Prochlorococcus marinus MIT 9215 uid58819

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157412353|ref|YP_001483219.1| peptide methionine sulfoxide reductase domain-containing protein [Prochlorococcus marinus str. MIT 9215]
    MNKFLSRRTFILIPTMSILKIIFKPMQVLASSIVSKEEWKFSKDEWKAKLSPESYYILREEGTERAFSSQLNNEKRKGIF
    HCLGCNLPLFSSDKKYDSGTGWPSFWDSIQGSVETKVDFKLIVPRTEYHCSRCGGHQGHVFNDGPLPTGKRY
    CNNGLALR
    FVPE

    >gi|157412431|ref|YP_001483297.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9215]
    MALKVGDKAPEFKLKDSFEKEVSLSDFKGKRIILYFYPKDNTPGCTKEACNFKENWDLLQKNNIVVLGISKDNASSHQKF
    IEKFNLPFILLTDPEPFQVSSDYDSYGLKKFMGKEYMGMMRNTFLIDTEGKIEKIYLKVKAAIMADHIIADLGLS

    >gi|157412456|ref|YP_001483322.1| hypothetical protein P9215_01171 [Prochlorococcus marinus str. MIT 9215]
    MALKTLNRRNKKDLKWPKIIIAILSTIGIVDTGSITLKNWGLFTSLSCPGMQNGCETVLNSPWGTLFENNQVNIPLSLAG
    FITYLSILVITIVLSLNLISPKEKLNKFLWWLVFLISCASSTFSFLLINIMFFKIQAYCFFCILSAILSFSIFIISIIGA
    KFESREPMIFKGFIVAISVLLGGLIWSTNVDPSNAIDVAKPTENVSPIITTSSSPQKVKFAKFLNENNIIMYSAYW
    CPHC
    HDQKQLFGNEAVKELKVVECAKDGKDNEYELCQTKGISGFPSWEINGEIISGTRDLNELAAKTDYQGDLNF

    >gi|157412473|ref|YP_001483339.1| hypothetical protein P9215_01341 [Prochlorococcus marinus str. MIT 9215]
    MENLEVKQEIKNSDDGKGILITNDAIEQISNLLKGQSDKKALRVGVRSGGCSGMSYTMDFIGTDEINPDDKIYDYSLKTD
    QSFQVVCDPKSLLYIYGMQLDFSKELIGGGFNFVNPNASQTCGCGSSFAV

    >gi|157412487|ref|YP_001483353.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9215]
    MESIQLSITGMKCGGCVSTVEKILNNSDGIQNVSVNLLTESAYFEITKKHIKIETVLENLKDNGFPSKIYINDFSKKINK
    AELEKKKKWNNQWKKLTFALFLLFFSVLGHLAEGRYINSPILGNIFFHASLATLALLFPGRGIILNGFKSFIQNRPDMDS
    LVALGVTSAYTTSLLSLIFPATGFPCFFNEPVMLLGFILIGRFLEERARYQTGSSIGELLDLQPEMANIFTEDNQIKSIR
    VNTLRPDQEIQVLAGDRVPADCIVTQGNSYVDVSHITGESKPIEVKEGEKLSSGSLNLNSTLRLRVQKVGGDSSLAKLVS
    LIESVNARKPRIQRIADEIAGKFTYFVLIFATLTFFFWWKGARNIWPDLLSHNNQFITHSSHTLHSSLGINAENFLSLAI
    QLSIAVLVIACPCALGLATPTVITVASGKAAKKGVLFKGGDKIEMASKINHIIFDKTGTLTKGKPFIVDYKNNNDHSFLL
    RIAASLEKESRHPIADAVVQEAKKQNLILFPIKKIFTHSGRGISGELDSIDGLINIGNIEWLISKGIIIDQNAKKIIENE
    ETKTNTIIGVSIKEKLLGFILLGDLLRDDSIKAVQNLRESNFTINILSGDRKQTVLALAKKIGCKETEVKWDLLPHMKLK
    IIESLKINNKVAMIGDGINDVPALASSDLGIAVGSGTQIAKANADVVLMGDQLNGLPYALNLAKKTIKKIKQNLTWAFGY
    NLLAIPIAAGILFPKYGILLTPSIAALLMATSSITVVINALSLE

    >gi|157412536|ref|YP_001483402.1| glutaredoxin [Prochlorococcus marinus str. MIT 9215]
    MSKVEIYTWQYCPFCIRAKSLLKKKNINFTEYKIDGDEDARALMTERADGRGTLPQIFIDNEGIGGCDDLYTLENENKLD
    SLLG

    >gi|157412569|ref|YP_001483435.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9215]
    MEIIESDVVIIGGGPAGCTCALYTSRSNLKTVILDKNPSVGALAITHQIANYPGVSVDMSGEKLLTLMREQAVQYGTDYR
    RAQVFGIDASGEWKMVYTPEGTFKAKALVLASGAMGRPASFKGEADFLGKGVSY
    CATCDGAFYKNREVAVVGVNKEAIEE
    ATVLTKFASTVHWITSSDPKSDNEEAMELMDNSNIKHWSRTRLLEILGDDMGVNGVVVKNKQEENPINLNLDGVFVYMSG
    SKPITDFLGDQIALKEDGGVIVDDFMSTNSDGVWAIGDIRNTPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS

    >gi|157412602|ref|YP_001483468.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9215]
    MQSESRESIFKTDSKTILILIISIVFISLLLFRNIFFKSTYLLKSFGELSVDPEIAFTNHKPTFLEFYAEWCEVCKEMAP
    KVSAFKDQYEKEINFVFLNVDNQKWGKYIQKFAVNGIPQINLFDNKGNLIFTFIGKQDEMKIREAINNLGRDEKPYEEII
    NSEFSSIQENKNNAVSPRTHG

    >gi|157412664|ref|YP_001483530.1| selenide,water dikinase [Prochlorococcus marinus str. MIT 9215]
    MSFNHLVLIGGGHTNVLLMKKWLMCPKLMPEIPVSIISRDSHLVYSAIFPSVISKSISIEESLIDIKSLAKNANVSFIEE
    EVKDIDFNLKKIALSNRPSIKYSKLMLNYGSQTTIPKEFESLVKNRDAFLIKPFLRAHELIQKEDIFDSVNELPFVIVGS
    GLAAIEVSYALRKRWRGRSLKLLCDSRKINHKILKSLRNSNIDLVENLNFDYGRVLLCTGNTSPLWAQKKILDSDSRGRI
    ITNQNLQLKSLSGVFAAGDCSVVGSAERPASGVFAVKVVNTLVQNLKKDIEGGLLKKWFPQRIGLQIVNIFPSHHQKAFA
    IYRNFVFGPSFLFWILKHKIDLNFINKFRLKRLIMQGSEKNISLNDCRG
    CAAKVPQFVLNKSLINSNLDSFASYPEDSVE
    IYQNGQDIILQSVDGFPALVSDPWLNAKITTLHACSDLWACGAKLSSAQALISLPKVEREFQSYLFSQSLQGIKSTVEDH
    GGELLGGHTFEARSLVNKPYSLGIDISLTVQGILKNGAKPWLKSGMNDGDILMMSRPLGVGIYFAGQMQNINMLGSSSEI
    INNLVKSQQYLIDEIYLFQNQFKESLVNAATDITGYGFIGHLKEMVDSSNLYRKKNNLEPLKVLLDLFAFKAYSGVFDLI
    RKDVKSTFFESNKEIFDKIYKGNKQKRIINFLNENSLDKETFNERISLLLDPQTCGPLLISCNRKYENNLKDKWYKVGEV
    VKM

    >gi|157412716|ref|YP_001483582.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. MIT 9215]
    MQIGDKIPEFSLLDQNGVKRSNKGLKNPLVLFFYPKDDTPGCTIEVCGFRDKYDLFKVLGAQVWGVSNGSTSSHLAFANK
    NKLQYPLLCDTNDSLRKTFKVPKVLGFMDGRVTYVIDRKGTVRHIFRDLLNGPEHIKEAIRVLKEIQNQ

    >gi|157412828|ref|YP_001483694.1| putative methyltransferase [Prochlorococcus marinus str. MIT 9215]
    MSESCCNTNTSNKASNQFDHKDAIQERYGSAALEKESCLCTPVGFNPVLLEAIPQEVIERDYGCGDPTKYVQKNDIVLDL
    GSGSGKNAFICAQIVGKEGKVIGVDQNPDMLCLSRSASKEVTKNIGFNNTEFLEGSIEKLDELDEDLNPLIADKSVDIIL
    SNCVLNLVSPESRNNLLRNIKRVLNDNGRIAISDIVSNKKVPLRLQNDHDLWTG
    CISGAWYEPDFISDFKELGFKNLEFA
    ERSAEPWKVIEDIEFRTVTLVGNI

    >gi|157412929|ref|YP_001483795.1| putative arsenate reductase [Prochlorococcus marinus str. MIT 9215]
    MKKIIFYSYLKCSTCRKAAKWLESNDLEFKLIDIVKEPPLVNYLNLALEQYSDDKKRIFNTRGKAFKTLNLDIYGLSREE
    IIHLLLNDGKLIKRPFLIYEAKKVILGFNEIEYIKQFI

    >gi|157412936|ref|YP_001483802.1| NAD binding site [Prochlorococcus marinus str. MIT 9215]
    MIGFDVVIIGGGLSGTSTALNLSKKGYSVLIIEKEKSQDYKPCAGGMASSMQRFLPLNIEDCIESKIKNVEFRWKAADNV
    TADLTGESPFWIVKREKLDQLLLNESLNNEAQIMRKLLVEKIIKKNDKWEITCNNKIKYITEFLVIADGSQSKWASYFNL
    GPRKPKFANTISLRLKGLGEIPSDAVRFEFGFIKYGFAWAFPLKGSVNIGLGTFINNGLLDNQAINKKVIRSFGFDDFPH
    ITISKKLRIWNGFHSINGDKVLAVGDAASLCDPFLAEGIRPSLISSFYAAEYIDQCLSGKVDDLNLYTKKINHIWGKSMA
    WGRRIAQVFYRFPRAGYQLGVKRKTAPKRIAQILSGEMSYEDIAKRVIRRLLTKRGT

    >gi|157412982|ref|YP_001483848.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9215]
    MNRILTWDDLNKFEVEDLDRVHGINNSYANLRLFGHSENDVLVTLYRDRHSWCPYCQKIWLWLEFKKIPYRVKKINMFCY
    GQKESWFVEKVRSGKLPAIEFKGQVITESDDIIAFLENAFGALGSFITSSHLIKIRELEREIFRSWCNWLCRESFNFIDN
    SFRKKRFKESISKLDEILSSSKSGFVDPSISNMGDIEPGVGDIIFIPYMERMNASLTYYKGFNLRSNYRHVDKWLTLFEG
    TSAYRGTQGDFHTHAHDLPPQMGGCYKESNEKQITFSKLIDTGEGLGNYEFNQNYDSKYYATIALKRVIKHKENLLKVNP
    YNKESFEESLRSALTHMIKGEVLIPKKLSGISLKYLKNRISVPRDMPIISARLLRQSLNKIESLCDINEIDKIPFRHRYD
    QDPRNFISS

    >gi|157412983|ref|YP_001483849.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. MIT 9215]
    MIKKILEFEFDLIVVGAGSGGLAAAKRAASYGAKVAIIEANQIGGTCVIKGCVPKKLMVYAAKSKKNMDYSEGYGLKNEG
    INFESNILLKNIREEVSRLSNLHRNSLKKLNIAIFEGLGRFITQNELEIICSNTKKIKNKISSKKILISVGGKPKKLNIP
    GVDLAWTSDDIFELEKFPKSILIVGGGYIACEFASIFRNLGTEVTQLIRGQHLLNGFDEDLSSCLEESPTFTEINIISNT
    KLKSIKKVNGNLESTLDSGDKLLTNNILIATGRKPNLLPLNLDFLNLKMDGQYLDVDELNQTSNANIFAVGDIINKPNLT
    PVAIEQGRVFSDNFFNDQKRKVNYEYIPKAVFTIPEISTVGLSEKRAKEIYSEKNIKIFKCKFTPMSNVFRENKSKCMLK
    IVVHKPTDKVLGCHMFGETSSEIIQMVSISLNAGITKKDFDITMALHPTISEEFVTMYG

    >gi|157413048|ref|YP_001483914.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. MIT 9215]
    MKNDILYSFRRCPYAIRARWALLICEIKVEIREIDLKNKPLDFLNNSKTKTVPILIKKNNEVIEESLEIILWALSESKKE
    NIKFIYFPDNKKDDIFEIINENDNKFKYHLDRFKYATRYKNIDEEFHFTHAIKFIKRWNELLAENKYFFGDSPTIADWSI
    WPFVRQFRIACESQKKTNYFESSIKNWLDSFEKNRKFKSLMYKYELWEPYSRKNYFPSN

    >gi|157413229|ref|YP_001484095.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9215]
    MQPHSLKLSPESDLINSIKGYSLSNNLYGYVSGVVGNLRKVCIQCPGNQEINKFEGNLEIVSLNGHFNKGDVHLHLSFAD
    EGCNVFGGHLEEGCIVKKGTDILLLSFEKKIINISNHDLITNESRVKAYILKD
    CPWSKRAIRLLNSLSIPHEVTLIDNDE
    SFQKIMAQSSHNTFPQIFLDNKFFGGYDELSEQAKLDNLISFK

    >gi|157413271|ref|YP_001484137.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9215]
    MFKFLKKIMNNEEINLTNDSYSLHRILKTDIKKDPNNNEDEIIFGCGCFWGAEKCFWKLPGVVTTSVGYAGGKKNNPTYY
    EVCSGLTGHSEVVRVIWDKRKIDVSDLLKMFWECHDPTQKNRQGNDIGTQYRSAIYYKNDNNFKTILASKEQYQKELKKK
    SLGLIETEIKMINAYYYAEKYHQQYLASAGSRQYCSASPTKVKLGVFSESNYKLKDHVWENFNWEVDKCVLRSDNNPIKN
    NI

    >gi|157413324|ref|YP_001484190.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. MIT 9215]
    MRNLVLGIIIPIILLFNYNSALSFDFAPEVGDQAPNFHLEGFNKNIKSKSIWELSDFQGKWLVMYFYPKDFTAGCTLEAK
    GFSELKKDFKKYNAEIVGISADNQDSHESFCSEKSINYTLLSDPEGVISDKYGSWIPPFSDRNTFLISPEGNISYRWISV
    LPINHAKEVLNVLKKKI

    >gi|157413379|ref|YP_001484245.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9215]
    MSLRVGQEAPDFSATAVYDQEFKEITLSGLRGKWVVLFFYPLDFTFVCPTEITAFSDRYNDFSALNTEILGVSVDSKHCH
    LAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPQGVVMHMTVNKAPVGRNVDETLRILQGYQY
    VAANPDEVCPANWTPGEKTMLEDPKGSKEYFSAL

    >gi|157413459|ref|YP_001484325.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9215]
    MQVDVQNTSVISADGSSIKLGEYSGEVILVVNVASYCGNTAQYEDLQKLHDLYSSKGLRILAFPCNDFGKQEPDSLSEIK
    DFCTTKFGVKFEIFEKVHAKGNTTEPYTTLNKAEPEGDVEWNFEKFLIGKDSKVIARFKPGIKPFDENLIAAIEVALDS

    >gi|157413531|ref|YP_001484397.1| thioredoxin [Prochlorococcus marinus str. MIT 9215]
    MSSAPAVTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSSTLSKHL

    >gi|157413565|ref|YP_001484431.1| sulfurtransferase [Prochlorococcus marinus str. MIT 9215]
    MKSKIYKIISLYSFFPFQEKLIIDLKNKLLEIENENDLSGLLIFAREGINGTICAEKNVIDIVINLINKYADYRNLNIKV
    NFSKKKVFKKLKIKIKKEIVTMGVPEINPSENNGTYIDSTDWNKLIKNQNTIVIDTRNHYEVSIGTFQNSINPNTRNFSE
    FPKWVDDHLDNHLEDKESTNIAMF
    CTGGIRCEKATSLLKKKGYKNIYHLQGGILQYLDEISKEENLFEGECYVFDKRVAL
    DQELEKGSYSICHACGMPVSIQDQKRKEYRKGIQCHFCIDQFSDDDRKRFEERQKQIDRLKVENHKIYKD

    >gi|157413582|ref|YP_001484448.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9215]
    MDNLTKDKIQKLIDSNPLMVFMKGTKLMPQCGFSNNVVQILNSLGVEFGTFDVLSDFAIREGIKEYSDWPTIPQVYLKGE
    FLGGSDILIEMYNAGSLKEKIEIELAS

    >gi|157413665|ref|YP_001484531.1| hypothetical protein P9215_13301 [Prochlorococcus marinus str. MIT 9215]
    MSTKSDLLKVKLTENFSEFSQLSDYSFMNSLKADPQSTKDGNDHKPRSVYSGHYVPVVPTAIPEPEYISHSNKLFKELRL
    SSDLTKDRKFCSFFSGDMSVANYPMSPFGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRMEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQELMDALGIPTSRSLTLYVSRSEIVRRPWYSKRSRYFEPDIMIDNKAAITTRVAPS
    FLRIGQIELFARRVRNNAHAEALNELKMIVQHLIYRNYKDEIENEISLESGVIKLAFLYRSRLISLVANWMRVGYCQGNF
    NSDNCAAGGYTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPTAAEINFKTFCSSLSPLLSESKQAQEKLHQIEKDFSE
    LMKKELKKMWASKLGLENYNGTLFNELFNLMVISKADYTILFRKLSEIPNSLDSIKDSFYLPINDELNNRWEVWIENWQS
    VLNKEGNIKAKSASMKSLNPVYTWREWMVVPAYEEAEKGNYKKIKELQDVFSNPYIEQPSEIDKKYNRLKPSQYFNYGGV
    SHYS
    CSS

    >gi|157413690|ref|YP_001484556.1| putative thioredoxin reductase [Prochlorococcus marinus str. MIT 9215]
    MENKETNSNVENVVIIGSGPAGYTAAIYAARANLQPLLVTGFNSGGIPGGQLMTTTFVENYPGFPDGVLGPELMDLMKAQ
    AERWGTNLYESDVVSINTDSHPFELKTLEGTIKTNSIIIATGASANRLGVINEDKYWSKGISA
    CAICDGATPQFREEELA
    VVGGGDSACEEAAYLTKYGSKVHLIVRSEKLRASAAMVDRVKANPKIEIHWNTKVDKAEGSEWLEKIETIHSKEGKGEIK
    IKGLFYAIGHTPNTKFLGKKIDLDNKGYIACKSGRPETSIEGIFAAGDVVDSEWRQGVTAAGTGCMAALATERWLAEKKL
    AKTIVRETPEPEKKLNSSDFNDEEVNEDTFDSNSEWQKGSYALRKLYHESKKPLLVIFSSPS
    CGPCHVLKPQLKRVIKEL
    DGAVLGVEIDIDKDQDIAKQAGINGTPTVQLFKEKLLKKQWQGVKQRSEFKEAIKNII

    >gi|157413859|ref|YP_001484725.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9215]
    MTDSIFDFDLIVIGAGYGGFDAAKHAAGKGLRVAIVESSDMGGTCVNKGCVPSKALLAASGKVREIADYEHLAKFGIHAS
    PVRFERSKIADHANNLVLNVRENLTKTLKRSGVEIILGIGRIEGNQKVGVRDKNGIDKIFTCKNIVIATGSSPFVPRGIT
    LDNRTVFTSDDAVKLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALENIMPTFDPDITKIAKKNLIQARDIDTKS
    NVFATKITPGCPVKIELTDAKSKEVLETLEVDAVLVATGRSPNSNNLNLESVGIETVKGFIPVDDQMRVKNGDEIIPNIW
    AVGDITGKLMLAHTAAAQGTIAVDNICGGNVEINYKSIPAATFTHPEISSVGLSEAEAKELSSAENFTLGVVKSFFKANS
    KALAELESDGLLKLIFNKDNGKVLGAHIFGLHAADLIQEISNAISRDQGVIELAKEVHTHPTLSEVVEVAYKQAASQIK

    >gi|157413895|ref|YP_001484761.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9215]
    MKYLLPLVIALSIFINPVNAFAEELILAGGCFWCLEHDLESLKGINFVQSGYSGGDLQNPTYENHEGHQEVVLVDYDSQL
    VTLPKILRLYFRNIDPLDAEGQFCDRGDSYRPVIFFKDKTEESDAKNAILSASNELRVPLEKISVELKSKGKFWLAEDYH
    QDFAERNELKYKFYRFSCGRDQRLDKLWGDNARSINLWTE

    >gi|157413934|ref|YP_001484800.1| flavoprotein [Prochlorococcus marinus str. MIT 9215]
    MEPFDLAVVGGGAAGFMTAITAAENGVKRIIILEGTSKLMEKVRISGGGRCNVTNATWIPNELVENYPRGGIQLLESFNR
    FAAGDVYDWFEKKGLKLKIEEDLRVFPVSNSSSDVIDCLRKSALSKNVEILTKFFVKEISKTPDNIFNIFSVKKAKVTSK
    NIILSTGGNPSGYKLAQTLGHNIVKPVPSLFTFSTKEPNLDECSGVSIKSIDIEIELNNKKFHNRGDLLITHWGFSGPAV
    LKLSSIAARELYSQKYKFNLIIKWSALSYEELNEKVKYLRLNKGKVNLINSRPVPLLTKRLWIFLLNKIGIDKEKKWADL
    LADERERMINILMKDKYIVSGKGPFGEEFVTSGGVKINEVNFKSMESLICPGLFFSGEVLDVDGITGGFNFQHCWTSGWI
    AGMAVSKLNH

    >gi|157414174|ref|YP_001485040.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. MIT 9215]
    MSKDNKFNFLNSDEEERYQKHLILKEIGYEGQLDLKKSSVLCIGAGGLGSAVLLYLAATGIGRIGIVDNDQVEKSNLQRQ
    IIHETNTIGNLKINSARERINKFNPNCEILTFSERINPQNSLEIIKEFDVICDCSDNFGTRYLINDSCLILNKPLVFGSV
    QGFEGQVSVFNLHKDSPNLRDLLPESPSKNAAPS
    CAEYGVVGVSTGLIGILQVNEIIKIILKKGEILDGKILIFDLFTMN
    MKKLHLKSDQLNKRIKDLSQFEGFYSSDELCEKNNKINSIDAHEFNKLYKAKPNKILLIDVRENEEFSTSAIEGSISMPL
    SHLNQESDLKFIQKESFSKEVFTICKSGKRSEKASRILSQFKIQSRSIEGGIEKVKKILCKKYIKNI