Prochlorococcus marinus MIT 9301 uid58437

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126695352|ref|YP_001090238.1| peptide methionine sulfoxide reductase domain-containing protein [Prochlorococcus marinus str. MIT 9301]
    MNQFLSRRTFILIPTMSFLKIIFKPMQVLASSLASKEEWNFSKDEWKARLSPETYYILREEGTERAFSSQLNNEKRKGNF
    HCAGCDLPLFSSDKKYDSGTGWPSFWDSIEGSVETKVDFKLIVPRTEYHCSRCGGHQGHVFNDGPPPTGKRY
    CNNGLALK
    FVPD

    >gi|126695429|ref|YP_001090315.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9301]
    MALQVGDKAPEFKLKDSFEKEVSLSDFKGKKIILYFYPKDNTPGCTKEACNFKENWDLLQKNNIVVLGISKDNASSHQKF
    IEKFNLPFILLTDPEPFKVSSDYDSYGLKKFMGKEYMGMMRNTFLIDTDGNIEKIYLKVKAAIMADHIIADLGLS

    >gi|126695454|ref|YP_001090340.1| hypothetical protein P9301_01161 [Prochlorococcus marinus str. MIT 9301]
    MSLKTLNRRNKKDLKWPKIIIAILSTIGIVDTGSITLKNWGLFTSLSCPGIQNGCETVLNSPWGTLFENNQVNIPLSLAG
    FITYLSILFITIILSLNVISPKEKLNKFFWWLVFLISCASSTFSFLLINIMFFKIQAYCFFCILSAILSFSIFIISMIGA
    KFESREPMIFRGFIVAISVLLGGLIWSTSVDPSNAIDVANPTENVSPIITTSSSPQKVKFAKFLSENNIVMYSAYW
    CPHC
    YDQKQLFGKEAVKELKVVECAKDGKDNEYELCQTKGISGFPSWEINGEIISGTRSLNELATKTDYQGDLNF

    >gi|126695471|ref|YP_001090357.1| hypothetical protein P9301_01331 [Prochlorococcus marinus str. MIT 9301]
    MENVEIKQEIKNSDDGKGILITNDAIEQISNLLKGQSDKKALRVGVRSGGCSGMSYTMDFIGTDEINHDDNVYDYSLKAD
    QSFQVVCDPKSLLYIYGMQLDFSKELIGGGFNFVNPNASQTCGCGSSFAV

    >gi|126695488|ref|YP_001090374.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9301]
    MESIQLRITGMKCGGCVSTVEKILNNSDGIENVSVNLLTESAYFEITQKHIEIEAVLKNLKENGFPSKIYINDFSKKINK
    EELEKKKKWNNQWKKLTFALLLLLFSGLGHLAEGRYINFPILGNIFFHASLATLALLFPGREIIINGFKSFIKNRPDMDS
    LVALGVTSAYITSLLSLIFPATGFPCFFNEPVMLLGFILIGRFLEERARYQTGSSIGELLDLQPEMANIYTEDNQIKSIR
    VNTLRPNQEIQVLAGDRVPADCIVTQGNSYVDVSHITGESKPIEVKEGENLSSGSLNLNSTLRLKVQKVGGDSSLAKLVN
    LIESVNARKPRIQRIADEIAGKFTYFVLIFATLTFFFWWQGARNIWPDLLSHNHQFITHSSHTLHSSLGSNAENFLSLAI
    QLSIAVLVIACPCALGLATPTVITVASGKAAKKGVLFKGGDKIEMASKINHIIFDKTGTLTKGKPFIVDYKNNDDYSFLL
    KVAASLEKESRHPIADALIQEAKKQNLSLFPIKKIVTHSGRGISGELESIDGLINIGNIEWLLSKGIIIDSDAKKVIENE
    ETKTNTIIGVSIKDKLLGFIFLGDLLRDDSIKTVQNLRKNKFKINILSGDRKQTVLALAKKIGFKEAEVKWDLLPEMKLK
    TIENLKIDNKVAMIGDGINDVPALASSDLGIAVGSGTQIAKANADVVLMGDQLNGLPYALNLAKKTIRKIKQNLTWAFGY
    NLLAIPIAAGILFPKYGILLTPSIAALLMAISSITVVINALSLD

    >gi|126695537|ref|YP_001090423.1| glutaredoxin [Prochlorococcus marinus str. MIT 9301]
    MSKVEIYTWQYCPFCIRAKSLLKKKNIIFTEYKIDGDEDARALMTERADGRRTLPQIFIDNEGIGGCDDLYTLENENKLD
    ALLN

    >gi|126695569|ref|YP_001090455.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9301]
    MEIIESDVVIIGGGPAGCTCALYTSRSNLKTVVLDKNPSVGALAITHQIANYPGVPVDISGEKLLTLMREQAVQYGTDYR
    RAQVFGIDTSGEWKMVYTPEGTFKARALVLASGAMGRPASFKGEADFLGKGVSY
    CATCDGAFYKNREVAVVGVNKEAIEE
    ATVLTKFASTVHWITSSDPKSDNEEAMELMASSNIKHWSRTRLLEILGDDMGVNGVVVKNKQEENPINLNLDGVFVYMSG
    SKPITDFLGDQIALKEDGGVIVDDFMSTNSDGVWAIGDIRNTPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS

    >gi|126695580|ref|YP_001090466.1| glutathione S-transferase C terminus [Prochlorococcus marinus str. MIT 9301]
    MQNKYLIMASKKFWFWFWTQLMNGFAPSDLHGNYKRPKGITIDSEYDINTQNGQIYLLVGHSCPWCQRTLLIQEIKDLSK
    KVKVIFLKADVEHGEWILNKKIKGCIRLSDLYKKANKKTIFRATLPLLISFVKDEVNILSNESSQITRLLNSIKSESKYQ
    ALSIKDCNQKFLDLINNSINDGVYKCGFARNQSAYYKASKNLFAAINEIENLLQKNKGDWIFGEELTYADIYLFPTLIRW
    ELIYSKLFKCTQQELSSFEKIIEWRLKFFKLSNVKRTCFDNEWKKDYYKALFPLNPNQLIPVLPSLEEIMRLEPKNI

    >gi|126695603|ref|YP_001090489.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9301]
    MLLFKNLFFKSTYLLKSFGELSVDPEIAFTNNKPTFLEFYADWCEVCKEMAPQVSSLKDEYEKDINFVFLNVDNQKWGNY
    IKKFSVNGIPQVNLFDKKGNLISTFIGKQDEIKIRESINNLEKEENPYEEIVNAEFSIIQENKKNEVNPRSHG

    >gi|126695664|ref|YP_001090550.1| selenide,water dikinase [Prochlorococcus marinus str. MIT 9301]
    MAFNHLVLIGGGHSNVSLLKKWLMFPKLMPEIPVSIISRDSHLVYSAMFPSVISKSITLEESLINIKSLAKNAKVSFIEE
    EVKNVDFNLKKIVLSNRPSVNYSKLVLNYGSQTIIPKEFESLVKNRNAFSIKPFLRAYDSILKEDIFDSVNELPFVIVGS
    GLAAIEVSFALRKRWGDRPLKLLCDSRKINNTILKSLRNSNIDLIEKLNFDYGKILLCTGNTSPLWSQKKLLDSDSYGRI
    ITNQNLQIKSFSGIFAVGDCAVVGSAKRPASGVFAVKVVNTLVQNLKKDIEGRSLKKWFPQKIGLQIVNIFPSHHPKAFA
    IYRNFVFGPSFIFWILKHKIDLNFIKKFRSKRLIMKSSEKSISLNDCRG
    CAAKIPQVVLNKSLINSNLNSFASSPEDSVE
    IYQNGQDIILQSVDGFPALVSDPWLNAKITTLHACSDLWACGAKLSSAQALISLPKVEREFQSYLFSQSLQGIKSTVEDQ
    GGELLGGHTFEARSLVNKPYSLGIDISLTVQGILKNGAKPWLKSGMNNGDILMMSRPLGVGIYFAGQMQNINMLDTSSKV
    INNLVKSQQYLIDEIYLFQNQFKESLVNAATDITGYGFIGHLKEMVESSNLYRQSNNLEPLKVLLDLFAFKAYPGVFDLI
    RKDVKSTFFESNKEIFDKIYKVNKQKRIINFLNENSLDQETFNERISLLLDPQTCGPLLISCNRKYENVLKDKWYKVGEV
    VKM

    >gi|126695718|ref|YP_001090604.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. MIT 9301]
    MQIGDKIPEFSLLDQNGVKRSNRGLKNPLVLFFYPKDDTPGCTIEVCGFRDKYDLFKVLGAQVWGVSNGSTSSHLAFANK
    NKLQYPLLCDTNDSLRKTFKVPKVLGFMDGRVTYVIDRKGTVRHIFRDLLNGPEHIKEAIRVLKEIQNQ

    >gi|126695773|ref|YP_001090659.1| putative methyltransferase [Prochlorococcus marinus str. MIT 9301]
    MSESCCNTNTSNKASNQFDHKDAIQERYGSAAQEKESCLCTPVGFNPVLLEAIPQEVIERDYGCGDPTKYVQKNDIVLDL
    GSGSGKNAFICAQIVGKEGKVIGVDQNPDMLSLSRSASKEVTKNIGFNNTEFLEGSIEKLDELDKNLNPLIADKSVDIIL
    SNCVLNLVSPESRNNLLNNIKRVLNDNGRIAISDIVSNKKVPLRLQNDHDLWTG
    CISGAWYEPEFISDFKELGFKNLKFV
    ERSAEPWKVIEDIEFRTVTLVGNI

    >gi|126695877|ref|YP_001090763.1| putative arsenate reductase [Prochlorococcus marinus str. MIT 9301]
    MKKIIFYSYLKCSTCRKAAKWLESKDFEFQLIDIVKEPPLVNYLNLALEQYSDDKKRIFNTRGKAFKTLNLDIDRLSKEI
    IQLLLSDGKLIKRPFLIYEGKKVILGFNEIEYAKDFI

    >gi|126695930|ref|YP_001090816.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9301]
    MNGILSWDDLNKFEVEDLDRVHGINNSYANLRLFGHSENDVLVTLYRDRHSWCPYCQKIWLWLEFKKIPYRVQKINMFCY
    GQKEGWFLEKVRSGKLPAIEFKGKVITESDNIIAFLENEFGALGSFITSSHLIKIRNLEREIFRSWCNWLCRESFNFIDN
    SFRKKRFKESISKLDEILSSSKSGFVDPSVSNTGNVEPGVGDIIFIPYMERMNASLIYYKGFNLRSNYRHVDNWLTLFEG
    TSAYRGTQGDFHTHSHDLPPQMGGCYKESNEQQITFSKLIDTGEGLGNYELNQNYDSKYYATIALKRVIKHKENLLKVNP
    YNKESFDESLRSALSHMITGEVLIPKKLSGISLRYLKNRVSVPRDMPIISARLLRQSLNKIESLSNINEIDNIPFRHRYD
    QDPRNFISS

    >gi|126695931|ref|YP_001090817.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. MIT 9301]
    MEFEFDLIVVGAGSGGLAAAKRAASYGAKVAIIEANQIGGTCVIRGCVPKKLMVYAAKSKKNMDSSEGYGLKNEGINFES
    NILLKNVREEVSRLSNLHRNSLKKLNITIFEGLGRFITQNELEIICSNTKKIKNKISSKKILISVGGKPKKLNIPGIDLA
    WTSDDIFELEKFPKSLLIVGGGYIACEFASIFRNLGTEVTQLIRGKHLLNGFDEDLSLCLEESPTFTDIKIISNAQLKSI
    DRVNGNLESTLESGDKLLTNNILIATGREPNLLPLNLDFLNLKMDGQYLDVDELNQTSNANIFAVGDIINKPNLTPVAIE
    QGRVFSDNFFNDQKRKVNYEYIPKAVFTIPEISTVGLSEKRAKEIYSEKNIKIFKCKFTPMSNTFKKNKSKCMLKIVVHK
    LTDKVLGCHMFGETSSEIIQMVSVSLNAGITKKDFDITMALHPTISEEFVTMYG

    >gi|126695995|ref|YP_001090881.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. MIT 9301]
    MKNDILYSFRRCPYAIRARWALLICEIKVEIREIDLKNKPPDFLNNSKTKTVPILIKKNSEVIEESLEIILWALSESKKE
    NIKLIYFPENKKEDIFEIINENDNEFKYHLDRFKYATRYKDSDEEFHFTNAMKFIKRWNELLAENKYFFGDSPTIADWSV
    WPFVRQFRIACESQKRINYFEPSIKNWLDLFEKNKEFKTLMYKYELWEPNYRKNYFPFN

    >gi|126696198|ref|YP_001091084.1| glutaredoxin [Prochlorococcus marinus str. MIT 9301]
    MQPHSLKLSPESDLINSIKEYSLSNNLYGYVSGVVGNLRTVCIQCPGNQVINKFEGNLEIVSLNGHFHKGDVHLHLSFAD
    EGCNVFGGHLEEGCIVKKGTDILLLSFEQKIINISNHDLITNESRVKAYILKD
    CPWSKRAIRLLNSLSIPHEVTLIDNDE
    SFQKIMAQSSHNTFPQIFLDNKFFGGYDALSEQAKLDNLISFK

    >gi|126696241|ref|YP_001091127.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9301]
    MFKFLKNIMNNEESNLTNDPYSLHRVLKTDIKKDPNEKEDEIIFGCGCFWGAEKCFWKLPGVITTSVGYAGGEKINPTYY
    EVCSGLTGHSEVVRVIWDKREIDVSDLLKMFWECHDPTQKNRQGNDMGTQYRSAIYYKNENNINTILASKEQYQTELSKK
    NLGLIETEIKMIDSYFYAEQYHQQYLASAGSRQYCSASPTKVKLGVFTGSDYKLEDHIWENFNWEVEKCVLRSDNNPIKN
    NI

    >gi|126696294|ref|YP_001091180.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. MIT 9301]
    MRSLVVSILIPFIILFNCYSALSFDFAPEVGDYAPNFKLEGFNKNIKTKKTWELSDFEGQWLVMYFYPKDFTAGCTLEAK
    GFSELKKDFSKYNAEIVGISADNEDSHESFCSERSINYTLLSDPDGIISDKYGSWIPPFSDRNTFLISPDGKISYRWISV
    LPLNHAKEVLNVLKKKI

    >gi|126696350|ref|YP_001091236.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9301]
    MSLRVGQEAPDFSATAVYDQEFKEITLSGLRGKWVVLFFYPLDFTFVCPTEITAFSDRYQDFSALNTEILGVSVDSKHCH
    LAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGIVMHTTVNKAPVGRNVDETLRILQGYQY
    VAANPDEVCPANWTPGEKTMLEDPKGSKEYFSAL

    >gi|126696433|ref|YP_001091319.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9301]
    MQVDVQNTTVLSADGSSIQLGEYSGEVILVVNVASYCGNTAQYEDLQKLHDLYSTKGLRILAFPCNDFGKQEPDSLSEIK
    DFCTTKYGIKFEIYEKVHAKGNTTEPYTTLNKVEPEGDVEWNFEKFLIGKDSKVIARFKPTVKPFDENLIAAIEVALDS

    >gi|126696505|ref|YP_001091391.1| thioredoxin [Prochlorococcus marinus str. MIT 9301]
    MSSAPAVTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSSTLTKHL

    >gi|126696539|ref|YP_001091425.1| sulfurtransferase [Prochlorococcus marinus str. MIT 9301]
    MKGKNYKIVSLYSFFPFQENLILDLKNKLIEIENENDLSGLFIFANEGINGTICAEKNVIDIVINLINTYTDNKNLNIKV
    NFSKNKVFKKLKIKIKKEIVTMGIPEINPSENNGTYIDSADWNKLIKNKNTIVIDTRNHYEVSIGTFQNSINPNTKNFSE
    FPKWVDDHLDTHLENKDSTNIAMF
    CTGGIRCEKATTLLKKKGYKNVYHLQGGILQYLDDIPKEKNLFEGECYVFDKRVAL
    DQELEKGSYSICHACGMPVSIQDQERKEYRKGIQCHFCIDQFSEDDRKRFEERQKQIDRLKVENHKIHKE

    >gi|126696556|ref|YP_001091442.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9301]
    MDKLTKDKIQKLIDSNPVMVFMKGTKLMPQCGFSNNVVQILNSLGVEFGTFDVLSDFAIREGIKEYSDWPTIPQVYLKGE
    FLGGSDILIEMYNSGSLKEKIEIELAS

    >gi|126696641|ref|YP_001091527.1| hypothetical protein P9301_13031 [Prochlorococcus marinus str. MIT 9301]
    MSTKSNSLKEKLTENFSEFSQLSDYSFMNSLNADPQSTKDGNDHKPRSVYSGHYVPVVPTAIPEPEYISHSKKLFKELRL
    SSNLTKDQNFCRFFSGDISVANYPMSPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRMEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQELMDALGIPTSRSLTLYVSRSEIVRRPWYSKGSRYFEPDIMIDNQAAITTRVAPS
    FLRVGQIELFARRVRNNAHDEALNELKMIVKHLIHRNYKDEIDNEISIESKVIKLASLYRSRLISLIANWMRVGYCQGNF
    NSDNCAAGGYTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPFAAAINFKTFCSSLSPLLSGNKQDQGKLDQIEKDFSE
    LMNKELKKMWANKLGLEHYNETLINEFFNLMVISKADYTILFRKLSEIPDNSYSLKDSFYFPIDDELNNRWEVWLKNWQS
    ILKKEGNIKAKSALMKSLNPVYTWREWMVVPAYEEAEKGNYKKIKELQDIFSNPYIEQPSEIDQKYNRLKPSQYFNYGGV
    SHYS
    CSS

    >gi|126696678|ref|YP_001091564.1| putative thioredoxin reductase [Prochlorococcus marinus str. MIT 9301]
    MENKEKIPNVENVVIIGSGPAGYTAAIYAARANLQPLLVTGFNSGGIPGGQLMTTTFVENYPGFPDGVLGPELMDLMKAQ
    AERWGTNLYESDVVSINTDSHPFELKTLEGTIKSNSIIIATGASANRLGVINEDKFWSKGISA
    CAICDGATPQFRGEELA
    VIGGGDSACEEAAYLTKYGSKVHLIVRSEKLRASAAMVDRVKANPKIAIHWNTKVEKADGSEWLEKIETIHSQEGKGEIN
    IKGLFYAIGHTPNTKFLGSKIDLDNKGYIACKSGRPETSIEGIFAAGDVVDSEWRQGVTAAGTGCMAALATERWLAEKNL
    AKTIVRETPEPEKKLNSSDFNEEEVNEDTFDSNSEWQKGSYALRKLYHESKKPILVIFSSPS
    CGPCHVLKPQLKRVIKEL
    DGAVLGVEIDIDKDQDIAKQAGINGTPTVQLFKEKLLKKQWQGVKQRSEFKEAIKNII

    >gi|126696821|ref|YP_001091707.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9301]
    MTDSSFDFDLIVIGAGYGGFDAAKHAAGKGLKVAIVESSDMGGTCVNKGCVPSKALLAASGKVREIADYEHLAKFGIHAS
    PVRFERSKIADHANNLVLNVRENLTKTLKRSGVEIILGIGRIEGNQKVGVRDKNGIDKIFTCKNIVIATGSSPFVPRGIT
    LDNRTVFTSDDAVKLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALENIMPTFDPDITKIAKKNLIQARDIDTKS
    NVFATKIIPGCPVKIELTDAKSKEVVETLEVDAVLVATGRSPNSNNLNLESVGIETVKGFIPIDDQMRVKNGDEIIPNIW
    AVGDVTGKLMLAHTAAAQGTVAVDNICGGNVGINYKSIPAATFTHPEISSVGLSEAEAEEISAKENFTLGVVKSFFKANS
    KALAELESDGLLKLIFNKDNGKVLGAHIFGLHAADLIQEISNAISRNQDVIQLSKEVHTHPTLSEVVEVAYKQAASQIK

    >gi|126696857|ref|YP_001091743.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9301]
    MKYFLPLIIALSIFIHPVNAFAEELILAGGCFWCLEHDLESLKGINFVKSGYSGGDLQNPTYENHEGHQEVVLVDYDPQL
    VILPKILRLYFRNIDPLDSKGQFCDRGDSYRPVIFFKDATEESDAKNAIVAASNELRVPLEKLSVELKSKSQFWLAEEYH
    QDFAEKNELKYKFYRFSCGRDQRLDKLWGDNARSTNLWNE

    >gi|126696896|ref|YP_001091782.1| flavoprotein [Prochlorococcus marinus str. MIT 9301]
    MEPFDLAVVGGGAAGFMTAITAAENGVKRIIILEGTSKLMEKVRISGGGRCNVTNATWIPNELIENYPRGGIQLLESFNR
    FAAGDVYDWFDKKGLKLKIEEDLRVFPVSNSSADVIDCLRKSALSKNVEILTKFFVKEISKTPDNIFNIFSLKKAKVTAK
    NIVLSTGGNPSGYKLAQNLGHTIVKPVPSLFTFSTKEPNLDECRGVSIKGIDIEIKLNNKNFQNRGDLLITHWGFSGPAV
    LKLSSIAARELYIQKYKFNLIVKWSSLSYEELKEKINHLRLNKGKMNLINSRPVPLLTKRLWIFLLKKIGIDKEKKWSDL
    LADEREKMINTLMRDEYIISGKGPFGEEFVTSGGVKINEVNFKSMESLICPGLFFSGEVLDVDGITGGFNFQHCWTSGWI
    AGMAVSKLNKSIIN

    >gi|126697098|ref|YP_001091984.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. MIT 9301]
    MSNDIKFNFLSSDEEERYQKHLTLKEIGYEGQLNLKNSSVLCIGAGGLGSSVLLYLAATGIGRIGIVDNDQVEKSNLQRQ
    IIHETKTIGNLKIDSAKERIKKLNPNCEILTFPERINPKNALELINKFDVICDCSDNFSTRYLINDSCLILNKPLVFGSV
    QGFEGQVSVFNLYKNSPNLRDLLPESPSKNAAPS
    CAEYGVVGVSTGLIGILQVNEIIKIILKKGETLDGKILIFDLLKMN
    IKKLTLKSDQLNKRIKNLSQNEDFYNSDEYCEKNNEINTINANDFNNLYKAKRNKILLIDVRENEEFSTSAIEGSISIPL
    RHLDQNSDLKFIQKESLGKEVFTICKSGKRSEEASRILSKFKIQSRSIEGGIEKVRKILCN