Prevotella melaninogenica ATCC 25845 uid51377

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302344855|ref|YP_003813208.1| glutathione peroxidase [Prevotella melaninogenica ATCC 25845]
    MKKLFSLLFLALMTLPIMAQKNVYKFSVKDGNEHTVKLKDYKGKVLLIVNTATKCGFTPQYEALQKLYETYKNQGLVILD
    FPCNQFGAQAPGSFRDIHTFCTGNYGTTFPQFAKINVNGRNESPLYTYLKAQQPFKGFDMNNNIGKFLDEKFRAENPDYA
    KDPSIKWNFTKFLIDRQGHVIDRFEPTADMKDVEAGIKAALKMK

    >gi|302344924|ref|YP_003813277.1| antioxidant, AhpC/TSA family [Prevotella melaninogenica ATCC 25845]
    MKRILLAVVSVFLMSASVAFAQTTNVEPTKDLDAKYATNMLKPGTRAPEFKLKTYDAKEIKLSQYRGSYVVLDFWASWCP
    D
    CRRDIPAMKALYEQFRDYGVQFVGISFDTDREVWAQTYWGKYQMHWTQVSELKKFRKNTVIDKLYKIDWIPSMYLVDPE
    GKIVMGTVEINKLKAKLESLPLTPQVSKTEVLPTFEGGQEAIDNYFAQNQRRSIQSFRSKVHAEMTVVFNVEMDGTVTGA
    RVVDVKNVKGTSKHFMKMDAEKQKRVLENCVEYYKEQAVRLTNNMPKWNPAMQNDRPVKSKTIVNIVFQ

    >gi|302344998|ref|YP_003813351.1| antioxidant, AhpC/TSA family [Prevotella melaninogenica ATCC 25845]
    MNVGDKAPEILGTDQDGKEIKLSDYKGQKIVLYFYPKDSTSGCTAQACNLRDNYKELRDKGYVIIGASIQDEKSHKKFIE
    KNELPFPLIADTDLKLVETFGVYGEKKMYGRTYMGTFRTTFIINEDGIIERILGPKQIKTKDHAAQILAED

    >gi|302345130|ref|YP_003813483.1| antioxidant, AhpC/TSA family [Prevotella melaninogenica ATCC 25845]
    MILKDIEGRTVQTDTISNNGKPLIIAFFATWCKPCNRELTSIDEVYDDWQQETGVRLVAVSIDQAQNVNKVKPMVDQNGW
    RYDVLLDANGEFRRSLGIQSVPYTVLLDGQGRIVYKHNGYTDGAEAELYKKVKEVAGK

    >gi|302345195|ref|YP_003813548.1| putative ATP synthase F0, A subunit [Prevotella melaninogenica ATCC 25845]
    MKRRNTLFILFTLLFSLTAMAQQNPVHFSVQQKQVSPTEVEVVFTAKIDQGWHVYSTNLPADGPTSASLHVDKAEGVTPV
    GKLTTRGKELNVYDKTFEMKLRYFENSVGFVQRYKITAKTYSIKGYLEYGACNDEMCLPPTQVEFNFKGNGPASAPAATP
    TAANAETEKTTTAATDVAADGLSALTAMAADTAKKTDVLPVDTAGPLKQENAQVNADVNLWQPVIKELSAFNSTKDSTNS
    SLWSIFFMGILGGFIALLTPCVWPIIPMTVSFFLKRAKDDRKKGIRDAVTYGLSIIVIYMGLATLVTWAFGPQKLNELAT
    NAPFNVFFFLLLVVFAFSFFGWFELRLPSSWGNAVDNKASATTGLLSIFLMAFTLSLVSFSCTAPVVGLLLVQAATSGDW
    VAPAVGMFGFALALALPFTFFALFPTLLKKAPKSGSWMNMIKVVLGFIELAFSLKFLSVADLAYGWHILDRETFLSIWIV
    LFGLLGLYLIGKLKFPHDDPDQKAMPVPAIMLGLCSLAFSVYMLPGLWGAPSKAVSAFAPPINTQDFNLAPQTVHAAYTD
    YDEGMRAAAAAGKPVLVDFTGFG
    CVNCRKMEASVWTDSRVAEKLNKDYVLISLYVDDKTPLKQPVEVKLPDGTSRTLRTI
    GDKWSYLEQTKFGYLAQPFYVPLDNAGKPLNGSFSFKEDVPAYLEFLDKGLENYHAQHQ

    >gi|302345203|ref|YP_003813556.1| thioredoxin [Prevotella melaninogenica ATCC 25845]
    MEVVITNENLETYKNGELPLVVDLWATWCGPCKMIGPIISELAEEYDGKIVVGKCDVEENDDVAIDFGVRNIPTILFFKG
    GQLVDKFVGAASKDVLKEKFDALL

    >gi|302345251|ref|YP_003813604.1| thioredoxin [Prevotella melaninogenica ATCC 25845]
    MKRRRYILLLVCLLMMAVQLRAQQGTEAANGIKFFKGTFSEALVKAKQENKILFVDFYAVWCVPCKKMAKTVFTQEEVGK
    YFNEHFISLQLDAEKGENVDIAKNYKVAAYPTVAFIAPDGKALSVNTGAMDKDELMEAAKIAAGESVSFEELYNKYKADN
    NDLDVQQQLLLKAPSFLQAQEGMDADKWVTRLQKLYKNYVAAKAPLKLINENDYRIILTLEGDEDKEHKQYMIDLMNDHL
    DDWMKKLGKAPAYYIVEANDIFAEDMAKDGNVKYKDYVEKVKNQYAKAYEVVGLTGITPYEKAKLYFDALFNLYKNKDVN
    GYVKAMETYFGKMENNLRSADYGKAAQNLYMAAGKNLKAKDHEVAIKWAEKALSQEDAVMDRVNYMVMIGDSYRELKNYT
    KAREYYNQAFAETLRLENMEMPQAMLQGAIKQKLSTLELLEK

    >gi|302345264|ref|YP_003813617.1| copper-exporting ATPase [Prevotella melaninogenica ATCC 25845]
    MKQTIPVIGMACSACSANIEKKLNTLKGVNSASVSLPGRSALIDFNPQVISLEKMKAEINALGYDLVIDKETSVDEIEKR
    EYVLLKRKTVLSWLFSIAVMCVSMRWIDLGSRDITNQVALLIALANMLYCGRQFYVSSFRQLRHGSANMDTLVALSTGIA
    FLFSAFNTFWGDAVWASRGVVWHTYFDASVMIITFVLTGRLLEEKAKDGTASSIRQMMGMAPKTAHIVDGDKIEEVPLST
    IEVGDILEVRPGEKVPVDGEVIWAESFMTADAAYVDESMITGEPTPAEKKKGSKVLAGTIPSQGKFRMRARQVGEDTALA
    HIIKMVQEAQGSKAPVQRIVDKAALVFVPVVACIALVTFLLWWLIGGNSALPQAIMSAVAVLVIACPCAMGLATPTALMV
    GIGKAAQKQILIKDATALESLRKVDVLVTDKTGTLTIPNKNIDFTKADNLPFEERETLKPNAREAMDELQKKGIEVYMMS
    GDKDEAARYWAEKAGIKHYHSKVLPQDKENLVRQLQAEGKRVAMVGDGINDTQALALADVSIAIGKGTDVAMDVAQVTLM
    GDDLSAIPEAVQLSRNTVRMIWENLFWAFIYNIVCIPLAAGLLYAFGIDWQITPSWASALMAFSSVSVVLNSLRLRWMK

    >gi|302345483|ref|YP_003813836.1| OsmC-like protein [Prevotella melaninogenica ATCC 25845]
    MVVTKAIYQGKGRVEAKHVRSGVLVTTDAGKAVGGLGENQNPVQLLGNALSACVLTLMGLQAERRGVDFTGCYAEVGECE
    EDMEKFTVTRIPITFHLKASFDEKQRKKFEYIANKA
    CFVGNTLTAEKVFTFVYD

    >gi|302345542|ref|YP_003813895.1| thioredoxin [Prevotella melaninogenica ATCC 25845]
    MKRTATLVVAIMALTLTACKADNNPKKQDNSAMTTEQTEVNNQNEGKESKMSVTEMNIDMFQQKVMDFKNNPKTWNFKGD
    KPAIIDFYATW
    CGPCKATAPVLEEVASDYAGQIDVYKVDVDKQRELAALFGIRSIPSILFIPKAGEPTMQNGAMNKAQFE
    EVIKSVLLK

    >gi|302345660|ref|YP_003814013.1| 6-O-methylguanine DNA methyltransferase, DNA binding domain protein [Prevotella melaninogenica ATCC 25845]
    MAVDIEEFRKEVYNVVASIPSGRVLSYGQIAWLVGCPRHARLVGKVLHGVSETENLPCHRVVNGNGRTAPCWEEQRGLLE
    TEGITFRANGCVDMRKWQWKLEE

    >gi|302345661|ref|YP_003814014.1| glutathione peroxidase [Prevotella melaninogenica ATCC 25845]
    MATVYDFNLKDKKGNEVSLETYKGKVLLIVNTATGCGFTPQYEELEAMYRSLKEKGLEILDIPCDQFGHQAPGTDEEIHE
    FCTAKFGTDFPQFKKSDVNGANELPLYTWLKSEKGYAGGAYEEKLAAIMEDLYNKANTEPRKQNDIQWNFTKFLVNRNGE
    VVARFEPTVDLKEVQKAVEAAL

    >gi|302345735|ref|YP_003814088.1| thioredoxin [Prevotella melaninogenica ATCC 25845]
    MKKIILMTALATAVLTANAQDIKPYEEKMSQIEAQFKSLEAAYQAFGKKDPATFTDAEKAKLNEIMSKADSLDNVQKTTA
    LEIARKFKDTKFPAKYVAKIMYDVEFDELKELCDPNTGYYNEPEMAKPKQLFESYKLRQPGSMYKDLTMQDLNGKQVKLS
    DWVGKGKYVLVDFWASW
    CGPCRAEMPNVVAAYNRYKDKGLEIIGVSFDSKKLQWSAAVEKLGMTWPQMSDLKGWESSAAA
    VYGIRSIPSNILIDPQGKIVAMDLRENRLQEVLAEKLK

    >gi|302345771|ref|YP_003814124.1| rhodanese-like protein [Prevotella melaninogenica ATCC 25845]
    MKKLFTAILAALGIGMGACAQNPYTDVDVNRFEQIIKSDSVQLVDVRKLDEFTEGHIPGATHIDVLTPSFLSNALAKLDK
    KRPCAVY
    CRSGKRSAMAATLLAKEGYTVTNLLGGIIAWTEAKKKTVKE

    >gi|302345933|ref|YP_003814286.1| peroxiredoxin [Prevotella melaninogenica ATCC 25845]
    MEPIINAHAPEFTVQAFQDGQFKTVSSKDIEGKWALFFFYPADFTFVCPTELEDLADKYEQLKGLGVEVFSVSTDTHFVH
    KAWHDASDRIKKIKYTMLADPTGVLSRGFGVYKEDEGLAYRGTFLVNPEGLVKIAEIQDNSIGRNADELVRKVEAALFVA
    SHEGEVCPAKWKQGDETLKPSIDLVGKL

    >gi|302345934|ref|YP_003814287.1| alkyl hydroperoxide reductase, F subunit [Prevotella melaninogenica ATCC 25845]
    MLDSSILEQVKGVFGSLSSDITLSVTRNSNDENSAEFSSFVEDIASTSDKIKTVYQEGEHFSFSILRNGEETGISFRGIP
    NGHEFTSLLLAILNSDGQGKNLPDEAIATRIKSLKGEIRLQTYVSLT
    CTNCPDVVQALNVMALINPNISNEMVDGGLYQD
    EIQRLNIQGVPSVYVNGEPLHTGRGDLGILLQELEDKVGTDHDENAVQTVREYDVIVLGGGPAGASSAIYSARKGLRVAI
    VAERIGGQVNDTTGIENLISVTKTTGTQLAADLRTHINDYSIDVFDNRKVVSTNLKEAIKTVSVRGGETFTAPAVVIATG
    ASWRLLGLPDEDKYIGHGEHF
    CPHCDGPFYKGKDVAVIGGGNSGIEAAIDLAGICRHVTVLEFADAMRADEVLQQKVASL
    PNVEVFLSTQTTALLGDGQKLSGIRVKDRTNDEERDIALDGVFVQIGLSPNSDAFKDQVEVTPRNEIVIDATNRTNLSGV
    YAAGDVTTVPYKQITIAMGEGAKAALSAFDDRIRGVI

    >gi|302346198|ref|YP_003814496.1| 6-O-methylguanine DNA methyltransferase, DNA binding domain protein [Prevotella melaninogenica ATCC 25845]
    MYFCRYPSPLGNLILAEEEDAIVYCQWEDTIDERMIAKWTEDREQNSVLLTEACRQLTEYFTQKRKTFNLPIRLNGTPFQ
    LLAWEGLQQIPYGETLSYAELARRIGRNKAARAVGNANHHNPLMVIIP
    CHRVVASNGELGGYAGGTARKAWLLEKEKGNN
    KL

    >gi|302346253|ref|YP_003814551.1| NADH:ubiquinone oxidoreductase, D subunit [Prevotella melaninogenica ATCC 25845]
    MDLFSKQNREVFSNPLNLDNPIMVQVLGICSALAVTSQLKPAIVMGLAVTIITAFSNVIISLIRNTIPNRIRIIVQLVVV
    AALVTVVSQILKAVAYDVSVELSVYVGLIITN
    CILMGRLEAFAMTNKPWPSFLDGVGNGLGYAMILVVVGAVREFFGRGS
    LLGFKILPQSLYDAGYMDNGMMSMPAMALILLGCVIWVHRAYFYKEDKK

    >gi|302346254|ref|YP_003814552.1| NADH:ubiquinone oxidoreductase, E subunit [Prevotella melaninogenica ATCC 25845]
    MEHLISLFFRSIFVDNMIFAFFLGMCSYLAVSKSVKTSLGLGVAVTFVLLVTTPINYLLLTKVLGPDCLAEGVDLTYLSF
    ILFIAVIAGIVQIVEMAVEKFSPSLYGALGIFLPLIAVN
    CAIMGASLFMQQRIGLDPASTQYIGTVWDALVYGTGSGLGW
    TLAIVAMGAIREKMEYSDVPKPLQGLGITFITVGLMAMAMMCFSGLKI

    >gi|302346372|ref|YP_003814670.1| methionine-R-sulfoxide reductase [Prevotella melaninogenica ATCC 25845]
    MRNILSILCTLILPTIVEAASCGLLMTGTTSCTNKTKTTMTQTDSIIAPKTKFTRPDDATLRKKLTPEQYAVTQQAATER
    PFTNEYDHEFREGIYVDITTGEPLFSSTDKFDSGCGWPAFSKPIDKKLVTNHTDTSHGMVRTEVRSKTGKAHLGHVFDDG
    PAATGGKRY
    CINSASLRFIPLEEMKAKGYGAYIKLVRPMKEIYVAGGCFWGTEHYLKQIEGVTATEVGYANGIIKNPTYE
    DVCTDKTQFAEAVHITYDPKVISLDFLLGLYFKSIDPTSINKQGNDRGSQYRTGVYYTDPADLPTIKKVFEEEQKQIHGK
    IAVEVKPLKNFYTAEEYHQDYLDKHPTGYCHLPAALFEYARKAKMKK

    >gi|302346373|ref|YP_003814671.1| thioredoxin-disulfide reductase [Prevotella melaninogenica ATCC 25845]
    MEKVKTLIIGSGPAGYTAAIYAGRANLQPVLYSGLQPGGQLTTTTIVENFPGFHEGIDANQLMSEMREQAKLYGADLRDG
    SIVKVDLSSRPFHLEDERGNQIEAETVIIATGASAKYLGLPDEEKYRGQGVSA
    CATCDGFFYRKRTVAVVGGGDTACEEA
    MYLSGLANKVYMIVRKPQLRAAEIMRKRVTEKENIEILYNTNTLGLFGEDGVEGAHLVRFKGEENEEKFDINIDGFFLAI
    GHTPNTDLFKGQLEMDDHGFIITKPKSTATNIEGVYAAGDVADPTYRQGVVAAGTGAMAAIEVDRFLQKQ

    >gi|302346402|ref|YP_003814700.1| hypothetical protein HMPREF0659_A6656 [Prevotella melaninogenica ATCC 25845]
    MKKFLLMTVMLVFGLTFAVAQNQAEIKFDKVTYDFGTFSDDNPVHKTTFTFTNVGKAPLVINQIVASCGCTIPNYDKRPI
    APGQKGTIDVTYNGTGKFPGHFKKSITVRTNGKVEMTRLYIEGVMTGK

    >gi|302346454|ref|YP_003814752.1| dihydrolipoyl dehydrogenase [Prevotella melaninogenica ATCC 25845]
    MKKTNLLIIGSGPGGYRTASYAAQNGLEVTIIEKAQPGGTCLNAGCIPTKCLAHDAELRLTTSSLYETTPPLDFAKVMER
    KEGVINQLREGVSTLLSQPGIDFIIGEARFVSDHVVEVNGEQIEAEHIIIATGSRSKMPPFMSEEDFLSQSETAQNIVTS
    TELLSIAKVPQRLTIIGAGVIGMEFASAFSAFGSEVTVIEFMKECLPPIDSDIAKRLRKTLEKRGVTFYMQSAVKQILSP
    AESGQEYTTVIFDKKGKEDRIDTDLVLIATGRQANFDNIGIESTGIEVNAKGIVVNDNMETNVKGVYAIGDVNARQMLAH
    AATFQGFRAVNHILGKDDNIRLDIMPSAIFTYPEAACVGKTEDQCKAEEIKYSTRKGFYRANGKALSMEETEGMIKVLIA
    EDGSILGAHCYGAHSADLIQEVAALMNYDAKLDKIRDIIHIHPTLSEILQDALL

    >gi|302346644|ref|YP_003814942.1| glutathione peroxidase [Prevotella melaninogenica ATCC 25845]
    MRTVYEFSVKDRKGKAFSLKEFSNEVLLIVNTATKCGFTPTYEELEALYEKYHAQGFEVLDFPCNQFGQQAPGTDESIHE
    FCKLTYGTKFPRFKKVKVNGEDADPLFKFLKEQKGFAGWDESHKLYPILDKMLSEADPNYKENPDIKWNFTKFLINKKGQ
    VVARFEPTESIENIAKQIEELL

    >gi|302347086|ref|YP_003815384.1| putative redox-active disulfide protein 2 [Prevotella melaninogenica ATCC 25845]
    MTMEIKVLGTGCSSCKALYETTKQAISELGCDATLIKEEDLLKIMEYNILGLPALVIDEKVVSAGKKLSLAEVKELITK