Prochlorococcus marinus MIT 9211 uid58309

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|159902556|ref|YP_001549900.1| methionine sulfoxide reductase domain-containing protein [Prochlorococcus marinus str. MIT 9211]
    MYNNFLSLNRRSILLGIWSGFLGLLFTPKTVFAASKAADEDWNLTDEDWKKRLSLEAYKVLREEGTERPFSSLLNEEKRL
    GVFHCAGCDLPLFESAKKFDSGTGWPSFWESLPNAIDTKTDFKLIVPRTEYHCHRCGGHQGHVFNDGPRPTGKRY
    CNNGI
    ALAFRPSK

    >gi|159902629|ref|YP_001549973.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. MIT 9211]
    MIAMPLQVGDTAPEFTLPDPNGTLVSLSSFRGQRVVIYFYPKDNTPGCTKEACNFRDLWKDFKSNNIKVIGISKDSGTSH
    LKFISKYQLPFTLLSDSEPCPVASSYESYGLKKFMGKEYLGMMRKTFVIDSEGKIELIYHKVKAEIMAKQILDDLSLT

    >gi|159902673|ref|YP_001550017.1| hypothetical protein P9211_01321 [Prochlorococcus marinus str. MIT 9211]
    MSTSQPVVETHTARDGKGIIITQTAMNQLARLCSEQGKDKVLRVGVRSGGCSGMSYTMDFISNQEIQEVDETYEYQSPGG
    KSFQVVCDPKSLLYIYGMQLDFSTDLIGGGFNFTNPNATQTCGCGSSFAV

    >gi|159902686|ref|YP_001550030.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. MIT 9211]
    MKPIKNQTKEESILLDVTGMKCGGCVQTVEKTLLNHKEVNNAFVNLVDRTALIDINDKSTDLKEILTSLEKRGFQAKVRQ
    NAKTNNSFDINASQEWWKQWRQLMVSLCLLLLSVLGHLAEAKTIAIPLLGNLIFHASLATFALFGPGLKILKSGWNAVAH
    FSPNMDSLVGIGVSSAYLTSLSALIWPQMGWPCFFNEPVMLLGFVLLGRFLEERARLRTGKALKELAKLQPQNARLINKN
    NQIKDVRVGALQPGERIQLLAGDRVPVDGVVIEGNSTVDVSNLTGESLPLETSPGTELSSGSLNLEGTLIVEVQRVGAET
    ALARIIGLVEKAQARKAPIQNLADKVAGKFCYGVVTLSFFTFIFWWRIGAIIWPQVLNTSGQGLMHMHGHMHNASLGTNA
    QTPLGLAVQLSIAVLVVACPCALGLATPTVITVASGKAAKRGWLFKGGDVIEKAALIKQIVFDKTGTLTVGRPEVIGYLG
    TEDPDELIQIAASLEENSRHPIAFAILQTAQSKGINLLTSSKVNTIPGKGISGYLDNIDGAIMVGTIEWLKSEGVNYNLD
    IEKLLEESNFNEKSIVAVSINKKLKGLIIIDDQIRNDVKDALTVLRKKGFFLRILSGDRRESVQRLGTKLGFKSTQIGWQ
    LLPEDKLNYLEELKRSGPVAMVGDGINDAPALAASNLGIAIGTGTQIAQDSADLVLMGDRLESLPDALSLSKATMQKIKQ
    NLVWAFGYNIIALPIAAGILLPSTGIVLSPPIAALLMACSSITVIINALSLKNT

    >gi|159902738|ref|YP_001550082.1| glutaredoxin [Prochlorococcus marinus str. MIT 9211]
    MAQVEIYTWQFCPFCIRAKNLLNKKGVDYKEYPIDGDPEGRLKMSERAGGRTTVPQIFINEKGIGGCDELYALEDSHQLD
    SLLN

    >gi|159902772|ref|YP_001550116.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. MIT 9211]
    METIETDVVIVGGGPAGCSCALYTSRADLKTVILDKNPSVGALAITHQIANYPGVPTDISGDDLLTLMRDQAIQYGTDYR
    RAQVFGVDVNGEWKTVFTPEGTFKAKALVLASGAMGRPASFKGEADFLGRGVSY
    CATCDGAFYKGREVAVVGTNKEAIEE
    ANVLTKFASTVHWITSSDPKDDDMHAQDLMNQPNVKHWSRTRLMQIEGDDGGVTGVLVKNRSQESNQSLTLEGVFVYMSG
    SKPITDFLGDQIALNENGGVVVDDFMSTTSEGVWAIGDIRNTPFKQAVVAASDGCIAAMAIDRYLNSRKSIRVDWVHS

    >gi|159902808|ref|YP_001550152.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. MIT 9211]
    MADNSSLIALSKLQKILLMLVAFVLSAALLIMKISVASVQPLEQLARSSLLPEIALANGKPTIFEFYADWCEVCQKMSPS
    IVDLEKRMGDKLDIVLLNVDNQRWSPLIDKYNVNGIPQFIFFNQDGDLKGISIGLLSSEKIIKASEYLIDNKELTDIEEF
    NNMSPDRFKFTDLIDTSKSRPVNPRSHS

    >gi|159902869|ref|YP_001550213.1| selenide,water dikinase [Prochlorococcus marinus str. MIT 9211]
    MLADHFLLAGGGHTHALILRRWAMHPHLRPKGLITLINRSSRNIYSSMFPGIISRQYKFDDAVIDLASLANRSGVSFVIG
    EIIGLDPERKKLFLENRPPIGFSLLSLDVGSETFADFKNFAHIEEKLVAEIKPFRSSYEWIEQFDDDPILDSQPLTVIGS
    GHSAFEIVLALRKRWPRRPLRLQAYESKINKKFRKGLLAADIDLRTNQEFVRGPVLLCTGNKPQSWIQKSGLQVNHQGRV
    LTEDTLQAINKPHIFAVGDCGVIANRQRPASGVWAVRAAKPLALNIERLAKGLKPFSWHPQKIVLQLIGGHFKSSMPSGW
    ALWGPFSIGPSSLIWKWKESIDRHFINIFDTSKDMKKVKAESNLLCRG
    CAAKVSEGTLKEALKEVDLQKLGDYPEDASMV
    SSSKGTGTLMQSVDGFPALISDPWLNARLTALHACSDIWASGASVISAQAVITLPVLNSYLQKELLVQSIAGIKSVLEPQ
    GAKLIGGHTFESRNEPIEQITLGIEISLSINGILKPGQLPLNKRGLKPKDELLISRGLGSGVIFAGTMHGATSSEVLETT
    LDTLSQSQHFLLEDIKKPINQNLDSFVINACTDITGYGLLGHLGEMLKSSNHFRELRGESGLRIKLYPDSIPILKGAKKL
    LRSGFSSTFAQSNRSFFSLLNSFKNAPPLIDLDLGDIQHESIEHQVIKELIVDPQTCGPLLVSCPQNVSQILLNKGPWVR
    IGLVDEI

    >gi|159902955|ref|YP_001550299.1| putative methyltransferase [Prochlorococcus marinus str. MIT 9211]
    MDKRYGAAAIDQEKCLCSPIAFNPKLLEVIPAENIEKDYGCGDPTRWIKKGDIVLDLGSGSGKNAFICAQVVGKSGHVIG
    IDRNNEMLALSRQAAPIVAARIGFSNMTFLEGDIQALDSMQGNGEQLVKDASIDVVISNCVLNLVNPSDRERLLRNIKRV
    LRRNGRVAISDIVSNKKVPLNLQEDPELWSG
    CISGAWQEDQFINDFKNLGFKEVICVDRSSMPWKVIEGIEFRSITLTGY
    L

    >gi|159903054|ref|YP_001550398.1| putative arsenate reductase [Prochlorococcus marinus str. MIT 9211]
    MRVKIYSYSACGTCKKALKWLDLNNIDYELIDITINPPSRKLIISALEQLGSRKFLLNTSGKSYRELGGETIRSKTDEEV
    IDLLALDGKLIKRPFLVDNKGRVLVGFKEPSWKDFFQN

    >gi|159903111|ref|YP_001550455.1| glutathione S-transferase [Prochlorococcus marinus str. MIT 9211]
    MKENINALTWEELSKFSTNESDLTNGPNTPYASKRLFGHNDEDIKVTLFRDYHAWCPYCQKIWLWLEWKKIPYLVKKASM
    RCYGQKEEWYLKKVPSGIFPAIEINQKVVTESDRILLLLESIFGPLGMQMEHPEIMGLRRLERRLFQSWCKWLCNPSFNN
    YQESKREKQFILLAKEVDVYLSKNNSPWLNPIKTGSEESLPGSVDVIFIPYLERMNASLAYYKGLNLRKEFPHINQWFRA
    LEKLDTYRGTQGDFHTHAHDLPPQMGGCWTNKNPKQEKFSKDIDLGHGLGDYETSFQNSQSISPEEIALGRVLKHRVPIM
    KANPIGPSLLDQPLRAALSTMITGQQYVPNKGTALGLRYLRDRISVPRDMPLLSARKLRQALEATAILDGPEQGPAIPIR
    NRFDQDPSPFLK

    >gi|159903112|ref|YP_001550456.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. MIT 9211]
    MNLLKDTFDLIVLGAGSGGLAAAKRAASHGARVAIVEGDRVGGTCVIRGCVPKKLLVYGSQYDEYLKDSHYFGIEISRSS
    IDSSVLLNNVRREVDRLNRLHVELLEKSGVEIISGWGSITSPTSISVISSDKSKKNKEIHARNILIAVGGRPVRPDIPGA
    ALGWVSDDMFLQKNWPEKVVIVGAGFIACEFSCIMNGLGVEVVQLVRGNTLLKGFDQELSLFLEENMRKEGIDLQFQKTL
    SALEGCQGDLKVLLQCNEAIDCGGVLFATGRKPFLDGLNLDKIGIVQEAERIKVDSGNATNIANIFAIGDVAGHVQLTPV
    AVEEGRVLADNLFSGTHRKVKYNLIPKAVFSKPEIASIGLSENEALDKFGGGNVQVYRSKFRPMSQSLQKSERRCLLKLV
    VDVKTDKILGCQMAGEHSAEIIQMASIAISMGATKLDFDQTMALHPTIAEEFVTMR

    >gi|159903155|ref|YP_001550499.1| hypothetical protein P9211_06141 [Prochlorococcus marinus str. MIT 9211]
    MPTNPSAFLSPATQTFAQFSKLANYSFINSLQADPQATTDGIDHHPRQVFSGHYVPVNPTAIPDPEYIAHSKSLFNELGL
    NHELAFDKQFRSLFSGDITVAQEPMRQVGWATGYALSIYGTEYVQQCPFGTGNGYGDGRAISVFEGLFKGRRWEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLGQEFMQALGVPTSRSLTLYVSKTEKVRRPWYSQDSSSIDPDIVVDNPVAITTRVAPS
    FLRVGQLELFARRARNDEHQGALSELKMIVKHLIDRNYQQEIDPNLCFAEQIVELAHLFKGRLISLVANWIRVGYCQGNF
    NSDNCAAGGFTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPVAAEANYHMFWAAIRPLLSTNTEALRRLDQVREGFSE
    AMNQEIEKMWLKKLGLASYDSTLVDELLELMVLSKVDYTIFFRKLSHIPEHLTPLKESFYSPSSEQIDAQWRGWLQRWRG
    GIKSCGDLTLTSTAMKLINPKYTWREWLVEPAYTRAERGDYSLIKELQTVFSNPYDDQCSIVASKYDRLKPTKFFNTGGV
    SHYS
    CSS

    >gi|159903229|ref|YP_001550573.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9211]
    MLKNLLNLIFFKKSEMASSDLTHYVLGSSLNEPIGNDEEEIFFGCGCFWGAEKGFWKLPGVKTTAVGYAGGEIANPTYRE
    VCSGRTGHSEVVKVVWKKSLIDLSDLLKLFWECHDPTQKNRQGNDQGSQYRSAIFTTNEKQTKMALSSRNSYQKLLTKEG
    YGVITTEIREEHLFYYAEEYHQQYLAKPGSRPYCSAMPTNINLSDFDGANYKLSKKIWLNYDWSVSHCILRSNVNPIPKD
    L

    >gi|159903279|ref|YP_001550623.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. MIT 9211]
    MDLGILYSFRRCPYAMRARWAIMRCNLKVELREVSLKDKPVELISTSKKGTVPVLITRDSKVIDESFGIILWAISMNCSD
    KLLRETLIANMEGIKLIVYENDNSFKYHLDRYKYPNRYPYSNQNIHKNKALEILYGWNEKIKHSSKSSRKGWLLNNNESI
    ADWCVWPFVRQYRNIDPHSFDQDPNLTYLSSWLNYYLKDKFYEILMEKSKKWEANQEPLYFPNIES

    >gi|159903398|ref|YP_001550742.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. MIT 9211]
    MLNLIRILSKNLATILVVFLIASPTYAINSNNINIGDKAPYFELDGYSKNNPDKDLWKLSDFKGVWTVLYFYPKDFTSGC
    TIEARSFEKLSPEFEKLNAMIVGISNDIQESHESFCSKESLSFTLLTDLQGIVSEKYSSWNKPYSKRNTFLIDPEGVIRY
    SWMNVNPLKHPTDVLKKLTELQV

    >gi|159903445|ref|YP_001550789.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9211]
    MMTNECIRVGQKAPDFTATAVIDQEFKEISLSNYRGKYVVLFFYPLDFTFVCPTEITAFSDRYSEFSSKNTEVLGVSVDS
    QFSHLAWIQTQRNDGGIGDINYPLVADLKKEISLAYNVLDDAEGVALRGLYIIDPDGVIMHATINNLPVGRNVDETLRVL
    QAFQYVQANPDEVCPANWTPGEKTMKPDPEGSKEYFSSL

    >gi|159903503|ref|YP_001550847.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9211]
    MFSRQIHLKAGDDLRASIEEYGRQKKESGFVTGIVGNLSAVAFQCPGIDVPTIKKGNLEIITLNGTFTPSNVHLHLSFSD
    SDCKVWGGHLELGTIVLKQADILLTSLDHGVNSSTIKGEKNTKETFRLEIAVIPD
    CPWSNRALRMIKSSNIAYRVTEVNS
    DDSFKLVQSRSGSSTFPQIFIDDEYIGGYEEFNQIIKSGKLF

    >gi|159903617|ref|YP_001550961.1| glutaredoxin-like protein [Prochlorococcus marinus str. MIT 9211]
    MDSDTRSKIESLINSNPIMVFMKGTKLMPQCGFSNNVVQILNALGISFETFDVLSDMDIREGIKEFSNWPTIPQVYLKGE
    FLGGSDILIEMYNSGELKEKLEIALAS

    >gi|159903670|ref|YP_001551014.1| Thiol-disulfide isomerase and thioredoxin [Prochlorococcus marinus str. MIT 9211]
    MLASPIVYMNAPIKVKRNRWQESFSSAKYNYLILSNKFFKGMSSAAAVTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVA
    PIVDEISKDFEGKIKVCKLNTDENPNVASQYGIRSIPTLMIFKGGQKVDTVVGAVPKATLSGTISKHI

    >gi|159903729|ref|YP_001551073.1| glutathione peroxidase [Prochlorococcus marinus str. MIT 9211]
    MKVSVTETSVQTSTGTIKKLGEYSGKVLLIVNVASYCGNTPQYSGLQELQNKFKDKGFAVLGFPCNDFGNQEPGTLDEIK
    EFCSVKFGADFEIFNKVHAKGFTTEPYTTLNKADPAGDVSWNFEKFLIGKDGSVVGRYEPSVQPLSEALISAIQLALDS

    >gi|159903765|ref|YP_001551109.1| putative thioredoxin reductase [Prochlorococcus marinus str. MIT 9211]
    MMGEKNTNDSTHIENVVIIGSGPAGYTAAIYAARANLQPLLVTGFAKGGIPGGQLMTTTFVENFPGFPDGVLGPELMDLM
    KAQALRWGTNLLEADAEEIELKKPPFIIKTTEETIRTNSLIIATGARANKLGIPSEVRFWSRGISA
    CAICDGATPQFRNE
    ELAVVGGGDSACEEAVYLTKYGSHVHLLVRSNQLRATASMSDRVISNPQISVHFETELLDAEGKDWLEKVLIKRKGSNQT
    RSISVKGLFYAIGHTPNIDLLKNQLEIDNKGYIITKDGRPETSINGVFAAGDVADKEWRQGITAAASGCKAALAAEKWLS
    KENLASLIKRKNSEPEPSPKNKSTQTTTEETFSEEAIWQKGSYPLRKLYHESNKPLLIVYTSKS
    CGPCHVLKPQLKRVLN
    ELKGQALGVEIDIELDTEIAKQAGVNGTPTVQLFKSKKLHNEWQGVKQRSVFKEEIINLLKKD

    >gi|159903886|ref|YP_001551230.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9211]
    MSEANFEFDLIVIGAGYGGFDAAKHAAEHGLSVAIIESREMGGTCVNRGCVPSKALLAASGKVRELADAEHLSSFGIHAA
    PVRFERRKIAEHANQLVKNIRNNLTKALERSGVKILRGYGRIEGTQKVGLRESNGVDRLISAKDIVIATGSDPFVPPGIE
    TDGRTVFTSDEAINLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALERVMPTFDTDIAKIAGRNLIQGRDIDARA
    GVLASKVSPGCPVKIELSDVKNRELLEELEVDAVLVATGRVPTSAGLNLESVGVKTNRGYIPIDDSMRVLVDGKPLKNLW
    AVGDVTGKLMLAHTAAAQGTVAVDNILGKNREIDYRSIPAATFTHPEISSVGMAESEAKEFAEKNNFELGIVRSYFKANS
    KALAELESDGLMKLLFRKDNGEVLGAHIYGLHAADLIQEVANAVARRQKVNELAIEVHTHPTLSEVIEVAYKQAVAQLKQ
    S

    >gi|159903928|ref|YP_001551272.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. MIT 9211]
    MKLPLFKKIIPLLAIAFSLLFSSPYAAVASLEKAVLAGGCFWCLEHDLEELPGILSVESGYTGGNLQNPTYKNHKGHQEA
    VIVEFDTKKIAFDKLLRSYWRNIDPFDSRGQFCDRGDSYRPVIFARDDSQLKESIESLSFASKELSASIDDIKVEIKNAN
    KFWQAEDYHQNFAENNNLKYQFYRYSCGRDKRLNEVWGSTSRKDLPWSINN

    >gi|159904047|ref|YP_001551391.1| redox protein, regulator of disulfide bond formation [Prochlorococcus marinus str. MIT 9211]
    MQSLRSVDRILCRYLGDLHSEAKHVNSGEKLRTDAPVDHAGKGESFAPTDLLATAVGTCFLTVMGITAKERGWELDEIKL
    EIDKKMTTHGPRKIKSLLLQIEMPNNLEPDQLKVLQKVTKDCPVLRNLNNSIRINVQWNQLKSKKKTSLNFIPTNVFRET
    PQVTFFDAGVKNSNGSDVVIHHGSAISPPNDDEIEQYYVHHHQVDHNFVLEGKRTFTLLNPEWEEPHHVIYLNHKMGALE
    IPIGTYHRSVSDSEGSIVLNQAVRDSDFDPTKEFKPVSLRDSADLEKAKAADPVFWIWDDGKIRRLKAGGIANGKKKITA


    >gi|159904051|ref|YP_001551395.1| peroxiredoxin [Prochlorococcus marinus str. MIT 9211]
    MSLNIGDKLPDFSLFDQEGKIRTSKQCKGKKLVLFFYPKDDTPGCTAEACGFRDKYDLFKLFGAVVWGVSNDNQLSHQKF
    AEKNKLPFPLLCDENNSLRTLFGVPKVLGLLDGRVTYLVDSTGVIRHIFNDLLNSTKHVTTALEILEEIK

    >gi|159904082|ref|YP_001551426.1| redox protein, regulator of disulfide bond formation [Prochlorococcus marinus str. MIT 9211]
    MHTEAQHVHSGQTLRTDAPVDHAGKGENFAPTDLLATAVGTCFLTVMGIKAKEKGWELGEITVEIKKKMTTNGPRKIESL
    LLQIEMPSDLEPDQLKVLKNATKDCPVLRSLDDSIRINVQWNQSKSKKEISLNFVPMNVFRETPQVTFFDAGVKGSNGSD
    VVIHHGCAISPPNEDEIEQYYVHHHQVDHNLVLAGKRTFTLLNPEWEEPHHVIYLNQKMGALQIPIGTYHRSVSGPEGSI
    VLNQAVRDSDFDPTKEFKPVSLRDRTDLQKAKAADPVFWIWDDGKIRRLKVGDIPSGKKKSRINCN

    >gi|159904230|ref|YP_001551574.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. MIT 9211]
    MKSIKANNMQLSPEEFARYSRHLSLPEIGIKGQKKLKGSSVLCIGCGGLGSPVLIYLAAAGIGNLGIVDNDLVEESNLQR
    QIIHTHKSIGKSKIESARSRIIDINPYCKVTIFSELLNNENALEIIKPYDLVCDCTDNFESRYLINDACVLLGKPYIYGA
    ISKFEGQASVFNLDKDSPNFRDLIPQPPSMDLLPS
    CSESGVIGVLPGIIGLIQATEIIKIIAGIGTTLSGRILIFNALEM
    KFKELKLKKDYAAKPITELIDYKDFCGSSGVTKVEDSIKSISAKKLRVLLEDNPNKNILLDVRTEEEFKLNAIKGSILVP
    LKNIQNGQEIDKIRKLASNKNIFVH
    CKTGKRSRKAILSLRSNGIDAVNLEGGINSWNES