Prochlorococcus marinus MIT 9303 uid58305

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124021730|ref|YP_001016037.1| hypothetical protein P9303_00151 [Prochlorococcus marinus str. MIT 9303]
    MPITALLLSRRSLLIATIAGVFGVYRRPAAAFAATRAEDLAWSLSNEQWAQRLSPEAYRVLREEGTERPFTSSLDKEKRV
    GIYHCAGCDLPLFSSAAKFDSGTGWPSFWEPLAGAIQTKVDFKLIIPRSEYHCRRCGGHQGHVFNDGPRPTGKRY
    CNNGV
    ALTFRPAS

    >gi|124021875|ref|YP_001016182.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9303]
    MAINISQIVVRTPEGAEKSLSEYNGTVLLIVNVASRCGFTKQYKGLQALQDTYGPKGLKVLGFPCNDFGAQEPGTLEEIK
    SFCSTTYGASFELFDKVHAMDKTTEPYTTLNQTEPAGDVAWNFEKFLVGKDGTVIKRFKSGVEPESTELKGAIEQALNT

    >gi|124021974|ref|YP_001016281.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9303]
    MTLQIGDPAPDFNLPNQDGTLVQLASLRGQRVVIYFYPKDDTPGCTKEACNFRDQWERFEANDIKVLGISKDGATSHTKF
    INKYQIPFTLLSDTEPCPVASSYESYGLKKFMGREYMGMMRHSFVVDPKGNLELIYLKVKAATMADQILKDLGLD

    >gi|124022035|ref|YP_001016342.1| putative methionine sulfoxide reductase family protein [Prochlorococcus marinus str. MIT 9303]
    MSRSDSSASDSVDWIKLSPEEWQARLTREQYQVARKGGTERAFTGAYWNHKAAGMYCCVCCGAPLFSSATKFDSGTGWPS
    FSDGVKAGAITTHRDTSHGMERTEINCSRCGAHLGHVFNDGPAPTGQRY
    CVNSASLDFSEQSEV

    >gi|124022094|ref|YP_001016401.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9303]
    METIEADVVIVGGGPAGCSCALYTSRADLKTVILDKNPDVGALAITHQIANYPGVSSEMSGEALLALMREQAVSFGSDYR
    RAQVFGVDVNGEWKTVYTPEGTFKARALVVATGALGRPASFKGEAEYLGRGVSY
    CATCDGAFYKGREVAVVGANKEAVEE
    GQVLTKFASTVHWLTTSDPKEDDVHAQALMTQPNVQHWSRTRLMLIEGDDAGVTGIKLKNRAQETEQDLAVEGVFVYMSG
    SKPITDFLGDQVAFKEDGGVVVDDFMATTVDGVWAIGDIRNTPFKQAVVAASDGCIAAMAIDRFLNSRKGIRVDWVH

    >gi|124022264|ref|YP_001016571.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9303]
    MKTTFRPLRRWWIAIFLCVALLGLPLQVLASVEEAVFAGGCFWCLEHDLEGLTGVISAESGYTGGDLPRPTYSQVSSKTT
    GHQEAVRVRFDAAQISYAELLRSYWRNVDPLDGDGQFCDQGDSYRPVIFTRDDQQDSEARESADAAALELAEPMSNLKVE
    IKPLSEFWLAEDYHQNYAELNSIKYNFYRYSCGRDRRLDQLWGDKARTGLPWQRPDQANLRKK

    >gi|124022287|ref|YP_001016594.1| hypothetical protein P9303_05771 [Prochlorococcus marinus str. MIT 9303]
    MSHPSESSAAPCITTVDEFEKLADYSLMNSLNTDPDSRVDGDDHLARQVFSGHFVPVTPTPLKNPEYVTHSSTFFNELGL
    NNELAFNEKFCKLFSGDLSATREPMRQVGWATGYALSIYGREYTQQCPFGTGNGYGDGRAISVFEGIINGKRWEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQEYMQALGVPTSRSLTLYVSKSETITRPWYSQHSQSIDPDILVENPVAISTRVAPS
    FLRVGQLELFARRARSNTHPRALEELRMIVSHLIEREYKNDINQSLAFTVQLVELARLFRERLTLLVANWQRVGYCQGNF
    NSDNCAAGGFTLDYGPFGFCEIFDPAFQPWTGGGEHFSYFNQPIAAEANYHMFWKALRPLLEEDAKALKEFDQVRDGFEQ
    AMNKQIQKMWAAKLGLKEYNSNLFEELLQLMLNSKVDYTIFFRELSYIPNDLLALKKSFYIQTSQQIDEQWQSWLQSWRD
    LVLNNGNSTEISKIMKLTNPKYTWREWLIAPAYQQAEEGDYSLVKELQEALSHPYDEQSKEIEDKYYRLKPKAFFNAGGI
    SHYS
    CSS

    >gi|124022457|ref|YP_001016764.1| putative arsenate reductase [Prochlorococcus marinus str. MIT 9303]
    MLNSIRIYSYSRCATCRKALAWLQQHQIAHDLFDIVETPPSREMLRGASKQLASRKLLFNTSGVSYRALGADAVKAMSDD
    EALDALASDGKLIKRPFLITENGSVLVGFKPEIWAEALLR

    >gi|124022540|ref|YP_001016847.1| peroxiredoxin [Prochlorococcus marinus str. MIT 9303]
    MPSLQSVPDVTFKTRVRDESVPGPNPFRWQDLTSAEIFKGRKVVVLALPGAFTPTCSSNHLPRYEELHTELVAQGVDQII
    CLSVNDAFVMFQWRKHLGTKNIFMLPDGNGEFTRKMGMLVEKSNLGFGLRSWRYSMLVNDCNIEKMFVEPGFSDNADVDP
    FEVSDADTMLAYMKGVQPAGVSSPRRKFEG

    >gi|124022562|ref|YP_001016869.1| putative methyltransferase [Prochlorococcus marinus str. MIT 9303]
    MSSSCCSPSASGPGADALDQTQAVEERYGAAAHAQEACLCTPVAFDLSLLQAIPRDVVERDYGCGDPTRWVKPGDTVLDL
    GSGSGKNAFICAQLIGSAGAVIGVDRNVEMLNLARQAAPVVAERIGFANVRFVEGAIEALEAPQVDGAPLIADRSIDVVL
    SNCVLNLVNPADRQNLLANIRRVLRPGGRLAVSDIVCDKPVPLALQQDPELWSG
    CISGAWQEEAFLEDFRALGFEKVSYA
    DRSDQPWQVVEDIEFRAVTLVGQLPDD

    >gi|124022621|ref|YP_001016928.1| thioredoxin [Prochlorococcus marinus str. MIT 9303]
    MSNAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFESKIKVFKLNTDENPNVASQYGIRSIPTLMV
    FKGGQKVDTVVGAVPKATLSGTISKYL

    >gi|124022661|ref|YP_001016968.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9303]
    MDPTTKTRIEALIQSSPIMVFMKGTKLMPQCGFSNNCVQILNSLGMSFETFDVLSDMEIRQGIKDYSNWPTIPQVYVKGE
    FIGGSDILIEMYNAGELAEKLEIALSS

    >gi|124022732|ref|YP_001017039.1| redox protein, regulator of disulfide bond formation [Prochlorococcus marinus str. MIT 9303]
    MTMTTISCCYKGNLRCEALHTPSGDRLTTDAPIDHEGKGEAFSPTDLVATALGTCVLTVMGITARRKGWRIEGAAVEVEK
    IMTSEGPRSIKALKLRITMPPELSDEQVKLLQRVVDTCPVKRSLAEGIAMEFSWS

    >gi|124022787|ref|YP_001017094.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. MIT 9303]
    MLSISQCLGRPSQALAMEGKLPALDAQAPDFELEAAAQEGALAEKLQRDAFLGSWLVLYFYPRDFTSGCTLEARGFQRDL
    SDFKAAGAAVVGVSADGTEEHVSFCSSEGLGYTLLSDPGGVVSERYGSWSSPFSQRHTFLIDPKGILRMRWLAVSPSRHS
    QDVLRELKELQQS

    >gi|124023039|ref|YP_001017346.1| Fe-S oxidoreductase [Prochlorococcus marinus str. MIT 9303]
    MISVLPSHDTSATAFRSEVFPELHRDNLRTLQVNLGYRCNQSCAHCHVNAGPTRLEMMDPQTMALIPKVLDQYQLECLDL
    TGGAPELHPGFKDLVIQASCLGVEVIDRCNLTILTEPGQHDLAAFLAKHRVTVVASLPCYEAENVDQQRGKGVFERSLIG
    LRQLNQLGYGQNDEQLILNLIFNPQGPQLPLPQAQLEEAYRKELKKRYGIEFTRLFTIANMPIQRFATQLTMSGQRESYQ
    QLLEGAHNPDNLKTVMCRSLISVNWQGQLFDCDFNQQLSLHPKGPVHHLRDLLDVEVQWPGQPITVGPHCFGCTAGNGSS
    CGGALQSEGEIG

    >gi|124023166|ref|YP_001017473.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9303]
    MTTNECLRVGQQAPDFSATAVVDQEFKEISLSQYRGKYVVLFFYPLDFTFVCPTEITAFSDRYTDFSSRNTEVLGVSVDS
    QFSHLAWIQTSRKEGGLGDINYPLIADLKKEISTAYNVLDDAAGVALRGLFIIDPDGVIMHSTINNLPVGRNVDETLRVL
    QAFQYVQSHPDEVCPANWTPGEKTMKPDPVGSKEFFASIN

    >gi|124023310|ref|YP_001017617.1| rhodanese-like protein [Prochlorococcus marinus str. MIT 9303]
    MNQPTPTSISAKDLHRWLSDSSSLPICVDVREDQELELAPFPADVLHLPLSRSSDWMETLPKLLPNDRPVVVICHAGIRS
    WNFGSWLLEQDNDYQVWNLEGGIDAWSINVDSSVPRY

    >gi|124023455|ref|YP_001017762.1| glutaredoxin [Prochlorococcus marinus str. MIT 9303]
    MRSLPLKLAPGSDLLISLQKIAQEQNSSGFVLGVVGNLSRAAFQCPGQSGPTVLEGNLEIITLNGTVSPNSVHLHLSLSD
    SACQVWGGHLEPGTLVLKGADLLVGLLDQSLPKDSPDSSQTPRVEIAVLPG
    CPWSTRALRMLRSLSIPHTVKSIDNDASF
    KEFNHLSELNSFPQIFIDGELIGGYDELSKMHASGQLETLR

    >gi|124023477|ref|YP_001017784.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9303]
    MFPSWLTPKASKEAPIPSETEQHAVLGTGLHDPLTTDHEDALFACGCFWGAEKGFWKLPGIITTAVGYAGGHQEQPTYQE
    VCSGRTGHTEIVRVVWNKSVIDFSDLLKLFWECHDPTQGNRQGNDRGSQYRSAIYTTTIQQMELAQASRDSFQQLLSKGG
    FGAITTEIKADQQFHYAESYHQQYLAKPGSRPYCSAMPTQVALNDFPGANFKLPVSVWQEYDWSVSHCVLRSGNEIIKL

    >gi|124023507|ref|YP_001017814.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9303]
    MPPAASTKALDWQALAELTVPEADRINGPTNAQATLRLFGQSEKALRVTLYRDHHAWCPYCQKVWLWLEWKQIPYRIRKV
    TMRCYGEKEAWFKKKVPSGMLPALELDGRLIMESDQILLALEHAFGPLGHQLEEPRTLKLRDLERQLFGAWCRWLCTARL
    NQRQEQACREQFQIKARMMEHQLSAEQGPWLDPASNTPTSPCPGSADVVFIPYVERMNASLAYYKGFSLREEHPSIHKWF
    KALEELEVYRGTQGDFHTHAHDLPPQMGGCWVAPNPKQQELAEAIDCGEGLAELETCWADPDNSKTRPEGLALSRVLKHH
    QRLLELNPLGAIRFDQPLRATLTRMALGASCLPDPGSARGLRYLRDRISVPRDMPLLSARRLRQALEQTAQLDSPEMGAP
    IPIYDRFDQNPKPFLTS

    >gi|124023509|ref|YP_001017816.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. MIT 9303]
    MEHPFDLIVLGAGSGGLAAAKRAASHGAKVAIVEGDRVGGTCVIRGCVPKKLLVYGSLYREQLEVAPSFGVELSDARINA
    GVLLANVRQEVDRLNALHIDLLAKNGVELVTGWGSFTSPNSVAVSRNGAIDASQELHGDHILIAVGGRPHRPDIPGAELG
    WVSDDMFMQSSFPDRVVVVGAGFIACEFACILHGLGVEVIQLVRGDHLLRGFDRELSTAVQDGMQGKGIDLRFGENPAAL
    KGQPGDLVLSTQSGERFSCGGVLLATGRRPFLQGLNLDAAGVVLEGRRISVDANQSTNIPHIFAVGDVTDRINLTPVAID
    EGRAFADSVFGQKPRQVNHDLVASAVFSQPELATVGLTEEQSIDRYGKDQVKVYRARFRSMAQALPKRGPRCLLKLIVDR
    NTDRILGCHMVGEHAAEIIQMASIALAMGATKADFDRTMALHPTVSEEFVTMT

    >gi|124023601|ref|YP_001017908.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. MIT 9303]
    MALQVGDKAPAIDLVDQNGKKRRSNDLKGKVLVLFFYPKDDTPGCTAEACSFRDNYSVFEKLGSEVWGVSGDDDISHRQF
    AERHSLPYALLSDKDNTLRRAFEVPRTLGMLPSRVTYVIDGQGTIRHIFNNLLDGPAHMREACRVVEEIKKKR

    >gi|124023678|ref|YP_001017985.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9303]
    MSEASFDFDVIVIGAGYGGFDAAKHAADDGLKVAIVESGDMGGTCVNRGCVPSKALLAASGKVRELADAEHLSGFGIHAA
    PVRFERQKIADHANKLVATIRSNLTKTLQRAGVTILRGHGRLEGSQRIGVREKSGVDRLLTARDVILATGSDPFVPPGIE
    TDGRTVFTSDEAVNLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALDRVMPTFDPDITKMAARHLIEGRDIDARA
    GVLASKVIPGCPVRIELAEMKSRELVDSLEVDAVLVATGRVPSSKGLNLESVGVETNRGFVPIDDSMRVLVNGNPLPHLW
    AVGDVTGKLMLAHTAAAQGTLAVDNIQGHSRTIDYRSIPAATFTHPEISSVGLSEADAKELAAKDGFELGSVRSYFKANS
    KALAELESDGLMKLLFRKDSGEVLGAHIYGLHAADLIQEVANAVARRQSVAQLANEVHTHPTLSEVVEVAYKQAAKQLAK
    AVVASASAS

    >gi|124023982|ref|YP_001018289.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. MIT 9303]
    MRLRIWDSGKGIASGTLSPMGLHETVDVGLSPDELERFSRHLTLPEVGMNGQKRLKAASVLCVGSGGLGSPLLLYLAAAG
    VGHIGIVDFDVVELSNLQRQVIHGTSWVGQPKTHSARARILEINPHCQVDLYEKALTRDNAFEIIHPYDIVCDCTDNFPS
    RYLVNDACVLLGKPSIYGSIHRFEGQATVFNLDAESPNYRDLVPEPPPAGLVPS
    CVEGGVMGILPGLIGLIQSAEVIKII
    TGIGTTLSGRLLVVDALAMTFREMALRPSQPRVVIDQLIDYQDFCASGADQPAQEKAAGLESISVQDLKSLLDLGAEDFA
    LVDVRNPNEAEIACIAGSELIPLNKIESGEAIEKVRQLASGRRLYVY
    CKLGGRSAKALTTLKRHGIEGVNVTGGIDAWAK
    EVDNSLPRY

    >gi|124024137|ref|YP_001018444.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9303]
    MTGSSPSSTLGQGQRLILLFTALGLAVVLFLLRGGLNAEAPLEQLARRSLDPDVALTNGRPTVIEFYADWCQACREMAPA
    MLTTERERETQLDVVLVNVDNPRWQDLVDRYDVNGIPQLNFFDNKGKLQGLSLGARTQEQLQQLTDALIQNQPLPKFAGV
    GAISNLNASQERTEKQNDLEAIGPMSHG

    >gi|124024236|ref|YP_001018543.1| selenide,water dikinase [Prochlorococcus marinus str. MIT 9303]
    MTADHLVLAGGGHSHALMLRRWAMRPQLRPAGLITLINRHSTTLYSGMVPGLIAGHYRHSEIAIDLRRLTDRAGVALIIA
    EITAVEAHHNRLLLAQRPPIHFQRISFDVGAETFNKGPYLERSQAALAMPIKPLEPALAWLEQQDSQVLLNDSTPLTVIG
    AGLAGVEVALALRHRWPKRPLNLQAHHGQPRPALKQALSKAAIVIVPSGTPLSGPALLCTGSQAPAWLATSGFPVDPLGR
    VRTTKTLQVINHPHCFAVGDCAVIDKAQRPAAGVWAVQAAKPLAQNLERLSRRQPTRPWQPQQLALQILGGQLSSGRFTA
    WAFWGNLIIGPHPWLWYWKEAIDRRFMGSFNELPSMSGVLKRQESMACRG
    CAAKLAEKPLNDALKQAGLGALGQQPEDAA
    LIASTSSGDSLLQSVDGFPALISDPWLNGRLTTLHACSDLWASGAHVISAQAVITLPKVSSELQQELLVQTLKGIQSTLE
    PQGAKLIGGHTLEARSIPPQPINLGIQLTLSVNGKVASGRVPWSKGKLQSGDVLLLSRPIGSGVIFAAAMAGEAHPEDLD
    AALAQMTISQHNLLTALRSLEERHTGMQTIHACTDITGFGLLGHLGEMLSASNHQRHRAGLQPLRLLLEAAAIPSLQGAL
    LLLKAGYSSTLAPANRRNWHLLNPSINGEAAPIEIALNDVTPGSEHHQALLELMVDPQTCGPLLLACSTKIASELLRDGP
    WQRIGQVQPM

    >gi|124024310|ref|YP_001018617.1| hypothetical protein P9303_26221 [Prochlorococcus marinus str. MIT 9303]
    MTSTTNPATHHTATDGKGIQITNTAMQQLARLCLEKGNDQVLRVGVRSGGCSGMSYTMDFVPSADIQEGDEVYEYTATDG
    ASFRVICDPKSLLYIYGMQLDFSTEMIGGGFNFTNPNASQTCGCGSSFAV

    >gi|124024338|ref|YP_001018645.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9303]
    MSRNDRPLAHPSVALDIEGMKCGGCVQSVERILLEQPSVARASVNLVARTAWLDLNDPGQSLDPILAALAARGFSAQPRN
    TGSVEQLTSSTRDSLGAWWSQWRQLMVALVLLLLSVLGHLAAGGHLELVIVGALPFHAGLATVALLGPGRPILVGGARAA
    LALTPTMDTLVGLGVSSAYLASLVALLWPQVGWPCFFNEPVMLLGFVLLGRFLEERARFRTGRALQQLAQLQPDTARLLA
    GDGTIREVRVGALRPGERVQLLAGDRIPVDGMVLEGHSAVDVSSITGEPLPLEAAPGIELTSGSLNLEATLLLEVRHVGA
    ETALARIISLVEQAQARKAPIQGLADRVAGRFCYGVVSLALLTFLFWWQLGARLWPQVLHASGQGLVHGYGHHVPLGGVA
    ETSLGLALQLAIAVLVVACPCALGLATPTVITVASGQAARRGWLFRGGDVIEMAASLRQVVFDKTGTLTLGRPLVAGVVG
    TKKPDQLLQLAASLEQNSRHPLAHAVLQEAQRHRLALLPTLATRTYPGSGLAGELEGVEATVRVGTPEWLQAEGVHWTAE
    LQADVEQSSLQGQSVVAVALGEEPLGLVTIDDRLRPDVSVALDRLREQGMTLAMLSGDRRQAVERLGEQLGFQSHQLGWQ
    LLPDQKLERLQRLRKAGLLAMVGDGINDAPALAAADLGIAVGTGTQIAQDSADLVLLGDRLEGLPEALLLARRTMAKVRQ
    NLTWAFGYNLIALPIAAGLLLPGFGLLLSPPIAALLMALSSITVVVNALALRTT

    >gi|124024425|ref|YP_001018732.1| glutaredoxin [Prochlorococcus marinus str. MIT 9303]
    MAKVEIYTWQSCPFCLRAKALLDRKGVSYQEHAIDGDQDARAAMANRAGGSNTLPQIFIDDLSIGGCDELHALEGAQKLD
    GLLQGKG

    >gi|124024482|ref|YP_001018789.1| glutathione S-transferase N terminus protein [Prochlorococcus marinus str. MIT 9303]
    MSNPLLYSFRRCPYAMRARWALLVSGLLVNLREVALNNKPPELLQASQKGTVPVLLTADGTVIDESMDIMHWALQQADPF
    DGLRSGKAEEQQTIQQLIEQNDGPFKYHLDRFKYACRFKGEDAEEHRNMARDILVEWNARLAQQESSDCYGCLIGESQSL
    ADWALWPFVRQYRLADPSSFDCDQDLQAIKRWLKAFLQHPLYARLMTPVKPWLPEHQPQTFPADSSLVKTDQPLFHLALL
    EDWQDACNQGVYQFSTRGLKLKEIGFIHLSYQHQLESTYHQFYRDRGQVLSLKLNPEQLTMPLRAEPSSAGELFPHLFGV
    LPLSAVELVETYP

    >gi|124024204|ref|YP_001018511.1| hypothetical protein P9303_25151 [Prochlorococcus marinus str. MIT 9303]
    MQSHPEPALMGCFPNMALTPSTMLPLGTPLPSFELKVVPGTNLEIDDGLGALNTINTSTLPTKPLLLMALCAHCPFVKHI
    EKELTHLDQDYGDSVQLLAIASNSLITHPQDGPEQLAAQAKQQGWRFPYLLDTDQSLAKALQAACTPDFFLFAPSPQGLQ
    RLCYRGQLDNSRPGNHAPVTGSDLRAALDAVLNGQDVSPNQQASIGCNIKWHPGQEPPWFG