Bacillus atrophaeus 1942 uid59887

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|311067297|ref|YP_003972220.1| dihydrolipoamide dehydrogenase [Bacillus atrophaeus 1942]
    MTLAIIGGGPAGYAAAVSAAQQGRQVILIEQGQLGGTCLNEGCIPTKSLLESVNVLDKIKHAETFGITLSHGKITINWGN
    MQSRKQQVADQLVQGVQFLMKKNKIKTIQGTASFLSDRKLSIHREDGRKEIAEAEHVLIASGSEPASLPFAPFDGEWVIN
    SKDALTLPDIPDSLMIIGGGVIGCEFAGLFGRLGTKVTIIEAADQLIPAEDADIARLFQEKLEEEGVEIHTSASLQRVDK
    AAKTVIYKSGGREAEAHADYVLIAIGRKPRISGLELEQAGISFSSSGIHVNEHMQTNIPHIYACGDAVGGIQLAHAAFHE
    GVIAASHASGRDVKVNERAVPRCIYTSPEIACIGMTEKQARREYGHVQIGEFPFSANGKALIKNQYSGKIKIITEPEFGE
    IIGVSMIGPDVTELIGQAAAMINGEMTVDMTEHFIAAHPTLSETLQEALLSTIGLAVHA

    >gi|311067353|ref|YP_003972276.1| putative bacterioferritin comigratory protein; putative peroxiredoxin [Bacillus atrophaeus 1942]
    MAVEIGQETPDIELKGDNGEKVRLSDFKGKYIVLYFYPKDMTPGCTTEACDFRDHHESFAELDAVIIGVSPDSEEKHGRF
    KEKHGIPFLLLVDDENKLAEAFGVWKLKKNFGKEYMGIERSTFIIDKEGRLIKEWRKVKVKDHVAEALQALKEVSAK

    >gi|311067640|ref|YP_003972563.1| transcriptional regulator Spx [Bacillus atrophaeus 1942]
    MVTLYTSPSCTSCRKARAWLEEHEIPFEERNIFSEPLSIDEIKQILRMTEDGTDEIISTRSKVFQKLNVNVESMPLQDLY
    TLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRSFQLREAQRLAN

    >gi|311067661|ref|YP_003972584.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus atrophaeus 1942]
    MTGRYSRQELFAPIGPSGQEKLMEARAVVIGGGALGTASAEMLVRAGVGSVTIADRDYVEWSNLQRQQLYTEDDVKKEMP
    KAAAAEKRLRSINSDVHVKGIVMDVTAENVSELIEGASVIVDAADNFETRLIVNDAAVKMGIPFLYGACVGSYGLTFTVL
    PGVTPCLHCLLDKLPLGGLT
    CDTAGIISPAVLQVAVYQVTDALKLLTGERTEPMIRSFDLWKNERSEINAASLVNASCPS
    CGTKDFPFLSYENQTKAAVLCGRDTVQIRSGLAKQPDLESLAVRLRQAGLEVTANPYLISCRSHDMKMVLFQDGRAFIHG
    TNDITKAKSLYHKWIG

    >gi|311067814|ref|YP_003972737.1| peroxiredoxin [Bacillus atrophaeus 1942]
    MTNTLFTASVSAVGGREGRIVSSDRVLELDVAMPGTPRAKKVEKATNPEQLFAAGYAACFDSALQLVARKERLKIETEVT
    ANVSLLKDEEDQGFKLGVTLQVKGMGIAKSDLETLVQKAHGV
    CPYSKATSGNIDVTLVVAE

    >gi|311067816|ref|YP_003972739.1| organic hydroperoxide resistance reductase B [Bacillus atrophaeus 1942]
    MGSLFTAKVTAKGGRAGHIKSDDGVLDFNIVMPNAKKDGETGTNPEQLFAAGYAACFGGALEHVAKEQKIDIDSEVEGQV
    SLMKDESDGGFKIGVTLVVSTKGLDDGKAKELVEAAHDF
    CPYSKATRGNVDVQLKLK

    >gi|311067866|ref|YP_003972789.1| O6-alkylguanine DNA alkyltransferase [Bacillus atrophaeus 1942]
    MSCYEITETPLGEVAIVEEESKITRLLLSEEDFLKWKDAAPMAEKQETPILKEAKQQLREYFAGDRKTFSLPLVQKGTSF
    QQKVWQALDMIPYGESRSYADIAAAVGSPKAVRAVGQANKRNALPIFVP
    CHRVIGKNRALTGYAGSRTNVKAVLLRIEQI
    PYKEK

    >gi|311067897|ref|YP_003972820.1| thiol-disulfide isomerase [Bacillus atrophaeus 1942]
    MTKRFTLIASLVMVAIFSWLPEATAEKRSVPAVFLMKTIEGDDISIPHKGQKTILHFWTSWCPPCKKELPQFQSFYEEQQ
    AGGVQLVTVNLVNAEQNKQAVVDFIEANKLTFPVVLDSQGDLMKTYHIVTIPTSFLLNEKGEIEKTAVGPMTAEQLKEWA
    QE

    >gi|311067937|ref|YP_003972860.1| putative 2-cys peroxiredoxin [Bacillus atrophaeus 1942]
    MAERMVGKQAPRFEMEAVLANKEFGKVNLEENMKNDKWTVLFFYPMDFTFVCPTEITAMSDRYDEFEDLDAEVIGVSTDT
    IHTHLAWINTDRKENGLGELKYPLAADTNHEVSREYGVLIEEEGVALRGLFIINPEGELQYQTVFHNNIGRDVDETLRVL
    QALQTGGLCPANWKPGQKTL

    >gi|311067938|ref|YP_003972861.1| thiol-disulfide isomerase [Bacillus atrophaeus 1942]
    MKLRQPMPELTGEKAWFNGEVTKEQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYKDKLNVVAVHMPRSEDDLDLDK
    IKEVAAEHDISQPIFVDSDHALTEAFENEYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLAETEQAAE

    >gi|311067942|ref|YP_003972865.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus atrophaeus 1942]
    MQERYSRQTRYKPIGEEGQQKLAGSHVLFVGAGALGTAGAEGLVRAGAGNITIIDRDYVEWSNLQRQQLYTEDDANNRLP
    KAMAAKQHLTSINSDIHIEALVTEGTAETLEPLIRQADVVIDATDNFETRMIINDLAQKTKTPWIYGACVGSQGMFMTII
    PGVTPCLSCLFDQIPVGGAT
    CDTAGIISPAVQIVSAYQQAEALKLLTGKSGAVQRGFVTFDVWNNLHMKVDVEQIKRNEC
    PSCGSQQIYPYLQEWNMPKAAVLCGRDTVQVRSEALKRISKQQLVQRLEKIGKVEANEFLLHIVYERFRIVIFNDGRALV
    HGTKEVKEANSVLARLIGM

    >gi|311067977|ref|YP_003972900.1| dihydrolipoamide dehydrogenase [Bacillus atrophaeus 1942]
    MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALINAGHRYENAKHSDDMGITAEN
    VTVDFTKVQEWKASVVDKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENSAQTYTFKNAILATGSRPIELPNFKYS
    DRVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVKRNLKKKGNVEIHTKAM
    AKSVEEKADGVTVTFEVNGEEKTVDADYVLITVGRRPNTDELGLEQVGVEMTDRGVVKTDKQCRTNVPNIYAIGDIIDGP
    PLAHKASYEGKIAAEAIAGEPAEIDYLGIPAVVFSEPELASVGYTEAQAKEEGLEIVAAKFPFAANGRALSLNETDGFMK
    LITRKEDGLVIGAQIAGASASDMISELSLAIEGGMTAEDIAMTIHAHPTLGEITMEAAEVAIGSPIHIVK

    >gi|311068251|ref|YP_003973174.1| putative peroxiredoxin-related protein [Bacillus atrophaeus 1942]
    MADHHFYLKAQWPGKRNDVGTIESGNLMTSISIPKEMDGPGQGTNPDEMLLGAAATCYIITLAAMMERSGLEKEDLHMES
    EGIVEVKNGIFTYKTIIHRPVILLKPNASQADLALAHKLAEKAESS
    CMISRAVQGNVELKLEASVRASGE

    >gi|311068367|ref|YP_003973290.1| putative membrane-bound proteins with a thioredoxin-like domain [Bacillus atrophaeus 1942]
    MLSLLFMKYWPRGWHMLKKWLAGICLIGLAVYMCWTFYENYTKKEEVGIEEGQKAPDFSLKTLSGEEASLSDYKGKKVLL
    NFWATW
    CHPCRKEMPAMEELQKEHSEIAVVAVNFTSAEKGEKTVKQFADSLHLTFPILIDKSGINADYSVLTYPTTYILD
    EKGVIQQIYAGTMTKKQMKQKLGLN

    >gi|311068679|ref|YP_003973602.1| methionine sulfoxide reductase B [Bacillus atrophaeus 1942]
    MAGNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSMDKFDSHCGWPSFTKPIEDKEVEEKV
    DTTHGMIRTEVRSRTADSHLGHVFNDGPGPSGLRY
    CINSAALRFIPKDKLKEEGYEAYQHLFDK

    >gi|311068680|ref|YP_003973603.1| methionine sulfoxide reductase A [Bacillus atrophaeus 1942]
    MSEKKEIATFAGGCFWCMVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQITFQPDVFPYEKLLELFWQQ
    IDPTDAGGQFADRGSSYRAAIFYHNEKQKELAEESKKRLEKSGIFKAPIVTDILKAEPFYEAEDYHQGFYKKNTAHYQRY
    RIGSGREGFINQHWGAK

    >gi|311068701|ref|YP_003973624.1| putative peroxidase [Bacillus atrophaeus 1942]
    MSIYDIEVRTITGEETTLQPFAGKVMIIVNTASKCGFTPQLKQLQELYDTYQQEGLEILGFPCNQFMNQEPGDETSIQEF
    CKKNYGVTFPMFAKIDVNGAKAHPLFTYLTEQAKGMLGTKAIKWNFTKFVVDKKGNIVGRYSPNTNPKEIEDTILKLLAE


    >gi|311068832|ref|YP_003973755.1| thiol-disulfide oxidoreductase [Bacillus atrophaeus 1942]
    MKKKRRLFIRTGILLILICALGYTIYNAVFADKESISEGSQAPNFVLKDAEGNRIELNGLKGKGVFLNFWGTWCEPCKKE
    FPYMANQYKHFKDQGVEIVAVNVGESRLAVHNFMNSYGVNFPVVLDSDRQVLNAYGVSPIPTTFLINPEGKIVKVVTGTM
    TESMIHDYMNLIKPGESSG

    >gi|311068965|ref|YP_003973888.1| hypothetical protein BATR1942_10120 [Bacillus atrophaeus 1942]
    MQIYLTDTAKQTLQQAMVANPGKKAQLRFDAEGCGCAVSGVPTIWLSEQLTGECEQLETNGVPLYIQSSQKVFFDDQMTI
    DYNEKANTLALKSPAQMLSPRMSILVK

    >gi|311069006|ref|YP_003973929.1| dihydrolipoamide dehydrogenase [Bacillus atrophaeus 1942]
    MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVYKTSREAAQFGVETSDVSLNF
    EKVQHRKQEIVDKLANGVQHLMKKGKIDVYEGYGRILGPSIFSPMPGTISVERNNGEDNDMLIPKQVIIATGSRPRMLPG
    LEADGKYILTSDEALQLKELPESIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTDDKDISKEMQNLLAKKGIEIV
    TGSKVLTDSFTKTDGVSIQAEKDGETVTYSAEKMLISVGRQANVEGIGLENTDILTENGVISVNDTYQTKESHIYAIGDV
    IGGLQLAHVASREGIIAAEHIAGLEPLPLNPAFVPKCIYSNPEAASVGLTEEEAKQNGYQTKIGKFPFMAIGKALVHGET
    DGFVKIVADADTDDILGVHMIGPHVTDMISEAGLAKVLDASPWEIGHTIHPHPSLSEAIGEAALAADGKAIHF

    >gi|311069056|ref|YP_003973979.1| putative sulfur transferase [Bacillus atrophaeus 1942]
    MSNMIVLIIFAAFIVYMVISYIYQQRIMKTLTEEEFRAGYRKAQLIDVREPNEFEGGHILGARNIPLSQLKQRKSEIRPD
    KPVYLY
    CQNNVRSGRAAQTLRKNGCKEIYNLKGGFKKWGGKIKSKN

    >gi|311069079|ref|YP_003974002.1| transcriptional regulator of stress [Bacillus atrophaeus 1942]
    MEELTFYSYPSCTSCRKTKHWLKAHQIDFNERHLFRETPTMEELKYILSLTTEGIDEILATRSQTFKELNLNIEEMTVNE
    VLDLLIEKPKLLRRPILVDNRKLVIGYNPGELLKLTKKKTVHQSVS

    >gi|311069164|ref|YP_003974087.1| hypothetical protein BATR1942_11125 [Bacillus atrophaeus 1942]
    MIYQGFASVYDELMSHAPYDEWTDWIEASLPQKGRVLDLACGTGEISIRLAEKGWEVTGIDISEEMLSYAQQKAAGKQPI
    LFLQQDMRELEGYDGQFDAVVICCDSLNYLKNKNDVIKTFKSVFRVLKPDGILLFDVHSPYKMAEIFPDSTYADQDEEIS
    CIWQSFAGGEELSVVHDMSFFVWNGEAYDRFDETHEQRTFHINEYEQMLEDTGFKLEKVTADFSNLPPSSQSERLFFSAQ
    KLKTIV

    >gi|311069341|ref|YP_003974264.1| thioredoxin [Bacillus atrophaeus 1942]
    MAIVKATDQSFSAETNEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKD
    GEVVETSVGFKPKEALQELVNKHM

    >gi|311069435|ref|YP_003974358.1| thiol peroxidase [Bacillus atrophaeus 1942]
    MASITFKGGPVTLVGQEVKVGEQAPDFTVLTNGLEEKSLADFKGRATIISVIPSIDTGVCDAQTRRFNEESAKLGDVNVL
    TISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVFAEYVSEATNHPNYEKPIE
    AAKALLK

    >gi|311069482|ref|YP_003974405.1| putative thiol-disulfide oxidoreductase with thioredoxin domain [Bacillus atrophaeus 1942]
    MKKLESIEELQKAVKDDWAVFMFSADWCPDCRFVEPFLPELEANFPEFTYYYVDRDKFIDTCAEWEIYGIPSFVVFNEGK
    EVSRFVSKDRKTKEEIEQFLTESLAQ

    >gi|311069501|ref|YP_003974424.1| putative NAD(FAD) dehydrogenase [Bacillus atrophaeus 1942]
    MKQYDVIVIGGGPSGLMAAIAAGEQGASVLLIDKGNKLGRKLAISGGGRCNVTNRLPVEELIKHIPGNGRFLYSAFSEFN
    NEDIIAFFEKLGIQLKEEDHGRMFPVTDKAQSVVDALLDRLKQLGVTIRTNEKIKTVSYENGRAAGIITNNDEVIHARAV
    IIAVGGKSVPHTGSTGDGYAWAEAAGHTITELFPTEVPVTSAEPFIKQKTLQGLSLRDVGVSVLNKRGKPVITHVMDMLF
    THFGLSGPAILRCSQFVVKELRKQPEVKLRIDLYPHINEEELFQKMHRELKEAPKKAIKNVLKPWMQERYLLFLLEKNSI
    DPQISFSELPKENFRAFIKDCKQFTVTANGTLSIDKAFVTGGGVSVKEIDPKKLASKKMDGLYFCGEILDIHGYTGGYNI
    TSALVTGRLAGVNAGRFAKENA

    >gi|311069520|ref|YP_003974443.1| YtwF protein [Bacillus atrophaeus 1942]
    MTIKEISTVALQEKLEADEELYLIDVREDEEVAEGMIPEAVHIRMGDIPEKMDAFDKEKEYVFICRSGKRSMNVCMYLQE
    QGYKTVNVEGGMLDWEGETKPKN

    >gi|311069710|ref|YP_003974633.1| putative chaperone involved in Fe-S cluster assembly [Bacillus atrophaeus 1942]
    MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKGEQDSAFEQHGITVLVDNESMDIMNGTII
    DFKQSMMGGGFTIDNPNAIASCGCGSSFRTAQNAGKPEEC

    >gi|311069786|ref|YP_003974709.1| hypothetical protein BATR1942_14280 [Bacillus atrophaeus 1942]
    MTQYNESGNMQNALKQYKEGLGTFEQKMPMMGRKFNEFTEQCFEANSLTEKEKQLIALGISIHAQDEYCMIYHTKGCIDQ
    GATEENILETVSVAAAFGGGAALSQGVTVVQQCIQEFGSTTH

    >gi|311069791|ref|YP_003974714.1| putative thiol-disulfide oxidoreductase with thioredoxin domain [Bacillus atrophaeus 1942]
    MKELQEQELELIKEDVYLLYLYTPFCGTCQLAGKMLSVVEEMLPQVAYYKNNVNYSPTFAKAYKIESVPCFLLFKDGKVV
    ERGYAFHSVSYLYDMIKQKASNTSRL

    >gi|311069795|ref|YP_003974718.1| putative oxidoreductase [Bacillus atrophaeus 1942]
    MSLNFYWYPKCGTCRKAKKWLEEHGKEINEIHIAEQTPSKEEIKALYEKSGLELKKFFNTSGLKYRELNLKEKLYHMSED
    EQLELLASDGMLLKRPITSDGEKVTVGFKEDQFEKNWM

    >gi|311069870|ref|YP_003974793.1| thiol-disulfide oxidoreductase [Bacillus atrophaeus 1942]
    MKKKQQSSAKFAVILTVIVVVLLAGIVLINNSTQQSSETVSSQPSIKGQPVLGKNDAPVTVVEFGDYKCPSCKVFNNDIF
    PKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWSFHEKLFEEQPNTEQEWVTPALLGNVAKSTTKVN
    PATLKENLDKETFSSEVEKDSELNNKLNILATPTIYVNDKVIKKFGDYSEIKKAIEKELKGKQ

    >gi|311069871|ref|YP_003974794.1| copper(I)-transporting ATPase [Bacillus atrophaeus 1942]
    MEKGKQEFMLNGLDCSNCAKKIENGVRGIDGIDSCAVNFAASTLTVSSSEKDEQWLLNEVAKKVKSIESHVTVRPKHEKK
    PADDGYKKRLQHMLLRLAAGAVLGAIALLAHPGAAMEFLLYFAAYLIIGGDIVARAIKNIFRGQVFDEHFLMALATIGAF
    IIHQYPEGVAVMLFYQIGELFQGAAVSRSRKSISELMDIRPDYANLKTGEGIRLVSPEEVKIGDIIIVNPGENIPLDGRV
    AAGASMVDTSALTGESVPKKAEKGKDVMAGFINQNGVLHIEVTKGYEDSAVSKILDLVQNASSRKAQTENFITKFAKYYT
    PAVVIIAMLLAFLPPLLISGAVLSDWVYRALIFLVISCPCALVVSIPLGFFGGIGAASKAGVLVKGSNYLEALNQVKYAV
    FDKTGTLTKGSFEVTELNPAGEFTKEELLEAAALAEIHSQHPIAESIRKAYGKTLSAETIKSYEEIPGHGIKATVNGKAI
    LAGNMKLMDKEQIDHGQTRITGTVVHIAIDHRYAGSIVIADEIKEDAKQAVTALKALGVKRTIMLTGDTKQTGEAVGKSV
    GIDDIYADLLPQDKVEQIEALEAKLLPNEKLIFVGDGINDTPVLARADIGAAMGGLGSDAAVEAADIVLMTDQPSKIAEA
    IRVARRTRRIVWQNIGFALGVKAIFLLLGALGFATMWEAVFSDVGVTLLAVGNAMRIMRLKNE

    >gi|311069872|ref|YP_003974795.1| copper transporter ATPase [Bacillus atrophaeus 1942]
    MSEQKEIALQVSGMTCAACASRIEKGLKRMDGVTDAHVNLALETSNVTYNPSETGAAAIKEKIEKLGYGVVTEKAEFQIA
    GMT
    CAACANRIEKRLNKTEGVSSAPVNFALETVAVEYNPKEVAITDLKETVAKLGYQLEQKGEADGETESPQKKEQRKQT
    VRLIFSAILSFPLLWAMVSHFSFTSFIWVPDIFMNPWMQFALATPVQFVIGWPFYTGAYKALRNKSANMDVLVALGTTAA
    YVYSLYLTIQSLGAHGHTDGLYYETSAILLTLILLGKRFEAKAKGRSSDAIKKLMKLQAKTATVVRDGQEQVIPIEDVMT
    GDLVYVKPGERIPVDGEVTEGRSAVDESMITGESIPVDKSPGDSVTGATMNANGFLKIKAVNVGKDTALSQIIRVVEEAQ
    GSKAPIQRLADQISGIFVPIVLGIAVTTFLIWYFWAAPGDVGEAISKLIAVLVIACPCALGLATPTSIMAGSGRSAEFGI
    LFKGGEHLEKTHRLDTIVLDKTGTVTNGKPVLTDAVAADGFEETELLRLAAAAETGSEHPLGEAIAAGVKEKGIDIPKLT
    RFEAKIGAGVSAEAAGKTILVGSRRLMESEGVQHEALLFQMSALEGEGKTVMLVSVDGEPAGLIAVADTIKETSREAVKR
    LMSMGLEVIMMTGDNRKTAEAIAKEAGITRVIADVRPEQKAEEIFRLQQTGSRVAMVGDGINDAPALATADIGMAIGTGT
    DIAMETADITLIRGDLNSIADAIRMSRLTMKNIKQNLFWALGYNTLGIPIAAFGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RAK

    >gi|311069873|ref|YP_003974796.1| copper insertion chaperone and transporter component [Bacillus atrophaeus 1942]
    MEQTTIKVEGMSCQHCVKAVESSVGELNGVSAVQVNLEAGEVDVSFHADQVSLKEITDAIEDQGYDVAG

    >gi|311069987|ref|YP_003974910.1| thioredoxin reductase [Bacillus atrophaeus 1942]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTEDVENYPGFESILGPELSNKMFDHAKKFGAEYA
    YGDIKEIVDGKEYKTVKAGSKEYKARAIIISAGAEYKKIGVPGEKELGGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVEE
    GVYLTRFASKVTIVHRRDKLRAQSILQARAFDNEKIDFIWNKTVKEIHEENGKVGKVTLVDTISGEEEEFATNGVFIYIG
    MLPLSKPFENLGITNDEGYIETNDRMETKVDGIFAAGDIREKSLRQIVTATGDGSIAAQSVQHYVEELQETLKAMK

    >gi|311070339|ref|YP_003975262.1| putative sulfur oxido-reductase [Bacillus atrophaeus 1942]
    MTVHIKVYSDYVCPFCYVGKASFEEAIKGKDVEVEWLPFELRPSPAPQLDPVNDPAKQQMWKTSIEPMAQKLGVDIKFPN
    VSPHPYTDLAFEGFHFAKEHNKGHEYNTRVFTAFFQEEQNIGDIEVLTKLAEEVGLDGERFKAALESRTYQGTQQKALQH
    AYEEADITAVPTFIIGDEKIPGAASKEMFEKIIEQESNKMS

    >gi|311070532|ref|YP_003975455.1| hypothetical protein BATR1942_18035 [Bacillus atrophaeus 1942]
    MSLIGKEVQPFAAKAYKNGEFIDVTNESLKGQWSVFCFYPADFSFVCPTELEDLQNQYAALKELGVEVYSVSTDTHFVHK
    GWHDSSEKIGKITYAMIGDPSQTISRNFDVLNEEEGLADRGTFIIDPDGVIQTVEINAGGIGRDASNLVNKVKAAQYVRQ
    NPGEVCPAKWEEGSETLTPSLDLVGKI

    >gi|311070533|ref|YP_003975456.1| alkyl hydroperoxide reductase subunit F [Bacillus atrophaeus 1942]
    MVLEANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALIDELASMSSKITVEKAELNRTPSFSVNRVGEDTGVTFAGI
    PLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYRFESYISLT
    CHNCPDVVQALNMMSVLNPNITHTMIDGAAFKE
    EVENKNVMAVPTVYLNGETFGSGRMTLEEILAKMGSGADASEFADKDPYDVLVVGGGPAGASAAIYTARKGIRTGVVAER
    FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELENGAVLKSKTVILSTGARWRN
    VNVPGEQEFKNKGVAY
    CPHCDGPLFEGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTV
    LKNAQTKEITGDQSVNGITYTDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIVVDKRGATSVPGLFAAGDC
    TDGPYNQIIISMGSGASAALGAFDYLIRN

    >gi|311070615|ref|YP_003975538.1| ArsR family transcriptional regulator [Bacillus atrophaeus 1942]
    MNERNLKDLLYQEFARIGKSLSSPRRLEILDVLTQGPKTVETLAKSTNMSIANVSQHLKTLFNSRMVNYKKEGNYVIYEL
    ADEIIADFLTSLHALSEKQLVQVQQIKQEFLNDKLGMEGVTLSELKERMEKGEVLLLDVRPPEEYEKAHIPGAISIPIEE
    LENKLSSLPPNCEVVAY
    CRGPYCLMSAEAVEILRANGIHAFRLEEGVRDWKQITDLGD

    >gi|311070619|ref|YP_003975542.1| hypothetical protein BATR1942_18470 [Bacillus atrophaeus 1942]
    MPNKSKPNRLINEKSPYLLQHAHNPVNWYPWGEEAFEKAKRENKPVLVSIGYSTCHWCHVMAHESFEDEEIARLLNERFV
    AIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQKPFYAGTYFPKTSKFNRPGFIDVLEHLSNTFANDREHVEEI
    AENASSHLQIKTPEGNGTLTKEALHRTFQQLMSGFDTVYGGFGQAPKFPMPHMLMYLLRYHQYTGQENALYNVTKTLDSM
    ANGGIYDHVGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQDSRYQHIVEQIITFIQREMTHEDGSFYSALD
    ADTEGVEGKYYVWSKDEIIETLGDELGELYCAIYNITSSGNFEGHNIPNLIHTKLDKVKAEFDLNEQEINKQLGEARQKL
    LKKRETRTYPHVDDKVLTSWNALMIAGLAKAAKVFQAPEYLNMAQAAAAFIEKKLIIDGRVMVRYRDGEVKNKGFIDDYA
    FLLWAYIELYEAGYDLAYLQKAKDLSAKMLDLFWDQKHGGFYFTGHDAEALLVREKEVYDGAVPSGNSVAAVQLLRLGQL
    TGELSLIEKAEKMFSAFKRDVEAYPSGHSFFMQSVLTHMMPKKEIVIFGRKDDSQRQHIISALQQAFQPNFSVLVAEHPD
    QCKDIAPFAADYRIIDGKTTVYICENFACQQPTTDIEEAIKTLSSRD

    >gi|311070623|ref|YP_003975546.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus atrophaeus 1942]
    MQAKQHTIIYWTLFVCNQWNVYIAATSKGLCFVGSKDFDEVVLCAERKFPQHTLVQDDKVLHPYVAELEEYIKGDRKEFT
    MPIDVQGTPFQLAVWNALREIPYGETYSYSDIAERIQKPDSVRAVGTAIGANPVLITIP
    CHRVIGKNGKLTGFRGGLEMK
    KQLLSLEKESSCHSGKQ

    >gi|311070885|ref|YP_003975808.1| hypothetical protein BATR1942_19810 [Bacillus atrophaeus 1942]
    MENKYRVLLYYKYVPIEEPEEFTAQHLSFCKELGLLGRILISAEGINGTVSGTFEQTEQYMQALKADPRFADMPFKIDEA
    SGHAFKKMHVRHRDELVSLRLEDDVDPNEITGKHLSPPEFFEQMQSDDTVVIDARNDYEYDLGHFRGAIRPDIEAFRELP
    DWIQDNKEILEGKKILTY
    CTGGVRCEKFSGWLMKEGYEDVSQLDGGIVTYGKHPEVQGKLWDGQCYVFDERISVPVNRVE
    HVIVGKDCFTGEPCERYVNCANPSCNKKMICTPENEYKYMRSCSHECRTNPRNLYVKEHGMTAEEINARLAAIETEDQAS
    AE

    >gi|311071125|ref|YP_003976048.1| putative thioredoxin or thiol-disulfide isomerase [Bacillus atrophaeus 1942]
    MKKITTKEQFNELIQSDKEIIIKFYADWCPDCTRMNMFIGDILEAYNQNDWYELNKDELPELAETYQVMGIPSLLVFKNG
    EKTGHLHSANAKSPEEVTEFLSEHIS

    >gi|311068686|ref|YP_003973609.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase [Bacillus atrophaeus 1942]
    MRYVKCVAAAVFLLMLCACGGQQIKDPLNYEIEPFSFKNQDGKTVSLDRLKGEVWLADFIFTNCETVCPPMTAHMTDLQK
    KLKAEDADVRIVSFSVDPENDTPKELKKFAANYPMSFDNWDFLTGYSQSEIEAFALNSFKSIVKKPEGEDQVIHQTSFYL
    VGPDGKVLKDYNGVENTPYEDIIADVKAAEKLK

    >gi|311070987|ref|YP_003975910.1| assimilatory nitrate reductase electron transfer subunit [Bacillus atrophaeus 1942]
    MNKQTLILIGNGMAGVRCIEEIVKLDSSAFEIVIIGSEPHVNYNRIRLSSVLQGEASLDEITLNNSNWYATHGITLYTGE
    TVVDIDTDKQIVSTDQKRSLSYDKLIVATGSTPYILPIPGHDKEGVYSFRTIED
    CQSFIKIARHYQKAAVIGAGILGLEA
    AIGLKNLGMDVNVIHHSFSIMQKQLDQTASHMLKSALERKGLAFLLQKDTEAILGNSRASGVRFTDGSSIEADLIVMAAG
    VRPNIQLAASAGISTNRGIIVNEYMQTNMPNVYAVGECAEHNGIVYGLVAPLYEQGKALATHICGVLGEGYQGTPQSAAL
    KIAGIEVWSAGKVHADETTTSIQLYDEQAGIYKKALFQDDKLSGVILFGDTRDKQQLLDSLLKQRDISIVKKQLIEPNQT
    ANVFESMPSSETICQCNSVTKGSMMEAVNTKGLKTVEEVRNCTKASGSCGGCKPLVEELLAYVLSGEHTEKAGKPPFCGC
    TGFTEEEIIAELQRRPFTAPAEVMNHLGWKTENGCQTCIPAIQYYLGMIRPDLVQNHETAMKKGDTCTLIPQMYGGLTNA
    EELRRIADIIEIYNIPSVSITHSQRLRLSGIKPDDLPNIRQALQMPICSNHHYTVHSVTSCTCGQNSSFQTLAGSIEKKI
    ENLSMPAPVSISLSCEKDCEDAAIQDIGAIQIYGGWDIYAGGRRGTHAHAGELLCVTENQKDTAAMIKCLLQYYRETANY
    SEALHQWMSRLGIIHIREILFDQDLRIQLLKSLETDVSLIQNPLTHVKRS