Prochlorococcus marinus AS9601 uid58307

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|123967551|ref|YP_001008409.1| hypothetical protein A9601_00141 [Prochlorococcus marinus str. AS9601]
    MNQFLSRRIFILIPTMSILKIFFKPMQVLASSLASKEAWNFSRDEWKSRLSPESYYILREEGTERAFSSQLNNEKRKGIF
    HCAGCDLPLFSSDKKFDSGTGWPSFWDSIQGSVETKVDFKLIVPRTEYHCARCGGHQGHVFNDGPLPTGKRY
    CNNGLALR
    FVPD

    >gi|123967629|ref|YP_001008487.1| putative bacterioferritin comigratory (BCP) protein [Prochlorococcus marinus str. AS9601]
    MALKVGDKAPEFKLKDSFEKEVSLSDFKGKRIILYFYPKDNTPGCTKEACNFKENWDLLQKNNIVVLGISKDNASSHQRF
    IEKFNLPFILLTDPEPFKVSSDYDSYGLKKFMGKEYMGMMRNTFLIDTEGNIEKIYLKVKAAIMADHIIADLGLS

    >gi|123967654|ref|YP_001008512.1| hypothetical protein A9601_01171 [Prochlorococcus marinus str. AS9601]
    MALKTLNRRNKKDLKWPKIIIAILSTIGIVDTGSITLKNWGIFTSLSCPGIQNGCETVLNSPWGTLFENNKVNIPLSLAG
    FITYLSILIITIILSLNLISPKEKLNKFLWWLVFLISCASSTFSFLLINIMFFKIQAYCFFCILSAILSFSIFIISIIGA
    KFESREPMIFRGFIVAISVLLGGLIWSTNVDPSNAIDIANPTENVSPIISTSSSPQKVKFAKFLSENNIVMYSAYW
    CPHC
    HDQKQLFGKEAVKELKVVECAKDGKDNEYELCQTKGISGFPSWEINGEIISGTRDLNELATKTDYHGDLNF

    >gi|123967671|ref|YP_001008529.1| hypothetical protein A9601_01341 [Prochlorococcus marinus str. AS9601]
    MFMENVEVKQEIKNSDDGKGILITNDAIEQISNLLKGQSDKKALRVGVRSGGCSGMSYTMDFIGTDEISPDDKVYDYSLK
    ADQSFQVVCDPKSLLYIYGMQLDFSKELIGGGFNFVNPNASQTCGCGSSFAV

    >gi|123967685|ref|YP_001008543.1| putative P-type ATPase transporter for copper [Prochlorococcus marinus str. AS9601]
    MESIQLNITGMKCGGCVSTVEKILNNSDGIENVSVNLLTESAYFEITQNHIEIESVLENLKENGFPSKIYINDFSKKINK
    SELEKKKKWNNQWKKLTFALLLLFFSGLGHLAEGRYINFPILGNILFHASLATLALLFPGRGIIINGFKSFIKNHPDMDS
    LVALGVISAYTTSLLSLIFPATGFPCFFNEPVMLLGFILIGRFLEERARYQTGSSIGELLDLQPEMANIYTEDNHIKSIR
    VNTLRPDQEIQVLAGDRVPADCIVTQGNSYVDVSHITGESKPIEVKEGEILSSGSLNLNSTLRLKVQKVGGDSSLAKLVN
    LIESVNARKPRIQRVADEIAGKFTYFVLIFATLTFFFWWKGARNIWPDLLSHNNQLITHSSHTLHSSLGSNAENFLSLAI
    QLSIAVLVIACPCALGLATPTVITVASGKAAKKGVLFKGGDKIEMASKINHIIFDKTGTLTKGKPFIVDYKNNDDHSFLL
    RIAASLEKESRHPIADALIQEAKKQNLSLFPIKKIFNHTGRGISGELESIDGLINIGNIEWLVSKGIIIDSDAKKVIENE
    ETKTNTIIGVSIKDKLLGFVFLGDLLRDDSIKTVQNLRENKFKINILSGDRKQTVLALAKKIGCKETEVKWDLLPEMKLK
    TIENLKINNKVAMIGDGINDVPALASSDLGIAVGSGTQIAKANADVVLMGDQLNRLPYAFNLAKNTIRKIKQNLTWAFGY
    NLLAIPLAAGILFPKYGILLTPSIAALLMAISSITVVINALSLD

    >gi|123967734|ref|YP_001008592.1| glutaredoxin [Prochlorococcus marinus str. AS9601]
    MSKVEIYTWQYCPFCIRAKSLLKKKNVNFTEYKIDGDEDARALMIERADGRRTLPQIFIDNEGIGGCDDLYALENENKLE
    ALLN

    >gi|123967766|ref|YP_001008624.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prochlorococcus marinus str. AS9601]
    MEIIESDVVIIGGGPAGCTCALYTSRSNLKTVILDKNPSVGALAITHQIANYPGVPVDISGEKLLTLMRDQAVQYGTDYR
    RAQVFGIDATGEWKMVYTPEGTFKAKALVLASGAMGRPASFKGEADFLGKGVSY
    CATCDGAFYKNREVAVVGVNKEAIEE
    ATVLTKFASTVHWITSSDPKSDNEEAMELMDNSNIKHWSRTRLLEILGDDLGVNGVVVKNKQEENPINLNLDGVFVYMSG
    SKPITDFLGDQIALKEDGGVIVDDFMSTNSDGVWAIGDIRNTPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS

    >gi|123967801|ref|YP_001008659.1| thioredoxin-like protein TxlA [Prochlorococcus marinus str. AS9601]
    MISLLLFKNFFFRSTYLLKSFGELSVDPEIAFVNNKPTFLEFYAEWCEVCKETAPQVSAFKDEYEKDINFVFLNVDNQKW
    GNYIQKFAVNGIPQVNLFDKKGNLISTFIGKQDEIKIRESINNLKKGEKPFEEIINSEFSIIQENKNNEVSPRSHG

    >gi|123967862|ref|YP_001008720.1| selenide,water dikinase [Prochlorococcus marinus str. AS9601]
    MTFNHLVLIGGGHSNVSLLKKWLMFPKLMPEIPVSIISRDSHLVYSALFPSVISKSITLEESLIDIKSLAKNAKVSFIEE
    EVKDIDFNLKKIVLSNRPSVNYSKLVLNYGSQTIIPKEFESQVKNRNAFSIKPFLSAYDSILKEDIFDSVNELPFVIVGS
    GLAAIEVSYALRKRWGDRPLKLLCDSRKINNKILKSLRNSNIELVEKLHFDYGKLLLCTGNTSPLWVQKKLLDSDSHSRI
    ITNQNLQIKSFSGIFAVGDCAVVGSAKRPASGVFAVKVVNTLVQNLKKDVEGRSLKKWFPQKIGLQILNIFPSHHPKAFA
    IYHNFVFGPSFIFWILKQKIDINFIKKFRSKRLIMKSSEKSISINDCRG
    CAAKIPQFVLNKSLINSNLNSFASSPEDSVE
    IYKNGQDIILQSVDGFPALVSDPWLNAKITTLHACSDLWACGAKLSSAQALISLPKVEREFQSYLFTQSLQGIKSTVEDH
    GGELLGGHTFEARSFVNKPYSLGIDISLTVQGILKNGAKPWLKSGMNIGDILMMSRPLGVGIYFAGQMQNINMLGSSSEV
    INNLVKSQQYLIDEIYLFQNEFKESLVNAATDITGYGFIGHLKEMVESSNLYRQSNNLEPIKVLLDLFAFKAYPGVFDLI
    RKDVKSTFFESNREIFDKIYKVNNQKRIINFLNEKSLDKKTFNERISLLLDPQTCGPLLISCNRKYENVLKDKWYKVGEV
    VKM

    >gi|123967918|ref|YP_001008776.1| putative bacterioferritin comigratory protein [Prochlorococcus marinus str. AS9601]
    MQIGDKIPEFSLLDQNGVKRSNKGLKNPLVLFFYPKDDTPGCTIEVCGFRDKYDLFKVLGAEVWGVSNGSTSSHLAFANK
    NKLQYPLLCDTNDALRQTFKVPKVLGFMDGRVTYVIDRKGTVRHIFRDLLNGPEHIKEAIRVLKEIQNQ

    >gi|123968003|ref|YP_001008861.1| putative methyltransferase [Prochlorococcus marinus str. AS9601]
    MSESCCNTNTSNKAPNQFDHKDAIQERYGSAAQEKESCLCTPVGFDPVLLEVIPQEVIERDYGCGDPTKYVQKNDIVLDL
    GSGSGKNAFICAQIVGKEGKVIGVDQNPDMLSLSRSASKEVTKNIGFNNTEFLEGSIEKLDELDKDLNPLIADKSVDIIL
    SNCVLNLVSPESRNNLLNNIKRVLNDNGRIAISDIVSNKKVPLRLQNDHDLWTG
    CISGAWYEPEFISDFKELGFKNLKFV
    ERSAEPWKVIEDIEFRTVTLVGNI

    >gi|123968104|ref|YP_001008962.1| putative arsenate reductase [Prochlorococcus marinus str. AS9601]
    MKKIIFYSYLKCSTCRKAAKWLESKDFEFQLIDIVKEPPLVNYLNLALEQYSDDKKRIFNTRGKAFKSLNLDIDSLSKEE
    IIQLLLSDGKLIKRPFLIYEGKKVILGFNEIEYAKQFL

    >gi|123968157|ref|YP_001009015.1| glutathione S-transferase [Prochlorococcus marinus str. AS9601]
    MNGILTWDDLNKFEVEDLDRVNGINNSYANLRLFGHSENDVLVTLYRDRHSWCPYCQKIWLWLEFKKIPYRVKKINMFCY
    GQKESWFLEKVRSGKLPAIEFKEQVITESDDIIAFLENEFGALGSFITSSHLIKIRELEREIFRSWCDWLCRESFNFIDN
    SFRKKRFKESISKLDEILSSSKSGFVDPSVSNTGDLEPGVGDIIFIPYMERMNASLIYYKGFNLRSNYRHVDNWLTLFEG
    TSAYRGTQGDFHTHSHDLPPQMGGCYKESNEQQITFSKLIDTGEGLGNYELNQNYESKYYATIALKRVIKHKDNLLKVNP
    YNKESFDESLRSALSHMITGEVLIPKKLSGISLRYLKNRISVPRDMPIISARLLRQSLNKIESLSNINEIDKIPFRHRYD
    QDPINFISSYK

    >gi|123968158|ref|YP_001009016.1| glutathione reductase (NADPH) [Prochlorococcus marinus str. AS9601]
    MEFEFDLIVVGAGSGGLAAAKRAASYGAKVAIIEANQIGGTCVIRGCVPKKLMVYAAKSKKNMDSSEGYGLKNEGINFES
    NILLKNVREEVSRLSNLHRSSLKKLNITIFEGLGRFITQNELEIICSNTKKIKNKISSKKILISVGGKPKKLNIPGVDLA
    WTSDDIFELEKFPKSILIVGGGYIACEFASIFRNLGTEVTQLIRGQHLLNGFDEDLSSCLEESPTFADINIIPNTQLNSI
    KKVNGNLESTLDSGDKLLTNNILIATGREPNLLPLNLDFLNLKMDGQYLDVDELNQTSNANIFAVGDIINKPNLTPVAIE
    QGRVFSDNFFNDQKRKVNYEYIPKAVFTIPEISTVGLSEKRAKEIYSEKNIKIFKCKFTPMSNTFKKNKSKCMLKIVVHK
    LTDKVLGCHMFGETSSEIIQMVSISLNAGITKKDFDITMALHPTISEEFVTMYG

    >gi|123968221|ref|YP_001009079.1| glutathione S-transferase N terminus [Prochlorococcus marinus str. AS9601]
    MKNDILYSFRRCPYAIRARWALLICEIKVEIREIDLKNKPLDFLNNSKTKTVPILIKKNSEVIEESLEIILWALSESKKE
    NIKLIYLPENKKEDIFEIINENDNVFKYHLDRFKYATRYKDSDQEFHFTNAIKFIKRWNELLAEKKYFFGDSPTIADWSI
    WPFVRQFRIACESQKRTNYFESSIKNWLDSFEKNREFKSLMYKYELWEPNSRKNYFPSN

    >gi|123968396|ref|YP_001009254.1| glutaredoxin [Prochlorococcus marinus str. AS9601]
    MQPHSLKLFPESDLINSIKEYSLSNNLYGYVSGVVGNLRTVCIQCPGNQEINKFEGNLEIVSLNGHFNKGDVHLHLSFAD
    EGCNVFGGHLEEGCIVKKGTDILLLSFEQKIINISNHDLITNESRVKAYILKD
    CPWSKRAIRLLNSLSIPHKVTLIDNDE
    SFQKIMAQSSHNTFPQIFLDNKFFGGYDELSEQAKLDNLISFK

    >gi|123968438|ref|YP_001009296.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. AS9601]
    MFKFLKNIMNNEEVNLTNDAYSLHRILKTDIKKDPNLEEDEIIFGCGCFWGAEKCFWKLPGVITTSVGYAGGEKNNPTYY
    EVCSGLTGHSEVVRVIWDKRQIDLSDLLKMFWECHDPTQKNRQGNDMGTQYRSAIYYKNENNIPIILASKEQYQTELSKK
    NFGLIETEIKMIDSYFYAEQYHQQYLASAGSRQYCSASPTKVKLGVFSGSNYKLEDHIWENFNWEVDKCVLRSDNNPIKN
    NI

    >gi|123968491|ref|YP_001009349.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Prochlorococcus marinus str. AS9601]
    MRNLVISIFISFIFLFNCTSVIAFDFAPEVGDIAPNFQLEGFNKNIKSKNIWELNDFQGKWLVMYFYPKDFTAGCTLEAK
    GFSELKKDFSKYNAEIVGISADNQDSHESFCSEKSINYTLLSDPDGIISKKYGSWIPPFSDRNTFLISPKGEISYRWISV
    LPINHAKEVLNVLKKKI

    >gi|123968546|ref|YP_001009404.1| thioredoxin peroxidase [Prochlorococcus marinus str. AS9601]
    MSLRVGQEAPDFSATAVYDQEFKEVTLSGLRGKWVVLFFYPLDFTFVCPTEITAFSDRYQDFSALNTEILGVSVDSKHCH
    LAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGVVMHTTVNKAPVGRNVDETLRILQGYQY
    VAANPDEVCPANWTPGEKTMLEDPKGSKEYFSAL

    >gi|123968628|ref|YP_001009486.1| glutathione peroxidase [Prochlorococcus marinus str. AS9601]
    MQVDVQNTTVLSADGSSIKLGEYSGEVILVVNVASYCGNTAQYDDLQKLHDLYASKGLRILAFPCNDFGKQEPDSISEIK
    DFCTTKYGVKFEIYEKVHAKGNTTEPYTTLNKVEPEGDVEWNFEKFLIGKDSKVIARFKPGVKPFDENLIAAIEVALDS

    >gi|123968699|ref|YP_001009557.1| thioredoxin [Prochlorococcus marinus str. AS9601]
    MSSAPAVTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMI
    FKGGQKVDTVVGAVPKATLSSTLTKHL

    >gi|123968733|ref|YP_001009591.1| sulfurtransferase [Prochlorococcus marinus str. AS9601]
    MKGKNYKITSLYSFFPFQENLIFDLKNKLLEIENENDLSGLLIFASEGINGTICAEKNVIDIVINLIKEYTDSRNLNIKV
    NFSKKKVFKKLKIKIKKEIVTMGVPEINPSENNGTYIDSAGWNKLIKNQNTIVIDTRNHYEISVGTFQNSINPNTRNFSE
    FPKWVDDHLNTHLENKDSTNIAMF
    CTGGIRCEKATSLLKKKGYKNIYHLKGGILQYLDDIPKKENLFEGECYVFDKRVAL
    DQELEKGSYSICHACGMPISIQDQKRKEYRKGIQCHFCIDQFSDNDRKRFEERQKQIDRLKVENNKINKD

    >gi|123968750|ref|YP_001009608.1| glutaredoxin-like protein [Prochlorococcus marinus str. AS9601]
    MDNSTKDKIQKLIDSNPVMVFMKGTKLMPQCGFSNNVVQILNSLGVEFGTFDVLSDFAIREGIKEYSDWPTIPQVYLKGE
    FLGGSDILIEMYNSGSLKEKIEIELAS

    >gi|123968829|ref|YP_001009687.1| hypothetical protein A9601_12961 [Prochlorococcus marinus str. AS9601]
    MSTKSDSLKGKLTENFSEFSQLSDYSFMNSLKADPQSTKDGNDHKPRSVYSGHYVPVVPTAIPEPEYISHSNKLFKELRL
    SSNLTKDQNFCRFFSGDISVANYPMSPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGRAISVFEGLFNGKRMEMQLKGG
    GPTPYCRGADGRAVLRSSVREFLAQELMDALGIPTSRSLTLFVSRSEIVRRPWYSKGSRYFEPDIMIDNQAAITTRVAPS
    FLRVGQIELFARRVRDNAHDEALNELKMIVQHLIDRNYKDEIEYEISIQSKVIKLASLYRSRLISLIANWMRVGYCQGNF
    NSDNCAAGGYTLDYGPFGFCELFDPRFQPWTGGGEHFSFFNQPSAAAINFKTFCSSLSPLLSKSKQDQEKLDQIEKDFSE
    LMNKELMKMWANKLGLEHYNETLINEFFNLMVISKADYTILFRKLSEIPDNLDSLKDCFYLPINDELNNRWEVWLENWQS
    VLKKEENIKAKSASMKSLNPVYTWREWMVVPAYEEAEKGNYKKIKELQDIFSNPYVEQPAEIDQKYNRLKPSQYFNYGGV
    SHYS
    CSS

    >gi|123968858|ref|YP_001009716.1| putative thioredoxin reductase [Prochlorococcus marinus str. AS9601]
    MENKENNSNVENVVIIGSGPAGYTAAIYAARANLQPLLVTGFNSGGIPGGQLMTTTFVENYPGFPDGVLGPELMDLMKAQ
    AERWGTNLYESDVVSINTDSHPFELKTLEGTIKTNSIIIATGASANRLGVINEDKFWSKGISA
    CAICDGATPQFRDEELA
    VIGGGDSACEEAAYLTKYGSKVHLIVRSEKLRASAAMVDRVKANPKIEIHWNTKVNKADGFEWLEKIETIHSQEGKGEIN
    IKGLFYAIGHTPNTKFLDNKIDLDNKGYIACKSGRPETSIEGIFAAGDVVDSEWRQGVTAAGTGCMAALATERWLAEKNL
    AKTIVRETPEPEKKLNSSDFNEEEVNEDTFDSNSEWQKGSYALRKLYHESKKPILVIFSSPS
    CGPCHVLKPQLKRVIKEL
    DGAVLGVEIDIDKDQNIAKQAGINGTPTVQLFKEKLLKKQWQGVKQRSEFKEAIKNII

    >gi|123969029|ref|YP_001009887.1| dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. AS9601]
    MTDSSFDFDLIVIGAGYGGFDAAKHAAGKGLKVAIVESSDMGGTCVNKGCVPSKALLAASGKVREIADYEHLAKFGIHAS
    PVRFERSKIADHANNLVLNVRENLTKTLKRSGVEIILGIGRIEGNQKVGVRDKNGIDKIFTCKNIVIATGSSPFVPRGIT
    LDNRTVFTSDDAVKLEWLPRWIAIIGSGYIGLEFADVYTALGCEVTMIEALENIMPTFDPDITKIAKKNLIQARDIDTKS
    NVFATKITPGCPVKIELTDAKSKEVVETLEVDAVLVATGRSPNSNNLNLESVGIETVKGFIPVDDQMRVKNGDEIIPNIW
    AVGDVTGKLMLAHTAAAQGTIAVDNICGGNVEINYKSIPAATFTHPEISSVGLSEVEAKEISTKENFTLGVVKSFFKANS
    KALAELESDGLLKLIFNKDNGKVLGAHIFGLHAADLIQEISNAISRNQDVLELSKEVHTHPTLSEVVEVAYKQAASQIK

    >gi|123969065|ref|YP_001009923.1| peptide methionine sulfoxide reductase [Prochlorococcus marinus str. AS9601]
    MKYLLPLIVAFSLFMTPVNAFADELILAGGCFWCLEHDLESLKGINFVQSGYSGGDLQNPTYENHEGYQEVVLIDYDSNL
    VTLPEILRLYFRNIDPLDGKGQFCDRGDSYRPVIFFKDATEKSDAINAIVSASNELRVPIEKISVELKSKGQFWLAEEYH
    QDFAERNELKYKFYRFSCGRDQRLDKLWGDNARSINIWNE

    >gi|123969105|ref|YP_001009963.1| flavoprotein [Prochlorococcus marinus str. AS9601]
    MEPFDLAVVGGGAAGFMTAITAAENGVKRIIILEGTSKLMEKVRISGGGRCNVTNATWIPKELVENYPRGGIQLLESFNR
    FAPGDVYDWFEKKGLKLKIEKDLRVFPVSNSSSDVIDCLRKSALSKNVEILTKFFVKEISKTPDNIFNIFSIKKEKVTSK
    NIILSTGGNPSGYKLAQNLGHNIVKPLPSLFTFSTKEPNLDECSGVSVKGIDIEIKLNTKTFQNRGDLLITHWGFSGPAV
    LKLSSIAARELYNQKYKFNLIIKWSALSYEELKEKVNYLRLNKGKVNLINSRPLPKLTKRLWIFLLNKVGIDKEKKWADL
    LADEREKMINILKRDKYIISGKGPFGEEFVTSGGVKINEVNFKSMESLICPGLFFSGEVLDVDGITGGFNFQHCWTSGWI
    AGIAVSKLNH

    >gi|123969308|ref|YP_001010166.1| molybdopterin biosynthesis protein [Prochlorococcus marinus str. AS9601]
    MSKDIKFNFLNSDEEERYQKHLTLKEIGYEGQLNLKNSSVLCIGAGGLGSSVLLYLAATGIGRIGIVDNDQVEKSNLQRQ
    IIHETNTIGNLKIDSARERIKNFNPNCEILTFSERINPKNALELIKEFDVICDCSDNFGTRYLINDSCLILDKPLVFGSV
    QGFEGQVSVFNLYKNSPNLRDLLPESPSKNAAPS
    CAEFGVVGVSTGLIGILQVNEIIKIILKKGEILDGKILIFDLLNMN
    MKKLHLKSDQSNKRIKNLSQFEGFYNSDEYCEKNNEINIINADEFNSLYKAKPNKILLIDVRENEEFSSFAIEGSISIPL
    SHLKQASDLKFIQKESLNKEVFTICKSGKRSEKASRILSKFKIKSRSIEGGIEKVKKILGN

    >gi|123967843|ref|YP_001008701.1| hypothetical protein A9601_03061 [Prochlorococcus marinus str. AS9601]
    MVRTNSMDLELGFQLPHFEMLNANSLKNEYFNSHNLDNRHLLLMFICAHCPFVKYIENQIFILSKEIENKVQTVAISSND
    IVTHPSDSPKNLKLQAQTQGWSFPYLYDENQNFAKKLKAACTPDFYLFSNEGDGDFLLYYHGQLDDSRPGNNIPLSGKDL
    RSAVKDLNQDNSYPSNQMPSLGCNIKWTPGKEPSWFK