Prochlorococcus marinus CCMP1375 uid57995

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33239467|ref|NP_874409.1| hypothetical protein Pro0015 [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MNTNFFLSSRRSFLVGILSAFLGIVLGPKKVLAASNSDSWSLTKDQWKQRLSREAYYVLREEGTERPFSSLLNDEKREGI
    FACAGCDLPLFDSSRKFDSGTGWPSFWEPLPNAIETKTDFKLIVPRTEYHCSRCGGHQGHVFNDGPRPSGKRY
    CNNGVAL
    VFTVSK

    >gi|33239545|ref|NP_874487.1| peroxiredoxin [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MSLQIGEKAPDFTLPDQDGKLIKLSSFKGERVVIYFYPKDDTPGCTKEACNFRDRWDILQNHKINVIGISKDPANKHSKF
    INKYQLPFILLTDLEPCPVATSYESYGLKKFMGKEYMGMKRQTFVIDSEGKLEVIYLKVKAASMADQIVQDLALE

    >gi|33239572|ref|NP_874514.1| hypothetical protein Pro0120 [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MGTNRLKSRRRQDQGSKLARIFIAILGTIGVIDTGSITLERWGWINSLSCPGGLEGCDKVLKSAWGTIFAINGFEIPLSF
    VGFLSYLAILFLAIIPFSPLESGKKIDLSRNTWWGLFIISTCMTIFSFVLMGIMVMKIQAFCFFCILSAVISSLILILTI
    IGGGWEEKRDLLFRGLLITIVVLLGGLIWSSSVDPNKKETLIIDSNLGPIIENKSSLAAIELANHLKEKNIILYSAYW
    CP
    HCHDQKEMFGKEAASNLISIECAIDGNNSKPELCESKGITGFPSWEIKGKIESGVKSLDQLAELSEYKGSRDF

    >gi|33239589|ref|NP_874531.1| hypothetical protein Pro0137 [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MSGSSLPNTETHTANDGKGILITQAAMVQLARLCQEKGSDQLLRVGVRSGGCSGMSYTMDFVNSDAIEQEDEVYEYQPFD
    GTAFRVICDPKSLLYIYGMQLDFSNELIGGGFNFTNPNATQTCGCGSSFAV

    >gi|33239605|ref|NP_874547.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MSRRKIRSSNKSVFLTVEGMKCGGCVLSVEKTLLAQDNVEYASVNLIERTAFIELKNHTEDIEEIIKALTNKGFPAQEKK
    QSGSEYENEIDQAKNPWKQWNKLLIPLSLLVLSIIGHLAEGGEINIPVLGTLPFHASLATFALFGPGLTILKNGFKSAIN
    FTPTMDTLVGIGVVSAYLTSLSSLIWPSVGWPCFFNEPVMLLGFVLIGRFLEERARFRTGQALKELAQLQPNKARLLNNE
    NQIKEIRVGALQVGEKIEVLAGDRIPIDGIVLEGRSSIDISSLTGEPLPLTATSGQEISAGTLNLDGTLIVQVNRIGAET
    ALARIIRLVEQAQARKAPIQSLADQVAGKFCYGVVALSIFTFIFWWQIGSNLWPEVLNSSGQGLINSHEHMLHSSFGSEA
    QTPLGLAIQLSIAVLVIACPCALGLATPTVISVASGKAAQKGWLFKGGDVLEKAASIDQIIFDKTGTLTVGRPVVTETLL
    TTDKDKLIQIAASIENNSRHPIAYAILQKAEEFNLPLLKAFNTKSIPGKGIFGELEGIKGIVRVGTIEWARNEGVSWNKK
    TDLYLESITKIGKSVVSISIDKELTGILIIDDQIRNDAKFAINLLRKQGQILRIMSGDRREAVLRIGNELGFESQLLNWQ
    QLPEDKLKYLENLKNYGNIAMVGDGINDAPALASSDLGIAIGTGTEIAQDSADLVLLGDSLEGVPQAFSLAKRAMNKIKQ
    NLFLAFGYNIIALPIAAGILLPRFGILLSPPIAAFLMALSSITVVINALYLKTS

    >gi|33239639|ref|NP_874581.1| rhodanese-related sulfurtransferase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MNHKLPQTISPKELNQWLNEDSLKPILIDVRELEELSIAAFSEEVLHLPLSEFVSWSQSFTKTLSLDKPIVAICHSGVRS
    LNFGIWLLEQDGRYQVWNLQGGIDSWSLEVDNSVPRY

    >gi|33239656|ref|NP_874598.1| glutaredoxin [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MAKVEIYTWQYCPFCIRAKALLDLKKIDYDEYPIDGNQAEREKMSIRAKGKTTVPQIFINNQSVGGCDELYALEESNQLD
    NLINQNK

    >gi|33239691|ref|NP_874633.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    METIEADVVIVGGGPAGCSCALYSSRADLKTVILDKNPAVGALAITHQIANYPGVPTDISGEDLLNLMRDQCIQYGTDYR
    RAQVFGVDVNGDWKTVYTPEGTFKGRALVLASGAMGRPASFKGEAEFLGRGVSY
    CATCDGAFYKGREVAVVGVNKEAIEE
    AQVLTKFASIVHWITSSDPKQEDVHAQTLINEPNVRHWSRTRLLQIEGADAGVTGITVKNRIQEDKQLLPVEGVFVYMAG
    SKPITDFLGDQIALKEDGGVVVDDFMSTTSEGVWAIGDIRNTPFKQAVVAASDGCIAAMAIDRFLNSRKSIRVDWVHS

    >gi|33239724|ref|NP_874666.1| thioredoxin family protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MESPSLIELTKIQRIYLLIASFVLACFLFLLRGGLGLNSEKSLNILALSSLQPEVALNNGHPTIFEFYADWCEACQEMAP
    SIKSIKEKYQDQIDIVLLNVDNEKWLDLIEKYEVNGIPQLNLFDQFGVIKGQSIGLKNIDQIDQIANSLLNNEQLPVFPG
    INNLDGKNIAISPLKEDIIVSKISPRSHS

    >gi|33239785|ref|NP_874727.1| NADH dehydrogenase, FAD-containing subunit [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MLAGGGHTHALVLKRWAMKPHLKPKCLITLVNRDSSTIYSGMFPGLISGDYQLDEVSIDLRRLTDKAGVSLVVGEIHSLD
    IYENRLFLHNRASIGFSRLSLDVGSETLVDEDTSYLKDRSDVFPIRPFEKSLECIKELDVESQNESTKPFTVIGSGLAAL
    EIVFALRKRWPARELRLQAFSRKLNWRFKKAINLAKIDIISPKSLVDGPAVICTGNEAPKWLKNSGLKVNNAGRIITLPT
    LEIPGRPDIFAVGDCGVLAKNSRPPSGVWAVRAAKPLAKNLERSLSGKSLLAWRPQSIALKLVGGISKSNMSIAWSLWGF
    VVIGPNRLIWKLKQSIDRGFVKGFEELSMVEYEEKIIACRG
    CASKVAAQPLKSALKSAELDNLINYPEDAALVASSLDKG
    LWLQSVDGFPALSNDPWLNARLTTLHACSDLWARGASVTSAQAVITLPTIHQKLQQELLIQCLSGIKSALMPQGAELIGG
    HTYESRTELSGNISMDIEISLSINGLVVPNIRPWSKGGLQIGDEILISRGIGTGVIFSAAMKGAVPAKHVDAALFQLSQS
    QHVFVEGLRKQSLETNDSFLIHACTDITGFGLLGHLGEMIQATNIKRLKASLPLVKINLFANSIPVLDGVKNLFKLGYES
    TLAPSNRCFLELLNLKNKTVPFIELIMEDISSEMQEVHLIKELLVDPQTCGPLVISCESKIANSLIDNYYWHRIGFVDTL


    >gi|33239962|ref|NP_874904.1| arsenate reductase related protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MTASLKIFSYARCSTCRKALAWLNLQNIKYKLFDIIDSPPSKEMISDAINQLGDRKYLFNTSGKIYRSIGASAIKIMNDE
    NVVDLLNSEGGLIKRPFVMHPNGRFLIGFNQSIWEDFFLNQD

    >gi|33240019|ref|NP_874961.1| glutaredoxin-like domain-containing protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MKEAIAALSWEELTKFAHNQSDLINGPNNSYSLLRLFGQNKSSIRVVFFRDKHAWCPYCQKVWLWLELKKIPYAVKKVTM
    RCYGEKEKWYLKKVPSGLFPAIEIDQELITESDKILLHLEKTFGPLGMQMEHPKIIDLRNLERNLFRSWCIWLCNPSFSK
    VQSIEREKQFKFIAKEVDNRLSQTNSPWIDPSISNSLESLPGSIDVAFVPYLERMNASLAYYKGIKIRKEFPNIDRWFKS
    LEILPEYRGTQGDFHTHSHDLPPQMGGCWLDKNVLQETFSNQIDIGNGLGENETTFEPSTKTLPSAIALTRVLKHREGIK
    AVNPLGPESFDQPLRAALSYMISKQDFIPTQGSAVGLRYLRDRVSVPRDMPLLAAREFRKALEKTAQIDGSEKGAPLPTR
    HRFDQNPIYFSKAIDN

    >gi|33240020|ref|NP_874962.1| glutathione reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MNYSFDLIVLGAGSGGLAAAKRAASYGARVAIVEGDRVGGTCVIRGCVPKKLLVYGSQYGEYLKNAPSFGVKLTASKIEP
    SILLKNVRNEVDRLNKLHIDLLEKSNVVLIKGWGSIAGPNSVVVKSKDVQDQAIELFAEKILIAVGGRPSFPEIPGASLG
    WTSDDVFLQEGFPDKVVVVGAGFIACEFACILNGLGVKVKQLVRGRNLLKNFDNEVAFNLQQSMESSGIEFQFASEVNSI
    EGEIGDLNLVVNHDSNIKSGAVIFATGRKPFIEGLNLEKVDIRTSNNRINVDNKNSTNISNIFAIGDVTDKVNLTPVAIE
    EGRVFADNNYSDKNRYVNYEFIPKAVFSQPELAYVGKTEEESKRIYGESNIKIYRANFKPMSKMLVKSKEKCFLKLIIEK
    NSNKVVGCHMLGEHASEIIQMAAISMNMGATKLDFDQTMALHPTISEEFVTMK

    >gi|33240190|ref|NP_875132.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MFLNWLNPKKVEAQGKTTSKHFVLNSLINKPANKDEEEIFFGCGCFWGAEKGFWKLPGVITTAVGYAGGAKKNPTYREVC
    SGRTNHAEVVRVIWNKLEIDLSDLLKMFWECHDPTQGNRQGNDSGSQYRSAIYLTKQDHKTLAINSLEKYQVLLQEKGFG
    SITTQIETNIDFYYAEDYHQQYLAKPGSRPYCSAMPTNVSLKDFKGSNYKLNSRVWDNFNWEQNHCVLRSSNSPIIN

    >gi|33240236|ref|NP_875178.1| glutathione S-transferase omega class [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MEGIISVENSELRKGSKSILYTFRRCPYAIRARWALFLCGKQVEFREVRLNNKPIELLRASPKGTVPVLIRENGQVIDES
    LEIMHWAIRTSDDNSNKKLLKGFNDKNIKLLIDQNDNSFKFHLDRYKYPNRYEGIEAEEHRKKAKEILKDWDKRIKYSVN
    LNLFNDSETIADWSIWPFVRQYRLIDSVRFDKDKELINLRRWLESYLNSKSYSKIMKKLSFWKSPYDGISTHA

    >gi|33240325|ref|NP_875267.1| glutaredoxin domain/DNA-binding domain-containing protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MNRLKLNPGVDLKLSIAEFARKNNINGFIVGVVGDLSKAVVQCPKNKTKTSFDGTLEIISLNGTISPESVHLHLAISDGD
    CRVWGGHLEQGAIVLKGADILINSQESKLTTTNLTSFVLEVATLPN
    CPWSNNIKKILSTNKIPHKIININSDANFESIKK
    RSGSSTFPQIFLDGVFRGGYDDFLELYQKGDLYK

    >gi|33240382|ref|NP_875324.1| peroxiredoxin [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MVINYIKNIIFILIFAITITSYPSIVFSNSVPNINEQAPGFELEGYNPERPDKTKWSSNDFKGSWLILYFYPEDATSGCT
    IEAKGFQRLNKEFLSHKANIVGISKDSKASHKLFCSDQKLDFTLLSDKDSQISKSFGSWQEGFSSRNTFLIDPNGIIKYR
    WLAVIPIKHAKEVLSVLNRIDQT

    >gi|33240428|ref|NP_875370.1| AhpC/TSA family peroxiredoxin [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MTEGCLRVGQMAPNFTAEAVVDQEFKQISLTDYRGKWVVLFFYPLDFTFVCPTEITAFSDRFSDFSSKSTEILGVSVDSK
    HCHLAWIQTPRNRGGIGDITYPLVSDLKREIATAYNVLNDDGEADRGLFLINPEGIIMHCTINKAPVGRNVDETLRILQG
    YQYVASNPDKVCPANWNPGDKTMLEDPKGSKEYFASL

    >gi|33240535|ref|NP_875477.1| glutaredoxin-like protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MNLETRARIEDLINSHSIMVFMKGTKLMPQCGFSNNVVQILNALGKHFETFDVLSDMDIREAIKEYSNWPTIPQVYLKGE
    FLGGSDILIEMYNSGELLEKLEIALAS

    >gi|33240589|ref|NP_875531.1| thioredoxin family protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MSSAAAVTDSSFEQEVLQSDLPVLVDFWAPWCGPCRMVSPIVDEISKDFEGKIKVCKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSGTISKHL

    >gi|33240671|ref|NP_875613.1| glutathione peroxidase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MLINVKETVVETADGEKKNLGDYLGNVLLIVNVASLCGNTPQYKGLEKLFEKYKKNGFCVLAFPCNDFAGQEPGTIEEIK
    EFCSVKYGTTFEIFNKVHAKGLTTEPYTTLNKVEPKGDVSWNFEKFLVGKDGNVIARFEPSVEPSSEELITAIEVALSS

    >gi|33240695|ref|NP_875637.1| thioredoxin reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MSIENLVIIGSGPAGYTAAIYAARANLQPLLITGFERGGIPGGQLMTTTFVENFPGFPDGIMGPDLMDLLKAQAIRWGTK
    LLELDAEAIDLKQNPFRVKTANQSIAAQALIIATGARANKLGIPNENKFWTRGISA
    CAICDGATPQFRNEELAVVGGGDS
    ACEEAVYLTKYGSHVHLLIRSNQLKASKAMSDRVMANSQITVHWETELIDVEGKEWIETLKVKRRGTKQEETIKAKGLFY
    AIGHTPNADLLEGQLLINQNGYISTKSGRPETSIEGVFAAGDVADAEWRQGITAAGSGCKAALAAERWLSRNNLSTLIKR
    DSIEPAKTDKETEIAISTEQNFDATKTWQKGSYALRKLYHESSKPILVVYTSPN
    CGPCHVLKPQLKRVIQELKGTVQGIE
    IDIDIEQEIAKQAGVNGTPTVQLFHQKELKTQWRGVKQRSEFKEAITKVLSK

    >gi|33240821|ref|NP_875763.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MSKTKFDFDLIVIGAGYGGFDAAKHAAENGLKVGIVESRELGGTCVNRGCVPSKALLAASGKVRELANADHLALFGIHAA
    PVRFERQKIADHANNLVANVRNNLTKTLERAGVIILRGQGRLEGPQRVGVRESSGVDKVLTAKDVILATGSDPFVPPGIE
    TDGRTVFTSDEAISLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALERVMPTFDPDITKIASRNLIAGRDIDAKS
    GVLASKVKPGCPVKIELADVNTRVVVEELEVDAVLVATGRVPSSKDLNLESMSVETHKGFIPIDESMRVLVDGKPLPHLW
    AVGDVTGKLMLAHTAAAQGTVAVDNILGNKRKIDYRSIPAATFTHPEISSVGLSEEQAKEISAKENFSLGIIRSYFKANS
    KALAELESDGLMKLLFRKDNGQILGAHIYGLHAADLIQEVANALARKQSVVDLALEVHTHPTLSEVVEVAYKQAVQQMKK
    L

    >gi|33240863|ref|NP_875805.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MFIFKPILRILYLTIICICLLLFVPQANALNDSAVFAGGCFWCLEHDFESLKGVLSVESGYTGGKTIKPTYKNHKGHQEA
    IKITFDPLEVSFEELLKTYWRNIDPYDGGGQFCDRGDSYRPVIFYKDNSQYDLANNSLINAAEELSASSNNLAVKIERLD
    EFWEAEDYHQDFAQRNSVKYKFYRYSCGRDQRLDEVWGVNAREGIKWLKKMP

    >gi|33240970|ref|NP_875912.1| hypothetical protein Pro1521 [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MHMKDLYEPSTTRTFTEFSQHADYSLMESLQADPQATSDGNDHKPRQVFSGHYVPVSPTAIPAPEYIAHSKILFNELGLS
    NELVLDEQFRRLFSGDISVAQDPMRPVGWATGYALSIYGTEYIHQCPFGTGNGYGDGRAISVFEGLFNGRRWEMQLKGAG
    PTPYCRGADGRAVLRSSVREFLAQEYMHALGVPTSRSLTLYVSRSETVDRPWYTNDSRATDPDILVNSPAAITTRAAPSF
    IRVGQLELFARRVRNNAQNSSLNELQMIVKHLIKRNYKRVIDPNLPFANQVVELAHLFRGRLISLVTNWMRIGYCQGNFN
    SDNCAAGGFTLDYGPFGFCELFDPSFQPWTGGGEHFSFFNQPVAAKANFQMFCASIRPLITGNKEVIARLDKIQDEFSEA
    MDQEIEAMWAKKLGINHYDATLVNELLQLMILSKVDYTIFFRKLSDIPDQLTTLKPSFYQSTSQHVDARWNSWLQRWQNR
    IKSCGDLAMTSAAMKRINPKYTWREWLIAPAYKQAEQGDYSLIKELQDVFRNPYDEQSSEVSIKYDRLKPKEFFNAGGVS
    HYS
    CSS

    >gi|33241001|ref|NP_875943.1| redox protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MHTEAQHVHSGQTLRTDAPVDHAGKGENFAPTDLLATAVGTCFLTVMGITAKEKGWGLGEITVEIEKKMTTHGPRKIESL
    LLQIEMPSDLESDQLKVLRKATKDCPVLRNLDDSIRINVQWNQSKSKKKTSLNFVPTNVFRETPQVTFFDAGVKGSNGSD
    VVIHHGSAISPPNDDEIEQYYMHHHQVDHNLVLAGRRTFTLLNPEWEEPHHVIYLNQKMGALQIPIGTYHRSVSGPEGSI
    VLNQAVRDSDFDPTKEFKPVSLRHQADLQKAKTADPVFWIWEDGKIRRLKVSGISSGKKQITA

    >gi|33241173|ref|NP_876115.1| dinucleotide-utilizing protein [Prochlorococcus marinus subsp. marinus str. CCMP1375]
    MNLFNANHLELSSDELERYSRHLLLPEIGENGQRRLKNSSVICIGCGGLGSPLLLYLAAAGIGHIGIVDSDLVEKSNLQR
    QVIHETNSIGNTKIESAKKSILALNPNINVEVFNTLLTTENALEILQPFDVICDCTDNFESRYLINDASEILGKPNIYGA
    IAKFEGHSTVFNLREGSPTFRDLIPEPPDPELMPS
    CSEAGVMGILPGLVGIIQASETIKIITEIGDTLDGRLLVIDALTM
    KFKELSLRRDKLRKPIIELIDYQEFCSSNKAIKNSIPSISVFDLKELLEYDEPKVLLIDVRTTREHNIQSINQSISIPLE
    RIKSEEYINKIKDLSCGKKLFIHCSTGKRSIQAAMILKDYGIEATNILGGIEAWSQANF