCDLPLFLSDKKYDSGTGWPSFWDPIKGSVATKVDFKLIVPRTEYHCSRCGGHQGHVFNDGPLPTGKRY
    CNNGLALR
    FVPE

    >gi|78778467|ref|YP_396579.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9312]
    MALKVGDKAPEFKLKDSFDKEVSLNDFKGKRIILYFYPKDNTPGCTKEACNFKENWDLLQKNNIVVLGISKDNAVSHQKF
    IEKFNLPFILLTDPEPFKVSSDYDSYGLKKFMGKEYMGMMRNTFLIDTDGKIEKIYLKVKAAIMADHIIADLRLQ

    >gi|78778490|ref|YP_396602.1| thioredoxin domain-containing protein [Prochlorococcus marinus str. MIT 9312]
    MALKTLKSRNKKDLKWPKILISILSTIGIVDTGSITLKNWGLFTSLSCPGTQNGCETVLNSPWGTLFANNQINIPLSLAG
    LITYLSILVITIILSLNLISPKEKLNKFLWWLIFLISCASSTFSFLLINIMFFKIQAYCFFCILSAILSFSIFIISMIGA
    KFESREPMIFRGFVVFLSVLVGGLIWSTNVDPSNAIDVSSPTDNLSPLITTSSSPQKVLFAKFLRENNIVMYSAYW
    CPHC
    HDQKQLFGKEAVKELKVVECASDGKDNQYELCQTKGISGFPSWEINGEIISGTLDLNDLAITTGYQGDSNF

    >gi|78778505|ref|YP_396617.1| hypothetical protein PMT9312_0119 [Prochlorococcus marinus str. MIT 9312]
    MENLEVKQEIKNSDDGKGILITNDAIEQISNLLKGQIDKKALRVGVRSGGCSGMSYTMDFIGSNEINPDDKVYDYSLNSN
    QSFQVVCDPKSLLYIYGMQLDFSKELIGGGFNFVNPNASQTCGCGSSFAV

    >gi|78778519|ref|YP_396631.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9312]
    MIRKESIQLSITGMKCGGCVSTVETILNNSDGIENVSVNLLTESAYFEISYKHIEIETVLEKLKENGFPSKIYINDFSKK
    INKEELSKKKKWNNQWQKLTFALLLLLFSGLGHLAEGKYINFPILGNIFFHASLATIALLFPGRRIIINGFKSFIKNRPD
    MDSLVALGVTSAYITSLLSLIFPASGFPCFFNEPVMLLGFILIGRFLEERARYQTGSSIGELLDLQPEMANIYTKDNQIK
    SIRVNALKPDQEIQILAGDRVPADCIVTQGNSYVDVSHITGESKPIEVKEGEKLSSGSLNLNSTLRLKVQKVGGDSSLAQ
    LVSLIESVNANKPPIQRIADKIAGKFTYFVLIFATLSFFFWWKGAKHIWPDLLSHNHHQLLTNSSHTLHSSLGSNAENFL
    SLAIQLSIAVLVIACPCALGLATPTVITVASGKAAKKGVLFKGGDKIEMASKINHIIFDKTGTLTKGKLFIVDYKNNNDH
    TYLLRIAASLEKESRHPIANALIQEAQKQNLSLFPIKKILTHSGRGISGELESVEGLINIGNIEWLLSKGIVIDNNAKKV
    IENEETQTHTIIGVSIKDKLLGFILLGDLLREDSIKTVQNLRQNKFKINILSGDRKQTVLALAKKIGFKETEVKWNLLPH
    MKLKTIENLKIDNKVAMVGDGINDVPALASSDLGIAVGSGTQIAKANADIVLMGDQLNGLPYSLNLAKKTMRKIKQNLIW
    AFGYNLLAIPIAAGILFPKYDILLTPSIAALLMATSSITVVINALSLD

    >gi|78778567|ref|YP_396679.1| glutaredoxin GrxC [Prochlorococcus marinus str. MIT 9312]
    MSKVEIYTWQYCPFCIRAKSLLKKKNVNFTEYKIDGDEDARELMIERADGRRTLPQIFIDNEGIGGCDDLYALENENKLE
    ALLN

    >gi|78778599|ref|YP_396711.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9312]
    MEIIESDVVIIGGGPAGCTCALYTSRSNLKTVILDKNPSVGALAITHQIANYPGVPVDISGEKLLTLMREQAVQYGTDYR
    RAQVFGIDASGEWKTVFTPEGTFKAKALVLASGAMGRPASFKGEADFLGKGVSY
    CATCDGAFYKNREVAVVGVNKEAIEE
    ATVLTKFASTVHWITSSDPKSDNEEAMELIDNSNIKHWSRTRLLEILGDDMGVNGVIVKNKQEENPINLNLDGVFVYMSG
    SKPITDFLGDQIALKDDGGVIVDDFMSTNSDGVWAIGDIRNTPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS

    >gi|78778629|ref|YP_396741.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9312]
    MQSDSREPQLNANLNLIVVLLIVFVIVSLVLFRNLFFQSTYLLKSFGELSVEPEIAFKNKKPTFLEFYAEWCEVCKEMAP
    KVSALKDEYEKDINFVFLNVDNQKWENYIRKFEVNGIPQVNLFDREGNLKSTFIGKQEEITIRESLASLKGETKSHEEIH
    SAEFSVIKQKKNYQGNPRSHG

    >gi|78778689|ref|YP_396801.1| selenide, water dikinase [Prochlorococcus marinus str. MIT 9312]
    MTFNHLVLIGGGHSNVSLLKKWLMFPKLMPEIPVSIISRDSHLVYSAIFPSVISKSITIEESLIDIKSLAKNAKVSFIEE
    EVKDIDFNLKKIVLGNRPSVNYSKLVLNYGSQTIIPKEFESLVKNRNAFSIKPFLRAYDSILKEDIFDSVNELPFVIVGS
    GLAAIEVSYALRKRWGDRPLKLLCDSRKINNTILKSLRNSNIDLVEKLNFDYGKILLCTGNTSPLWANKKLLDSDSHGRI
    ITNQNLQIKSFSGIFAVGDCAVVGSAKRPASGVFAVKVVNTLVQNLKKDIEGRSLKKWFPQKIGLQIVNIFPSHHPKAFA
    IYRNFVFGPSFLFWILKYKIDLNFIKKFRSKRLIMKSSEKNISLNDCRG
    CAAKIPQFVLNKSLINSNLSSFASSPEDSVE
    IYQNGQDIILQSVDGFPALVSDPWLNAKITTLHACSDLWACGAKLASAQALISLPKVEREFQSYLFSQSLQGIKSTVEDH
    GGELLGGHTFEARSLVNKPYSLGIDISLTVQGILKNGAKPWLKSGMNIGDILMMSRPLGVGIYFAGQMQNINMLGSSSEI
    INNLLKSQQYLIDEIYLFQNQFKESLVNAATDITGYGFIGHLKEMVESSNLYRQNNHLEPLKVLLDLFAFKAYPGVFDLI
    RKDVKSTFFESNREIFDKIYKLNKQKRIINFLNENSLDHQTFNERISLLLDPQTCGPLLISCNPKYENVLKDKWYKVGEV
    LKM

    >gi|78778738|ref|YP_396850.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. MIT 9312]
    MQIGDKIPEFSLLDQNGIKRSNKGLKNPLVLFFYPKDDTPGCTIEVCGFRDKYDLFKVLGAQVWGVSNGSSSSHLAFANK
    NKLQYPLLCDTNNSLRKTFKVPNVLGFMDGRVTYVIDRNGIVRHIFRDLLNGPEHIKEAIRVLKEIQNK

    >gi|78778796|ref|YP_396908.1| hypothetical protein PMT9312_0411 [Prochlorococcus marinus str. MIT 9312]
    MSESCCNPNTSNKAPNQFDHKDAIQERYGSAALKKESCLCTPVGFNPILLEAIPQEVIERDYGCGDPTKYVQKNDIVLDL
    GSGSGKNAFICAQIVGEEGKVIGVDQNHDMLSLSRSASKEVTKNIGFNNTEFLEGSIEKLDKLDKDLNPLIADKSVDIIL
    SNCVLNLVSPKSRNNLLRNIKRVLNENGRIAISDIVSNKKVPLRLQNDHDLWTG
    CISGAWYEPEFISNFKELGFKNLEFV
    ERSTEPWKVIEDIEFRTVTLVGNI

    >gi|78778898|ref|YP_397010.1| hypothetical protein PMT9312_0513 [Prochlorococcus marinus str. MIT 9312]
    MKKIIFYSYLKCSTCRKAAKWLDKKDFEYQLIDIVKEPPLLDYLNLALEQYSPDKKRIFNTRGKAFKSINLDIYSLSKEE
    IIQLLLSDGKLIKRPFLVYEEKKVILGFNEIEYAEQFM

    >gi|78778951|ref|YP_397063.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9312]
    MNDILTWEDLNKYKVEDLDRVNGINNSYANLRLFGHTANDVIITLYRDRHSWCPYCQKIWLWLEYKRIPYRVKKINMFCY
    GKKESWFLHKVKSGKLPAIEFKGQFITESDDIISFLENEFGALGSFITSSHLIKTRELEREIFRSWCNWLCRESFNFIDN
    SFRKKRFKESISKFDEILRKSKSGFVDPSASNTGEIEPGVGDIIFIPYMERMNASLTYYKGFNLRSNYRYVDNWLTLFEE
    TSTYRGTQGDFHTHSHDLPPQMGGCYKESNEQQIALSELIDNGKGLGNYELNKNYDSKYFAKIALKRVIKHKDSLIKVNP
    YDKESFDESLRSALTHMITGEIRITEKLSGISIKYLKNRISVPRDMPLISARLLRQSLNKIELLSDKNEIDKIPLMHRYD
    QDPRNFIL

    >gi|78778952|ref|YP_397064.1| NADPH-glutathione reductase [Prochlorococcus marinus str. MIT 9312]
    MIKKILEFQFDLIVVGAGSGGLAAAKRAASYGAKVAIIEVNKIGGTCVIRGCVPKKLMVYAAKSKKNMDSSEGYGLKSEG
    ISFESDILLKNVREEVSRLSDLHRNSLNKLDVTVFEGLGRFTAQNELEIICPKTKKIINKISSKKILISVGGKPKKLNIP
    GMDLAWTSDDIFELENFPKSILIVGGGYIACEFASIFRNLGTEVTQLIRGQRLLNGFDEDLSSCLEESPTFTGINIIFNT
    QLKSIRRVNGNLESTLDSGEKILTNNILIATGREPNLIPLNLDFLNLKMDGQYLDVNELNQTSNANIFAVGDIINRPNLT
    PVAIEQGRVFSDNFFNDQKRKVNYENIPKAVFTIPEISTVGLSEKRAKEVYSEKNIKIFKCKFTPMSNTFKEKKTKCMLK
    IVVNSITDKVLGCHMFGETSSEIIQMVSIALNAGITKKDFDTTMALHPTISEEFVTMYG

    >gi|78779015|ref|YP_397127.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9312]
    MTNDILYSFRRCPYAIRVRWALLICKITVEIREIDLKNKPLDFLNKSKTKTVPILIKKNGDVIEESLGIILWAMSESKKA
    NIKAIYFPDNKREDIFEIINENDNEFKYHLDRFKYATRYQHSNEEFHFTKAIEFIKRWNQLLAENKYFFGDAPTIADWCI
    WPFVRQFKIACESQKRTNYLELPIKTWLDSFENDRKFKSIMYKYALWEPNSRTNYFPSN

    >gi|78779191|ref|YP_397303.1| hypothetical protein PMT9312_0807 [Prochlorococcus marinus str. MIT 9312]
    MQPHSLKLSPESDLINSIKEYSLSKNLYGYISGVVGNLRTVCIQCPGNQEINKFEGNLEIVSLNGHFNKGDVHLHLSFAD
    EGCNVFGGHLEEGCIVKKGTDILLLSFEQKIINVSNNDLITNQSRVKAYILNE
    CPWSKRAIRLLNFYNIPHEVVLIDNDE
    SFQKIMVKSNHNTFPQIFLDNKFFGGYDEISEQAKLDKLTSFK

    >gi|78779228|ref|YP_397340.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9312]
    MFKFLKNIMNNEEPTLNNDINSIHRILKTDITRNPNPQEEEIIFGCGCFWGAEKCFWKLPGVVTTSVGYAGGDKSNPTYY
    EVCSGLTGHSEVVRVIWNKSEIDISDLLKMFWECHDPTQKNRQGNDMGTQYRSAIYFKKENNKKIIIASKEQYQKELNKK
    NLGLIETEIKMIDTYFYAEQYHQQYLASPGSRQYCSASPTKVKLGDFPGSKYKLKEHIWENFNWQVDKCVLRSDNNPINN
    NI

    >gi|78779281|ref|YP_397393.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Prochlorococcus marinus str. MIT 9312]
    MRTLVVSILISFFLLINCNSTLAFDFAPEVGDSAPNFQLEGFNKNIKSKKIWELSDFQGKWLVIYFYPKDFTAGCTLEAK
    GFSELKKDFSKYNAEIIGISADKKDSHESFCSEKSITYTLLSDPEGIISDKYGSWIPPYSDRNTFLISPEGTISYRWISV
    LPINHAKEVLNVLKKKI

    >gi|78779328|ref|YP_397440.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9312]
    MSLRVGQEAPDFTATAVYDQEFKEITLSGLRGKWVVLFFYPLDFTFVCPTEITAFSDRYQDFSSIDAEILGVSVDSKHCH
    LAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGIVMHTTVNKAPVGRNVDETLRILQGYQY
    VAANPDEVCPANWTPGEKTMLEDPKGSKEYFSAL

    >gi|78779400|ref|YP_397512.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9312]
    MQVDVQNTTVFSADGSSIKLGQYSGEVILVVNVASYCGNTAQYEDLQKLHDLYSSKGLRILAFPCNDFGKQEPGSLSEIK
    DFCTTKYGVKFEIYEKVHAKGDTTEPYTTLNKVEPEGDVEWNFEKFLIGKDCKVIARFKPSVKPFDENLIAAIEVALDS

    >gi|78779455|ref|YP_397567.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
    MSSAPAVTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSSTLTKHL

    >gi|78779488|ref|YP_397600.1| rhodanese-like protein [Prochlorococcus marinus str. MIT 9312]
    MKGKNYKIVSLYSFFPFQENLIIDLKSKLLEIGYENDLSGLLIFASEGINGTICAEKNVIDIVINLLNKYADNRNLNIKV
    NFSKKKVFKKLKIKIKKEIVTMGVPEINPSENNGTYIDSANWNKLIKNQNTIVIDTRNHYEVSVGTFQNSINPNTRNFSE
    FPKWVDDQLDTHLENKESTNIAMF
    CTGGIRCEKATSLLKKKGYKNIYHLQGGILQYLDDIPKEKNLFEGECYVFDKRVAL
    DQELEKGSYSICHACGMPVSIQDQERKEYRKGIQCHFCIDQFSDDDRKRFEERQKQIDRLKVGNHKIFKD

    >gi|78779505|ref|YP_397617.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9312]
    MDNLTKDKIQKLIDSNPVMVFMKGTKLMPQCGFSNNVVQILNSLGIEFGTFDVLSDFEVREGIKKYSDWPTIPQVYLKGE
    FLGGSDILIEMYNSGALKEKIEIELAS

    >gi|78779607|ref|YP_397719.1| hypothetical protein PMT9312_1224 [Prochlorococcus marinus str. MIT 9312]
    MSTKSDSLKGKLTENFSEFSQLSDYSLMNSLKADPQSTKDGNDHKPRSVYSGHYVPVVPTPIPEPEYISHSNKLFKELRL
    SSDLTKDENFCRFFSGDISVANYPMSPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRMEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQELMDALGIPTSRSLTLYVSRSEIVRRPWYSKGSRYFEPDVMIDNQAAITTRVAPS
    FLRLGQIELFARRVRNNAHDEALNELKMIVQHLIDRNYKDEIEYEISIESKVIKLASLYRSRLISLIANWMRVGYCQGNF
    NSDNCAAGGYTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPSAAAINFKTFCSSLSLLLSQSKQDQEKLDQIEKDFFE
    LMNKELMKMWANKLGLEHYNETLINEFFNLMVISKADYTILFRKLSKIPDNLDSLKDCFYLPINDELNNRWEVWLENWQS
    VLKKEGNIKAKSASMKSLNPVYTWREWMVVPAYEEAEKGNYKKIKELQDVFSNPYVEQPPEIDQKYNRLKPSQYFNYGGV
    SHYS
    CSS

    >gi|78779630|ref|YP_397742.1| thioredoxin reductase [Prochlorococcus marinus str. MIT 9312]
    MENKEKNSNLENVVIIGSGPAGYTAAIYAARANLQPLLVTGFNSGGIPGGQLMTTTFVENYPGFPDGVLGPELMDLMKAQ
    AERWGTNLYESDVVSINTDLHPFELKTLDGTIKANSIIIATGASANRLGVINEDKFWSKGISA
    CAICDGATPQFRDEELA
    VIGGGDSACEEAAYLTKYGSKVHLIVRSEKLRASAAMVDRVKANPKIHIHWETKVEKANGSEWLEKIETIHSQEGKGEIN
    IKGLFYAIGHTPNTKFLDKKIDLDNKGYIACKPGRPETSVEGIFAAGDVVDSEWRQGVTAAGTGCMAALATERWLAEKNL
    AKTIIRETPEPDKKLNSSDFNEDEVNEDTFDSNSEWQKGSYALRKLYHESKKPLLVIFSSPS
    CGPCHVLKPQLKRIIKEL
    NGAVLGVEIDIDKDQDIAKQAGINGTPTVQLFKDKLLKKQWQGVKQRSEFKEAIKNII

    >gi|78779778|ref|YP_397890.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9312]
    MTDSSFDFDLIVIGAGYGGFDAAKHAAGKGLKVAIVESSDMGGTCVNKGCVPSKALLAASGKVREIADYEHLAKFGIHAS
    PVRFERSKIADHANNLVLNVRENLTKTLKRSGVEIILGIGRIEGNQKVGVRDKNGIDKIFTCKNIVIATGSSPFVPRGIT
    LDNRTVFTSDDAVKLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALENIMPTFDPDITKIAKKNLIQARDIDTKS
    NVFATKITPGCPVKIELTDAKSKEVVETLEVDAVLVATGRSPNSNNLNLESAGIETVKGFIPIDDQMRVKNGDEIIPNIW
    AVGDVTGKLMLAHTAAAQGTIAVDNICGGNVEINYKSIPAATFTHPEISSVGLSEAEAKEISAKENFTLGVVKSFFKANS
    KALAELESDGLLKLIFNKDNGKVLGAHIFGLHAADLIQEISNAISRNQDVIELSTEVHTHPTLSEVVEVAYKQAASQIK

    >gi|78779815|ref|YP_397927.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9312]
    MKYFLPLIIALSIFINPVNAFAEELILAGGCFWCLEHDLESLKGINFVQSGYSGGDLQNPTYENHEGHQEVVLVNYDSQL
    VTLPEILRLYLRNIDPLDGKGQFCDRGDSYRPVIFFKDATEESDATNAIVSASNELRVPLEKIAVELKSKGQFWLAEEYH
    QDFAERNELKYKFYRFSCGRDQRLDKLWGNNARSTNLWIE

    >gi|78780046|ref|YP_398158.1| rhodanese-like protein [Prochlorococcus marinus str. MIT 9312]
    MSKDIKFNCLNSDEEERYQKHLTLKEIGYEGQIDIKNSSVLCIGAGGLGSSVLLYLTASGIGEIGIVDNDHVEKSNLQRQ
    IIHETNNIGNLKIDSARERMRKLNPNSKLITFAERINPKNALEIIRQFDIICDCSDNFSTRYLINDACLILKKPLVFGSV
    QGFEGQVSVFNLHEKSPNLRDLLPESPSKNNVPS
    CAEYGVVGVSTGLIGILQVNEIIKIILKKGEILDGKILIFDLLNMN
    MKKLNLKGDQINKRIKNLSQFVDFYCEDECSDKNKINRINANDFNSLYKAKPNKILLIDVRENEEFSNSAIEGSISIPLS
    HLSQKPDLEFIQKESLIKEVFTICKSGKRSEKASKILSKFKIKSRSIEGGIEKVKKLLCN

    >gi|78779851|ref|YP_397963.1| hypothetical protein PMT9312_1467 [Prochlorococcus marinus str. MIT 9312]
    MQDKFLEPYDLAVVGGGAAGFMTAITAAENGVKRIIILEGTSKLMEKIRISGGGRCNVTNATWIPNELVENYPRGGIQLL
    ESFNRFASGDVFDWFEKKGLKLKIEEDLRVFPASNSSSDVIECLRKSALSKNVEILTKCFVKEILKTPDNIFKIFSLKEE
    TVITKNIILSTGGHPSGYKLAQNLGHSIVKPVPSLFTFSTKEPNLDECSGVSIKGIDIEIKLNNKTFQNRGDLLITHWGF
    SGPAVLKLSSIAARELFSQKYKFNLIIKWSFLSYEELKEKINFLRLNKGKVNLINSRPVSLLTKRLWIFLLNKIGIDKEK
    KWADLMAYERDKMINTLMRDKYIISGKGPFGEEFVTSGGVKINEVNFKTMESLICPGLYFSGEVLDVDGITGGFNFQHCW
    TSGWIAGMAVSKLNQ