Prevotella ruminicola 23 uid47507

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294672941|ref|YP_003573557.1| hypothetical protein PRU_0159 [Prevotella ruminicola 23]
    MKKLTVILLSILASQLSPLQVNAQRLTVKTTTIDVGATGYEQPVTATFEMRNKGLRRLVIQSVKPDCGCTKIEYPKEVGI
    GERFTIKMTYDARMLGHFQKMCLVKSNASKKPFYLTMTGVVKSDFRDYSGEYPIEMGDLLLDKAVLEFDDVNKGDVPEQE
    IHILNNGKKAMRPNLMHLPPYLTAITSPDHLLPGRAATISVKLLSEKLRDYGLTKTTLYMAHNPGDKVRQDFAIDVATVL
    LPDMKQFEKENKELAPQLQMSATDVDFTDFGGKTKKTATVTLQNTGVSPLKITSLQLFTAGLKVTLSKSEIAPGQSANLK
    ITGIAEELQKLRTRPRILMITNDPDHAKVVVNIKLQ

    >gi|294673163|ref|YP_003573779.1| ThiF/MoeB/HesA family protein [Prevotella ruminicola 23]
    MELTSEQCRRYNRHLILEGFGPEAQSKLLQAKVLLVGAGGLGSPVALYLAAAGVGTIGVVDGDTVSITNLQRQVLHSTPD
    VGRPKVDVAKERMLAINPDVHVETYEYYLSETNAMELIKPYDFVIDGTDNFAPKYLVNDACVMLNKAFTMGGISKYSGQL
    MTHVPGSACYRCLFPEPPAKQDVET
    CAMVGVLGSIAGMLGTVQATECLKYLAGVGQLLTNSMLTFDALSMQWQRFDFGKR
    ESCELCGTHPSIHQLKEYAFKPCKSK

    >gi|294673224|ref|YP_003573840.1| methionine-S-sulfoxide reductase [Prevotella ruminicola 23]
    MEKEIYLAGGCFWGTEHFFKQIEGVIETEVGFANGHTENPTYKEVYTDTTGHAETVRIKYNDAVVGLEFLLQMFFKAIDP
    TSLNKQGHDEGTRYRTGIYYQDANDLPVIEKVYAEQQAQYAEPLAVEKLPLQKFYSAEEYHQDYLDKNPDGYCHLPLELF
    KFAKQAKDKSKQQ

    >gi|294673269|ref|YP_003573885.1| putative thiol-disulfide oxidoreductase [Prevotella ruminicola 23]
    MLAALLMTACGGCSATDDKVDGDEVMDADSLVVGDQLPAFEVTMNDGSVVRTADLKGQPSVVVLFSVDCPDCRHELPEVQ
    KLWDRSRQGELTGDGKPLPIVLIARKNLTEDIEPFWKFAELTMPYSPQPDRKVYSRFAPSRIPRIYISDASATIRVAYAD
    TGMPTAETLAEEISRLNE

    >gi|294673546|ref|YP_003574162.1| RnfABCDGE type electron transport complex E subunit [Prevotella ruminicola 23]
    MNAIQIIKNGIVKENPTFVLMLGMCPTLATTTSAANGMSMGLATMAVLICTNVVISCLKSVTPDKVRIPVFIVVIAAFVT
    LLQMVIKAYLPDVDASLGLFIPLIVVN
    CIILGRAEAFAAKNSPVASLFDGIGIGLGFTLGLTLLGMCRELLGSGSIFGFT
    LIPETYNILLFVLPPGAFITLGFLIAIVNKLRSND

    >gi|294673547|ref|YP_003574163.1| RnfABCDGE type electron transport complex subunit A [Prevotella ruminicola 23]
    MEYLLIFISAIFVNNIVLSQFLGICPFLGVSKKIDTSLGMSAAVAFVLTLATIVTWLVQKYVLDAFGLQYLQTIAFILVI
    ASLVQMVEIVLKKVSPALYQALGIFLPLITTN
    CAVLGVAILVIQKDYNLLQSVVYAFSTAIGFGVALTVFAGMREQLELV
    KIPKGMQGMAIVMLSAGLLSLAFMGFSGVDGGLKILFGLD

    >gi|294673686|ref|YP_003574302.1| hypothetical protein PRU_0965 [Prevotella ruminicola 23]
    MKKLLSTIVLAIVATAGWAQTRIWNNIVTGYSNVPFVKITKVVLSADSTEVFMHFDMPERAAGQEGVLAAKSLLQADGKT
    YEAKNAVGMKLGQPVKIPKDCKVDFSLVFDALPASTWLFSISDPGIWIINAVRDADANADVDVTPVGITDTYWRNTLTGD
    WLIGFAQHHVIYNNKVWDILNQTEQKDTYVLTLNDGLTIKVGKLKKGIRPITIGTGKAIACNPITQEALPDYPTKDTRKG
    FVDNGYREGDSVTIVGWLKDMPEQAWKQSGEFEVWTSNFITDKTESFTAKLDSLGRFTLRMPLLNSATVTLAPRQSWVHP
    VLEPGKTYFFLNDFNTGQKLFMGDDVRLQNELVACPATWPETRINPGESAMQFMERANKVFDAIITKMQADITHRPNLSQ
    RFIDYIKGLCMAGQGYSMMQARFDVPGRSLPKEYMDYVNTKLWQPAPKPYTLYSEFPRFMRDYLDQLRDERHSVSIDPYR
    ITLNDGAYPIILRQARADGKVSITDEELALMERYAVEFHKEYAKQAKNQKIDSLNIDLAGTDLDKLGIAEQYLAIMERPD
    VKKEIEQEFSLIDLYYQKQAIESATTDRALIDLALARKFYWKLNSFRKSLDPSDLNFANKEIKLASALNFVLTENDKYVA
    LEHQDLANAASLRPSTDVANMTDGEKMLRKIIEPYKGRVIYLDVWGTW
    CGPCKQKLKDSWKVKEALKDYDIVYLYLCNGS
    SDESWKNVIKEYNLTGPNCVHYNLPKEQQSAIEHYLSVNSFPTYKIIDKQGNIHDLGWLDDQNLEAFKQTMGKFCK

    >gi|294673730|ref|YP_003574346.1| thioredoxin domain-containing protein [Prevotella ruminicola 23]
    MKKVLFAAAIMMAAGAKAQQVNYTISGVSKDNGAKVVVIDAQARKMENATVENGKFSISGSAEKNALLIIRNSSVSWMMP
    IINDGTPITVNLNDTTVTGSAQNERLVRYDIDMNAAYGKLGVKAGLEKIYTDEVNTMIPVAFVEQYLEEFGLEKLQKTMA
    TKPVWANHPAVQSAIKEYEFEQADRAKKAAYIGKQFTDLEEPDTDGNMHKLSEYVGKGKWVLVDFWASW
    CAPCRAEMPNV
    VKAYEKYHDKGFDIVGLSFDNRKEPWVKAITDLKMPWTHLSDLKGWKTVASGLYEVNSIPDNLLIDPQGKIVARGLRAQG
    LQDKLKEIFGE

    >gi|294673837|ref|YP_003574453.1| putative permease [Prevotella ruminicola 23]
    MDLQSFFISLLNVVCEMAPYLLLGFFIAGVLHVFVPQRFYANYLSRNNKFSVLWAALLGVPLPLCSCGVIPTAIGLRNEK
    ASKGAIASFLIATPQTGIDSILATFSLMGLGFAIIRPVAALITGVCGGLLVNRLVREDDISSIDNCSCEVESGNRIWRVL
    RYAYYDMLRDIGLRLLIGLIVAALIQVAVPDEFFLSFGSQPLLQMLVILIIAVPMYICSTGSIPVAAALMMKGLSPGAAL
    VMLMAGPAVNLASILVVHKSMGRRFTSIYLMTIVGFAVLFGLLLNATGLDFAVAVQDACCMNESAMPSVFKIVCATVLTL
    LIIFALMMKFFSKFTTKKTLAPDVTIYRVEDMH
    CSHCEAAVVRAVEDLPGVEKAKASASANTLTIKGTATEEAIRTAVEG
    IGYTFKGRK

    >gi|294673854|ref|YP_003574470.1| putative ferridoxin oxidoreductase, 4Fe-4S binding subunit [Prevotella ruminicola 23]
    MKGAIEVNTERCKGCSLCIVACPQKVIALANKVNLHGYPYVEAVNEEACVGCASCGIVCPDGCITVYRKKVEE

    >gi|294673945|ref|YP_003574561.1| NADH:ubiquinone oxidoreductase E subunit [Prevotella ruminicola 23]
    MEHAISLLFRSIFVDNMIFAFFLGMCSYLAVSKTVKTSLGLGLAVTFVLTVTVPVNYLLQTKVLGPDCLVEGVDLSYLSF
    ILFIAVIAGMVQLVEMTVEKYSPSLYAALGIFLPLIAVN
    CAIMGASLFMQQRILMDPSNSQAITSVWDAIVYGFGSGLGW
    ALAIVAMGAIREKMQYSDVPKPLQGLGIVFITVGLMAMAMMCFSGLNI

    >gi|294673946|ref|YP_003574562.1| NADH:ubiquinone oxidoreductase D subunit [Prevotella ruminicola 23]
    MALFSKQNKEVFTNPLNVDHPILGQVLGICSALAVTSQLKPAIVMGLAVTVITAFSNVIISIIRNTIPNRIRIVVQLVVV
    AALVTIVSQILKAFAYDVSVQLSVYVGLIITN
    CILMGRLEAFAMQNKPWPSFLDGVGNGLGYAMILVIVGAVRELLGRGS
    LLGFQIVPDACYDFGYVNNGMMTMPAMALILVGCVIWVHRAYFYKEK

    >gi|294673962|ref|YP_003574578.1| putative thiol-disulfide oxidoreductase [Prevotella ruminicola 23]
    MAASCANKPKAAAAPAAEATEVAVDGELAPDFELPNLQGSTTKLSSLRGKYVVLDFWGSWCVWCIRGIPKMKEAYTKYKD
    KMEILGVDCRDTEEKWRAAVDEHQLPWLQVRCPDEQLQTIASQYSIEGFPTKVIIDPDGKLVRTVVGEDPAFYTFLDELF
    K

    >gi|294674044|ref|YP_003574660.1| glutathione peroxidase [Prevotella ruminicola 23]
    MVVAYAKAAFFFITTTRILLQHDMKTVYDFTVKDRKGKDVSLKEYANEVLLIVNTATKCGFTPQYEELEKLYEQYHSQGF
    EILDFPCNQFGQQAPGTDESIHEFCKLNFGTEFPRFKKIKVNGDDADPLYKFLQEQKGFAGWDMSHKIAPILDDMLSKED
    PDYKQKADIKWNFTKFLINKKGQVVARFEPTENIENIAKQIEELLK

    >gi|294674045|ref|YP_003574661.1| thioredoxin-disulfide reductase [Prevotella ruminicola 23]
    MEHTKCLIIGSGPAGYTAAIYASRANLSPIEYSGMQPGGQLTQTTEVENFPGYPQGVDGNQMMMDLLEQAQRFGTDIRNG
    EIVKVDFSKAPYVCTADDGTEIEADTVIIATGASAKYLGLDDERKYNGQGVSA
    CATCDGFFYRKKTVAVVGGGDTACEDA
    LYLAGLAKKVYLIVRKPFLRASQVMQQRVKENGNIEILFEHNTLGLYGENGVEGAHLVKRKGEADEELVDIAIDGFFLAI
    GHKPNTDIFKEWLDMDETGYLKKIDGTPKTKVPGVFVAGDCADPVYRQAISAAGSGCQAAIEAERFLLNK

    >gi|294674109|ref|YP_003574725.1| putative thiol:disulfide interchange protein [Prevotella ruminicola 23]
    MKKLLTIWMLLVAFVAAKAQMMDPVHFTTQMKDLKNGEAELVFKATIDAGWHVYSTGLGNDGPISASFHKNKMDGAEPVG
    KLQAHGKEIKQFDKLFEMEVRYFEQAVTFVQKIKFTKPQYDIDCYIEYGACNDQACLPPSEVTFKQSGKSSIEEEASVPK
    DAPEVDTAKVVAPVDSAVVANDLWTPVVSELQAFNGNAAPTESMALWLIFIEGLLGGFIALFTPCVWPIIPMTVSFFLKR
    NKDRSKAIREATTYGASIVVIYVLLGLAVTLLFGASALNALATNAVFNIFFCLLLVVFAASFLGAFEITLPASWSTKIDE
    KSESTTGLLSIFLMAFTLALVSFSCTGPIIGFLLVAVSTQGSIVAPTIGMLGFAIALAIPFTLFAMFPSLLKSAPKSGGW
    MNAIKVTLGFIELAFALKFLSVADLAYGWHILDREVFLSLWIVIFGLLGAYLLGWLKFPHDDDKHRTNVPQFFLAMASLA
    FTIYMIPGLWGAPLKAISAFAPPMSTQDFNLQKTVTEAKYKDYEQGMAAAKAEHKPVIIDFTGFG
    CVNCRKMEAAVWSDP
    QVADILNNKYILISLYVDDKTPLATPIEVEENGQKRTLRTVGDKWSYLQRVKFGANAQPFYVLLNEEGHPLAGSRSYDED
    IQGYIEFLNKGLK

    >gi|294674131|ref|YP_003574747.1| hypothetical protein PRU_1440 [Prevotella ruminicola 23]
    MKKIAFIALMLICGLTAALAQKPAEIKFDKLTHDFGSFSEKSPVVTYTFTYTNVGEQPLVINQAVASCGCTVPEYTKAPI
    KPGEKGEIKVTYNGAGKFPGHFKKSITIRTNGVVEMTRLYIEGEMTEN

    >gi|294674167|ref|YP_003574783.1| thioredoxin family protein [Prevotella ruminicola 23]
    MTACGGCSATGDKVDGDEVTDADSLVVGDQLPEFKVTMSDGSMVRTADLLGKPSVVVLFSIDCMDCRHQLPQIQRLWDMN
    QKNSVIQGQRIPIVLIARECTEEDIEPFWKFSEFTMPYSPQPNRRVYSLFAPRVIPRIYISDAQGIIRYMHVDIGMPTAE
    TIVNEIKELKQ

    >gi|294674215|ref|YP_003574831.1| UDP-galactopyranose mutase [Prevotella ruminicola 23]
    MEYDYLIVGSGLFGATYACQATRQGKKCLVIDKRPHLGGNVYCENVEGINVHKYGAHIFHTNNKEVWDFVNSIVPFNRYT
    NSPVANYHGKLYNLPFNMNTFYQMWGVTTPEQAVAKIEEQKAEAVTKMKAEGVSEPRNLEEQGLCLVGKDIFEKLIKEYT
    EKQWGRKCRDLPAFIIKRLPVRLVFDNNYFNDAYQGIPIGGYNKLIEGLLEGVECKTNTDFFKSEYHDWCKYAKQLVYTG
    PIDEYFDFCYGKLDWRTVSFKTRVEDTPNYQGNAVVNYTSHEQPYTRVIEHKHFEMFGQAVYDCPKTVVSEEYSTEYKEE
    MDQYYPVNDNKNNLLAEKYRALAENEDGVLFGGRLAEYKYYDMAPIIEKVMGLVIE

    >gi|294674348|ref|YP_003574964.1| hypothetical protein PRU_1669 [Prevotella ruminicola 23]
    MKAIILLTALTLSITTSAQDKERDAIVQHYMSLSAQLKASTQSTIKSDGSFYYPHAGDKFPTFSDKDIDGNTWNSDSIRG
    RVAVFNLWYSG
    CRPCLAEMPILSEWKQQLPEVLYFSATFHDAATTKRITDNRQFNWIHLVEDKTMMPWIGSLGFPLTIVV
    DKQGIVRYAVHGTSEQKRAEILDAIKSALK

    >gi|294674374|ref|YP_003574990.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Prevotella ruminicola 23]
    MKDYPDKMSPEQARAFRDAVLNIVAQIPRGCVTTYGDIATLAGWPSHSRMVGRTLRYTPGAENLPCHRVVNKSGRTAPDW
    SRQRPLLEEEGIHFKPNGHVDMSLHQWIHMQRNSLEGGWYINDFHFSQRE

    >gi|294674565|ref|YP_003575181.1| thioredoxin [Prevotella ruminicola 23]
    MEVTITKENFAELKAGNLPLVVDFWATWCGPCRMVAPIIEELAAKYDGKIVVGKCDVEDNEDLAAEFGIRNIPTILFFKN
    GEVVDKLIGAQSKGKFEEKFEALL

    >gi|294674700|ref|YP_003575316.1| dihydrolipoyl dehydrogenase [Prevotella ruminicola 23]
    MSKVDLIIIGAGPGGYRAAEYAAKQGLKVVIFEGSEVGGTCLNVGCIPTKTYVHSATFAEARERMATVVSQLRQGVEGIL
    SHPNITLVREKGVFTDAHTVGDYTADNIIIATGSETKWLPIKGVDKRLRVGEQSSGIPRVVDSTGLLNLETQPKRLAIIG
    AGVIGMEFASVFNRFGTEVTVIEYLKECLPALDSDIAKRLRKYLERPRVGDGTSGMKGGITFKMKTAVEDIADIDADVVL
    MATGRKPRVQADFANAGIEFDERKGVTVDDHFKTTVNGIFAIGDVNGKQMLAHAAEMQAIHVVNQIIGKPDNIRFDIMPA
    AIFTQPEAACVGPTEDQLKAEGIAYECRKSFWRANGKALAMGETEGMLKLFVSPADGAILGCHAYGAHSADIVQEVSVLM
    CKHTTIAELADMVHIHPTLSEILKSAVE

    >gi|294674709|ref|YP_003575325.1| hypothetical protein PRU_2053 [Prevotella ruminicola 23]
    MKKKTIITAMLALIAMMGLAQTQTATITGEVPAVKDGTVIGLATGSLGHDVGTVQNGRFSLSVPVEDVTLVSLDFMGEGC
    PSRTFNVILRPGAHVKVSGTDCLYPLWKVESDVPEQQTQNRLVDHCRDLLEKCMKLELAGAWKETEPIRLEITKRELDIL
    PLLPIDAASIEKLYEISISAKVTKDFPYLEQARALEKRFAAHAPQALKTQMDEIHANLYPPRLLQVGNQAVDYELFDLQG
    NKHYLSDAFADGRYVLLDFWAIG
    CGPCRMAEAEMKDFYEKMKGKLEIVGISLDDLPQWKEHEFSKRIAWKNWNDGFKGIN
    IVSSYCDVHAKPYYVLLSPDKRIVWKAMGYVPGYFMGMYDALNGLPQDNTSNLALVVTKVEADANATKVSFRYYTLKEYP
    FAVARQSYIAANGKRYKVTAADGITLDERTFVKVKAHTATEGTLANIYYSDFTLTFEPFDTKPATFDFREGDGEDVFVIR
    NISL

    >gi|294674806|ref|YP_003575422.1| hypothetical protein PRU_2156 [Prevotella ruminicola 23]
    MKKLLSTIVLAITCVAALAQKSKVWDDVITGYCNIPVIDITKVTFTPDSTEVCMRLSFRAGKQFGFTSGTHLKVGTQQYA
    VKNATVIKLNEGYTMPTDTVDFSLIFNPAPLGTTRMDLIEPAGLTFSNIHGAGEIPDGIIDTYWRNNATGDWLIGFAVNH
    VIYNNKVWDIATLTNNKDAYTIALTDGPIIKVGKLKKSKRTIGIDQQKGIVCSPITTATMPDYPTKDMRKGFVDNGYRAG
    DSVTIVGWLKDMPEQAWKQSGEFEAIISHLIIDNQERYTTKLDSLGRFTLRFPLVNSSDAFLDLRRSSVSPVLEPGKTYF
    FLKDFKTGQVLFMGDDARLQNELAACPAAWGYRRINQGEDAMQFKTRMDGICEAMKAEIQENIAKRPNLSQRYIDYVNGL
    CLAGQGESMMQARFVVPGKELPKEYMDYVTTQLWQKMPKPYTLFMPFSTFMRDYLDQVVTERHGVKIDRYTITLPEGAYP
    TILRRAKADGRVSITDDEIALVERYAEAYRKEYAAQAQNQKIDSLNINISNSYSEQYLAIMERPDVKTVIDEESTLVDIY
    YQLEAVKSTNPDPALIDLALAHRFYWTLNSFRKSLAPAALNFALQEIKLPAALDIVKTTNDKYIALEHQDLTNAASLRPS
    TDVENMTDGEKMLRKIIEPYKGRVIYLDVWGTW
    CGPCKQRLKDSWKEKEALKDLDIVYLYLCNGSSDESWKNVIKEYNLA
    GPNCVHYNLPKEQQSAIERYLNVQGFPTYKIIDKQGNIHDLDWLHADDMEAFKQTMEKFCK

    >gi|294674981|ref|YP_003575597.1| thioredoxin domain-containing protein [Prevotella ruminicola 23]
    MKIDSAIASEPQKMYMYSMIEREMQLHDSISFDSLHREGTMHGYVPYEYNVNLMLQRRGPQCVPIVVKGGDSLTIHIGDE
    DDGFRLRYIDKVQGSPSTLEMVHYQCRYDSLRQVYLNQNNMSQLYNLSDAQCDSIRAIAKQEKDKLERYILDYACTGKSP
    YSVIEAASDVFYSFRRNPTLYPYTEKEVDDMMNSLLVRFPDYSPMKAFVNDSTMGTYMSAQSFEIWAGMQLRTYSERFQK
    EDKVKVRPLKVGDYMNLRLYNGAKPNVNEFRGKYVLVDFWASW
    CQPCMAQMPNIRYAAQEFSDDLAVCLIGIDENRKQWW
    STVKEKDLRNKDATQTDRPYKIYNYYAYDDKKRVMYPEYQALDIQTIPHNYLVDRSGRIIAKNISITLAIDKLKILLEKE
    KQQ

    >gi|294675046|ref|YP_003575662.1| thioredoxin-dependent thiol peroxidase Bcp [Prevotella ruminicola 23]
    MRMNIGDKAPEILGKDEQGRDIRLSDYRGRKLVLYFYPKDNTSGCTAEACSLRDHYNELQGAGYEVVGVSKDSAASHVKF
    KEKHELPFPLIADVDKELLQAMGAWGEKVMYGKKTEGTIRTTFIINEEGVIEQIFAGKQVKTKEHAEQILSR

    >gi|294675110|ref|YP_003575726.1| S41 family peptidase [Prevotella ruminicola 23]
    MNKTFASLLLCMASMNAHAQFRINNSDDSPLRKLQFAEIAISNLYVDSVDEKKLVEDGIRGMLDKLDPHSSYLTPKEVKD
    ANEPLAGNFEGIGVQFNLIEDTLLVIQPVTNGPSEKVGIIAGDRIISVNDSAIAGVKMSKEEIMKRLRGPKGTKVKLGVI
    RQGIKDRLTFTVTRDKIPVKSVDAVYMIRPQIGYIRIGNFGATTHQEFLAGLKTLRDQGMQHLILDLQENGGGYLKAAVD
    IANEFLQKNDLIVYTEGRKVPRTEYKADGSGVFRQGKVIVLVDSYTASAAEIVTGAIQDQDRGIVVGRRTFGKGLVQRPL
    DLPDGSMIRLTIAHYYTPSGRCIQKPYTKGENRDYAMDVINRLKSGELTNADSIHFADSLKYQTLREHRTVYGGGGIMPD
    EYCPLDTTIYTKFHRELAAKSIILQQNLRYVDNHRKQLKKAWPSFAEFKEKYEVPQDLVDTILKNGEKQNIKPKDQAELE
    KTLPYLRLQLKALIARDIWDMSEYFSVFNEENAMVKRALEVIAKQAFTTIDVDKFQKTLENCANDCVLVDVRTPEEYNAE
    HLKGAVNIDVKDSLNFMKKATDMLPKEKTIMVY
    CRTGHRSSMAAGKLAAAGYKVLNLKGGITAWKEAEKETVK

    >gi|294675355|ref|YP_003575971.1| thioredoxin domain-containing protein [Prevotella ruminicola 23]
    MKKVFVMMAVLLASVTASANDNFKLTGKIDGASNDTLCIEYTILQPQKQHMVHKVAVKAGEFLFHANLKEAYSAKMYLKT
    NPKESLYFYLVPDEEAVFSGSLNSVDEHWSGSTFYQQYERITELQRPFNIEFVAARNDPDSIRGEKNRDINRRAHSVYMK
    YIEEHPDEDATATLIVYVGYEQVLPAMAKLTPEVRNGRMKSDLDSLERMFKQVLKEAAARKAVKNDTVTIGTQVPELGLK
    DLQGNVLELKSLRGKYVVLDFWGSW
    CTWCIKGFPKLKEYYAKYKDRLEIVGIDCNDTAEKWAAAVKKHNLPWLQVRSEDG
    ITEDRFRIKGYPYKVLISPEGIVLNAYLGETADFYQYLDTAL

    >gi|294675414|ref|YP_003576030.1| glutathione peroxidase family protein [Prevotella ruminicola 23]
    MSKIYDFKALTSKGKEIDFSEFQGKVLLVVNTASKCGFTPQFEGLEALNQKYKDQGLVVIGFPCNQFKEQDPGTDSEISE
    FCQLNYGVTFQIMKKIDVNGAAADPIFEYLKTQAPTEEYKGLKAKAAKALFKTISKSVEKDSDIKWNFTKFLISKDGDTI
    KRYAPTTEPADFEKDIEAMLG

    >gi|294675450|ref|YP_003576066.1| hypothetical protein PRU_2829 [Prevotella ruminicola 23]
    MKRLILSAVIASATLTGALAQQNDQRLNKAITDKGYFQKAWKSAPSFRDLLKRRKAAVNQFRAIPTAALHPITIRAFATA
    EQRAGTRHVIIREHQYLNDSGYNNGGFDLGIGTPDHVIAAIAGDIIDSYVTQAAIKGVAIDSLAINIKQTGHSLQNWGLD
    YTIFIDSPASDQQLEELRVLAEKNSPLYQFSIRAHKVNTTVELHKSAEELEIPPTYQPGLREFIEWETRKGEANKQLRES
    GQRPDKAKFGGYAYDYPYSRKNEFTPAQSESYLNPDGPTAFINPSSGVTVLQVRHHRVLQDHPQIFGGNDLGPTAVESHI
    GLLGS
    CFTHVAEGTAARNRIPLDTLNVALTAQFDPRSGRKGYEQTPLYPTDIQMRVVISSPRSEAEIRQLVADTERGCPI
    YNLVTNAQEIKGGIKRVIAKNK

    >gi|294675456|ref|YP_003576072.1| putative thiol-disulfide oxidoreductase [Prevotella ruminicola 23]
    MKLKTLLAALLLAGFAINTKAQTTDEDLDAKYATSLIQPGTVAPDFTMNTPDGKPFSLSSLKGKTVVLDFWASWCPDCRK
    DAPEVVRLYNDFHSDKVEFVGVSMDTNVEAWQKAINQYGISYPQVSELKKFKETDISKSYGVQWIPSMVVVSPEGNILLS
    TVQYQKVEKLLKGINK