Porphyromonas gingivalis W83 uid57641

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|34539910|ref|NP_904389.1| thioredoxin [Porphyromonas gingivalis W83]
    MALQITDATFDGLVAEGKPMVVDFWATWCGPCRMVGPIIDELAAEYEGRAIIGKVDVDANTELPMKYGVRNIPTILFIKN
    GEVVKKLVGAQSKDVFKKELDALF

    >gi|34540034|ref|NP_904513.1| pyridine nucleotide-disulphide oxidoreductase family protein [Porphyromonas gingivalis W83]
    MVREAKNLRARTKKISLHICRKHAPQSEDFRCVFLRQQVIDRDIEAMAKPYDFYIVWKLSYNHVFTIHPRHTILELPPVY
    PDTALVPFFIMRFSFFDHMISCEYIFHRKLFVCLHRKNKQKQKSNMRYVIVGGVAGGATAAARLRRIDEKAEIILFEKGQ
    NISYAN
    CGLPYYIGGVIKERENLFVQTPEKFGRLLNLDVRVQSEVLSIDRSDKQIRVREANGREYSEHYDKLLLSPGALP
    FVPPLPGVDSPGVFTLRNVEDTDAIKSYLDTHKVKRAIVVGGGFIGLEMAENLHARGIAVNVIEMAPQVMAPVDFSMATI
    VHAHLQEKGIGLYLGKAVKSIEKRGEVLTASLDSGEKIEAELILLSIGVRPNTKLAADAQLAIGPARGIRVNEYLQTSDP
    DIYAIGDAIEYPHPLTGKPWTNFLAGPANRQGRIVADNMHGQTLRSYEGAIGTAIAKIFDLTVAATGLPAKALKREGLPY
    ESVTVQPNSHAGYYPNAYPLTLKITFHPESGMLYGAQCVGIEGVDKRIDSIAQIIKRKGGIADLMQTEQAYAPPFSSAKD
    PVALAGYVADNIITGRMKPLHWREMKEVDPNRVTLIDARPRQAYEVEHIPGAISMPVEEIRARIGEIPHDKPIYVY
    CAVG
    MRGYFASNILRQCGFSNVRNLIGGYRLYSTITADYSSAGQPATAQLPAKDSPSSHTQVPEVDACGMSCPGPILKLKQSID
    QIAVGEQLCILATDPGFARDAQAWCDTTGHNLIRQETIKGKYKVTIEKTACKEEGTCVNETPSKGKTFILFSDDLDKALA
    TFVLANGAAAMGQPVTIFFTFWGLNAIKKPHAVKAKKDIWGKMFGMMLPKNSKGLGLSKMNMFGLGAKMMRMVMKEKHVD
    SLESMRKQALENGVEFIACQMSMDVMGINREELLDEVSIGGVATYMNRAEEANINLFI

    >gi|34540117|ref|NP_904596.1| thioredoxin family protein [Porphyromonas gingivalis W83]
    MKKNICSKAILLASLLLLSVGTMTASCTSKNDTRQEETVSADSKGEKDGKIIHITAEYMREHIYDYTANPQEWVYKGDKP
    AIIDFYADW
    CGPCRSLSPKLEEVAKKYAGKLTVYKVDVDKEKELAGIFGVRSIPMVLFVPVKGIPTQTMGNLPMENIEEA
    IAKIMQSDL

    >gi|34540144|ref|NP_904623.1| electron transport complex RsxE subunit [Porphyromonas gingivalis W83]
    MSKNLSVIINGIIKENPTFVLLLGMCPTLATTTSAINGMSMGLATMFVLICSNMVVSLVKNLIPDMVRIPAFIVIIAGFV
    TILQMLIKAYMPDLDKSLGIFIPLIVVN
    CIVLGRAEAVASKKGLLHSMFDGIGIGLGFTLSLTVLGIVRELLGSGKLFDF
    AVFNESYGALIFVLAPGAFIALGYLIALVNKMKKKA

    >gi|34540145|ref|NP_904624.1| electron transport complex, RnfABCDGE type, A subunit [Porphyromonas gingivalis W83]
    MEFFMLFIAAVFVNNVVLSQFLGICPFLGVSKKVDTSIGMGAAVTFVLALATLVTFLIQKFVLDRFGLGFMQTIAFILVI
    AALVQMVEIILKKVSPPLYQALGVFLPLITTN
    CCVLGVAILVIQKDYTLLQSFVYAISTAIGFTLAMVTFAGIREQLDMT
    NLPKAMKGIPSALLAAGILAMAFMGFSGIA

    >gi|34540155|ref|NP_904634.1| hypothetical protein PG0319 [Porphyromonas gingivalis W83]
    MNFQRVKSYFKKNRTMKRIVFVMIALLIGIGVATAQNAKKAVISSDNVEHDFGTIKEADGSVTHTFVIKNTGDAPLVITR
    VVAS
    CGCTTPQFSKEPIAPGQTSKIDVTYNPAGRPGQFVKTIAVYSNGKDGTFTLRIKGVVE

    >gi|34540156|ref|NP_904635.1| hypothetical protein PG0320 [Porphyromonas gingivalis W83]
    MIVSTFRGLLFFLFLLTPLLLTAQESPEIQVEEQSFNFGLIPEEKGSVGHSFKFRNSGTAPLLITRVMADCGCTTPTWPE
    EAIAPGEEAEIRVLFDPVGRSGAFVKRIRVFSNAQSSPLELSISGTVTTLSGAIPHAYVLAIGPLQVSNARLLFPISMPE
    DEGVVRLVVNNTDESDLQVAVVSLPSFVSLDDRAFRLQAREPRELNLSLAVPRNMPPGMKDEPLVLEVTSPETGKKAVDS
    VMVSLPLVDNFPALTAAQTGVMELSTYLDMGQLDGETTKAAIEIRNVGAGPLRLHSVTTRNPALTAVPDRTEIKPGGSTL
    LRIAVDPQVMKAEGWQSIAADISIICNDPQAPLRRIKVKAEL

    >gi|34540302|ref|NP_904781.1| methylated-DNA--protein-cysteine S-methyltransferase [Porphyromonas gingivalis W83]
    MIKYSMETICIQHYQSPCGDLILGSYGHQLCMCDWVHKERKEIIDMGLQKRLCSSYEIALSPVLKETIAQLDEYFSHKRE
    TFDIPLLMAGTEFQQTVWGELLNIPYGTTISYATLARRIGNPKAVRAVARANGANPISILVP
    CHRVIGSDNTLTGYGGGL
    DKKEFLLRHEMSLPV

    >gi|34540424|ref|NP_904903.1| alkyl hydroperoxide reductase, C subunit [Porphyromonas gingivalis W83]
    MTPILNTVFPEFKLNAYHNGEFKVITNEDLKGKWSLVVFYPGDFTFVCPTELEDLANKYEEFKQLGVEVYSCSCDTHFVH
    KAWADASPAIKKVQYPMLADPSGALTRDLGILIDDVHMAYRGSFVINPEGIIKIVELNDNSVGRDAEEILRKIKAAQYVA
    AHDGQVCPAKWREGQQTLKPSIDLVGKI

    >gi|34540425|ref|NP_904904.1| alkyl hydroperoxide reductase, F subunit [Porphyromonas gingivalis W83]
    MLDKDTLAQVGSYFAQLKKSYTLRLNAHTSHPSYNEAKEMLDGLASVSDHVRAEYNAADDFRIDLLVDGADSGIGFRGIP
    GGHEFSSLLLAILNNDGIGRNIPDEGVQDRIRRINGPIELKTYVSLS
    CTNCPDVVQTLNMIAILNPTINHTMVDGSFFPD
    EVESLGIASVPTVMAGDEVIHVGRGDMAALLNKIEAKYGSVPAESADKTLRPFDLLVVGGGPAGSAAAIYSARKGLKVAI
    VAERVGGQVNETVGIENLISVPYTTGSELASNLNSHIKANTISLFEARTVSSITQQEGISRVEVTSGEVFTAPALIMATG
    ASWRKLGVPGEKEYTGNGVAY
    CAHCDGPFFKGKRVAVVGGGNSGLEAAIDLAGICEHVTVVEFLDVLRADEVLQKKARET
    ANIDILLSTATKEIMGNGQKVEGILLTDRNTGEEKQIALSGVFVQIGLAANTSLVKDLVETNSRGEVLIDTSCRTNTPGI
    YAAGDCTTVPYKQIVIAMGEGAKAALSAFEDRIRG

    >gi|34540491|ref|NP_904970.1| putative lipoprotein [Porphyromonas gingivalis W83]
    MYPVMYRRFCMTIGMVALFGSITSFAASCSQQPNKIEQPTDSITSNVSVQEPELAFPLPEIPLSITSPRERALYFVKHYW
    DEFNFMDSAYLEKPQNMEVSIANFLGVAIALPVDEVKSSIIYPLEKSSGALLELFIKFYKKYLYEPNSPMLNEEYYIPAV
    AFLMKSPKVSFAERIRLKERYELMLRNRIGTKAEDFIYEQTNGSLHRLSSRFTLNTILVFYEPG
    CHTCSELIRQLHQDDW
    LRNLVESKQLSILFIYPDNDKNAWVAGLSDFPDFVEVGINSDSSITDRQLYDIKASPTIYLLDNHGYVILKDVQIGVIKE
    YLKEKKE

    >gi|34540584|ref|NP_905063.1| alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase [Porphyromonas gingivalis W83]
    MRYDLAIIGGGPAGYTAAERAAKGGLKTLLIEKNALGGVCLNEGCIPTKTLLYSAKVLHQIATASKYAVSGTADGLDLGK
    VIARKGKIIRKLTAGIRSRLTEAGVEMVTAEATVTGCDADGIIGITAGEAQYKAANLLL
    CTGSETFIPPIPGVEQTEYWT
    NREALQNKEIPTSLVIIGGGVIGMEFASFFNGIGTQVHVVEMLPEILNGIDPEHAAMLRAHYEKEGIKFYLGHKVTSVRN
    GAVTVEYEGESKEIEGERILMSVGRRPVLQGFESLGLVLAGKGVKTNERMQTSLPNVYAAGDITGFSLLAHTAVREAEVA
    VDQILGKTDETMSYRAVPGVVYTNPEVAGVGETEESLRKAGRAYTVRRLPMAFSGRFVAENEQGNGECKLLLDEENRLIG
    AHLIGNPAGELIVTAAMAIETGMTDRQIERIIFPHPTVGEILKETLAGG

    >gi|34540648|ref|NP_905127.1| bacterioferritin comigratory protein [Porphyromonas gingivalis W83]
    MTFLLPLFDIIQTDGAMIQIGDRIPEILGIDQDGNEVKRDDYRGRKIALYFYPKDNTSGCTAQACSLRDSHSTLRAAGYE
    IIGVSRDSAKSHRNFREKYELPFPLIVDEEVRLNELFGVWVEKSMYGRKYMGTERTTFLTDKEGVVTRIIRGKEVKTKDH
    ADQILNG

    >gi|34540820|ref|NP_905299.1| thioredoxin family protein [Porphyromonas gingivalis W83]
    MLLAGLTSCQQKGYTITGTVDSTLNLDGNMVYIQLSQGNNLDSTTIRNGAFTFTGEHIDTAKLAYIVTASPEHNVVPIIF
    ILEDGKISAKIGEYAAKGTPLNEENFKYSAKINELENSFKLKMEEIQADTARAAEETQAMLEKEYTAMLGEKSKITTELY
    QSHTNDALGARLLQNILYGEGSDSDVIAEARKKAGPIVLAHPNIVHLLAMIDNLADTQPGKMAKNFAGTDAEGNEVELFK
    YVGQGNYAVVDFWASW
    CGPCRREIPYIAEANAKFAEKGLQVVGIVVWDKMEDHLKAKEALNVVWPQIFDAKNVATDMYGI
    QGIPQVILFGPDGTIIERDLRGEKLIEKLSEIYNSNKK

    >gi|34540863|ref|NP_905342.1| thioredoxin reductase [Porphyromonas gingivalis W83]
    MSEHARCLIIGSGPAGYTAAIYASRANLNPILYEGIQPGGQLTTTTEVENFPGYPEGITGTELMEDLRKQATRFGADIRS
    GIATKADLSKAPYRITIDGEKEITADTLIISTGATAKYLGLADEAKYAGMGVSA
    CATCDGFFYRKKKVAVVGGGDTACEE
    ALYLASLAEHVYLIVRKNYLRASKVMQERVMNTANITVLFEHNTVGLFGENGVEGAHLVKRKGEPDEEMVDIAIDGFFLA
    IGHTPNSKIFADYLDLDEVGYILTEGSSPRTKVPGVFAAGDVADPHYRQAITAAGSGCKAAIEAERYLGEHGL

    >gi|34541223|ref|NP_905702.1| rhodanese-like domain-containing protein [Porphyromonas gingivalis W83]
    MSKQSVKKIISFSLTIIIAIVMLGLLKNLFSQSDDKALSEAIRNGAFLVDVRTPGEFASGSVAGAVNIPLDRIASRLNEL
    KNKKTIIVF
    CRSGNRSSQAKSILERNGFSNVLDGGTWGHVASLKGDQ

    >gi|34541224|ref|NP_905703.1| metallo-beta-lactamase superfamily protein [Porphyromonas gingivalis W83]
    MKVEQIYTGCLAQGAYYITSMGEAAIIDPLREITPYLERLKRDGVKLKYILETHFHADFVSGHLDLSRATGAPIVYGPTA
    KPGFDAIVAEDNQIFELGNVKIRVLHTPGHTMESSCFLLIDENGREAALFSGDTLFLGDVGRPDLAQKAANLTQEELAGL
    LYDSLYTKILPLSDDIIVYPAHGAGSACGKNMMQETVDSLGNQKRVNYALNQPGKEAFIASVIEGLLPPPAYFGGNVAMN
    KMGYDSIDNVMERGLSALSATDFEAIAKTSDALVLDTRAPGVFAQGFIPRSINIGLDGDFAPWVGTMIVDVKQPLLLVAD
    PGREQEVITRLSRVGFDQVLGYLDGGFDTWNASGKEIDHVECITANEFAERFCPEESLVFDVRKESEYAAEHVEGAYSRP
    LAYINDWIQDIPRDRHFYLH
    CIGGYRSMIASSILLSRGYRNFTDIEGGFASIAQTGVPKTDYVCQSKVSKK

    >gi|34541283|ref|NP_905762.1| thioredoxin family protein [Porphyromonas gingivalis W83]
    MEYAADGDTVFLESIENMEVTRLDSAIIRNGTFSFKGRQDSTVARYLSCMTATDVFSIPFFLENGHIEVKMKSGNESVTG
    TPTNDIYQEIRSKMAEIMNKMNEIYSDSTLTEELAEEKMDQMEREYTIAQKEAVKKNIANPVGVFLFKEQYFENSLAENQ
    ALFRQIPPKYLNDPVLMGMQKQMESQEKTDMNTPFTDFTMQTPEGKTVKLSDYVGKGKLVLVDFWASW
    CGPCRQAMPDLI
    KVYADYKGKLEIVGVSLDENPGAWKKAIARLGITWPQMSDYKGWASPAAMQYGVHSIPHTLLIDNDGTIIGRNLHGEELT
    DKLSAALR

    >gi|34541337|ref|NP_905816.1| thiol:disulfide interchange protein dsbD, putative [Porphyromonas gingivalis W83]
    MTNKNHRNSKWTVALALLFLSMLPIGASAQIIKDVVVWKTSLQDSDTPEKTLVFTATIKPGWHLYDQNLPEDGPTSTEFL
    FDKMTGAKLVGKAIPDKAPVNRYDKQFEMDLRWYEKTVSFRQKIQVTDPAKFSIKGGVRFMACNDENCLPPETSDFSFDA
    SMIKSKAAAPDTEAEAAEAVAAETAADTTSQTDAAEALSSKADLWTPVVSELRAYGDDTLKQAESAPWKIFLYGFLYGFV
    ALLTPCVWPMIPMTVSFFLKRNKDKKKAVRDAFTYGASIIVIYVVLGLLITGIFGVNSLNSLATNAVFNIIFFLLLVVFA
    ISFFGAFELVLPSSWTNKLDSKADSTTGLLSIFFMAFTLALVSFSCTGPIIGTLLVQAATAGSKLAPAMGMLGFATSLAL
    PFTLFAVFPSWLQGMPKSGGWLNMVKVVLGFLELALALKFLSVADLAYGWHILDRETFLALWIVIFALLGCYLLGWIRFS
    HDSEWPHLSVPRFMMATVSLAFAVYMIPGLWGAPLKAVSAFAPPLHTQDFNLYSGEVHAHFTDYEAGMAFARQENKPVLL
    DFSGHG
    CVNCRKMENAVWIDPTVKSMLEKDYVLITLMVDEKKPLAEPLTIVFDGKEKTLRTVGDKWSYLQSHKFGANAQP
    FYVAIDHEGKPLSASYSYNEDVPLYVDFLKGGLQEFKKRKNK

    >gi|34541344|ref|NP_905823.1| putative lipoprotein [Porphyromonas gingivalis W83]
    MKQKLILAILLMSFVSLFSCACKNAAQTDTPADKSIVNNVNADRFRELLADPTIQLIDVRTAEEYAQGHIANAKLLPVTD
    SNFKEQADQELDKAHPVAIY
    CRSGGRSAKAADILLRRGYFVYNLLGGYKGYPYK

    >gi|34541358|ref|NP_905837.1| thiol peroxidase [Porphyromonas gingivalis W83]
    MSLKIFLTALSVMATVTLQGKININTNGQLPGVGSVAPDFKAVRADLSEVSLSEFKGKRVVINIFPSIDTGVCAASVRRF
    NQEASSLDNTVVLCLSKDLPFAQARFCGAEGLDKVITVSAFRCDCFEKGYGLLMTDGPLKGLLARAVVVVDENGKIIYEE
    LVPEITQEPNYEAAIAALK

    >gi|34541377|ref|NP_905856.1| selenide, water dikinase [Porphyromonas gingivalis W83]
    MNRSSFDLLSTVEYGGCSAKLDPAKLSELLHDIPLPVDSRIMVDVSTHDDAGVYRLNDDTALIVTTDFFPPVCSDPYTFG
    RIAAANALSDVYAMGGRPLLVLNLTMFPSEGIPVEVLADILRGGQQTIDESGAFTMGGHTIDDPIPKYGLAVTGIVHPEH
    LVTNAGVRAGQCLVLTKPLGIGVAMAAHRLGLIGSEVYEAAIGQMCLLNRAGAELMQKYGIRGATDITGFGLLGHAKGLA
    EASDVCLHIDSRSVPVLPECLSLLRDGCIPGAAFRNLRFVGDMLRADCPTEYKMLLADAQTSGGLLMAVDADRAEDLVAD
    LHRTGLHPFAAIIGYATDAEDAAKLIVT

    >gi|34541493|ref|NP_905972.1| tRNA 2-selenouridine synthase [Porphyromonas gingivalis W83]
    MLIDTDFFLSNRSDSLVLDVRSPEEYRRGHIPGAESFPLFSDAERAEVGTLYVRHSRQAAVERGLEFVGPRMAEMVREAR
    SLAAGRDIILY
    CWRGGMRSESVAWLLSVAGLRIRRLRGGYKAYRRHFPDILKLYPWRFIVLGGYTGSGKTPILNELTQMG
    EQVIDLEGLAHHKGSAFGALGQEQQPTTEHFMNLLHDALSACDPNRPIWVESESKTIGRVFLPDDFYKVMRQAPLIELSV
    PRPVRIAHIAKEYGVYDAEALANSFEHIARRMGGAATTQAITALKEGRLEEAVSLALDYYDKAYAHSLAEFRESSSARLA
    VETDTPHETAIKLLELSHIKGLQS

    >gi|34541629|ref|NP_906108.1| thioredoxin family protein [Porphyromonas gingivalis W83]
    MLDMELESFLSMEKQGDISDAFLSAVKAEMQQMVLYAAGLAVRNIEETNRLRQKAKELYFYYLERYSPLAEMYKGSEMSL
    HNAGTATLRGHKNLAGGKRIDIGLWDGSKEFFHEYCYLPDDVQIRLFISKIQLLHFVVGAITTPQYVEKVALLGKVVGSS
    RYLELLRSFIDLNDPSGKNYSRGLFFYDHKFDKLEEVGKEVGENLPEVIKRFFPDKWVLVDVWATW
    CSPCKKEFGYNKQL
    HAFLEEKGIAMLYCSVDEPENSDNWRNNLSAFGLTGYHYYITSKAEKELLKIPDFRMLIPRYLLFDNKGKLVHANLPRPS
    SEKALYEEIEKLMQGN

    >gi|34541670|ref|NP_906149.1| bifunctional methionine sulfoxide reductase A/B protein [Porphyromonas gingivalis W83]
    MKYLSLILISMASFSFSLSAGSCSSSAKHNDSIPETKTIYFAGGCFWGTEHFFKQVRGVVATEVGYANGNVEDPSYEEVC
    SQTTGFAETVRVEYDPSELSLSLLLDLFFKTIDPTILNRQGNDVGSQYRTGIYYTDQEDLSLISSALSALATKYDRPIVV
    ENEPLKNFYPAENYHQDYLDHNPRGYCHIDPSLFELARKANPARFYKKADDAELRARLTPEQYAVTRNNATEPAFDNEYW
    NEFREGIYVDVTTGEPLFLSTDKFDSGCGWPSFSKPIGKELISERIDRSFGMTRTEVRSTTGDAHLGHLFNDGPLEKGGL
    RY
    CINSASLRFIPKEDMKKEGYGSLLPLLNKR

    >gi|34541746|ref|NP_906225.1| hypothetical protein PG2175 [Porphyromonas gingivalis W83]
    MKCFFIALIGLLFSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRL
    IAVSIDEGQNAQKVKPLADGNGWEYEVLLDSNGDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVK


    >gi|34541749|ref|NP_906228.1| Na(+)-translocating NADH-quinone reductase subunit E [Porphyromonas gingivalis W83]
    MDYISMFVRSIFVDNMVFAYYLGMCSFLAVSKNVKTSIGLGAAVTFILVCTLPINYLLQNYIFKAGALSWLGSQYAEVDL
    SFLSLIIFIAVIASFTQLVEMVVERFSPSLYASLGIFLPLIAVN
    CAILGGSLFMQQREFINVGMATVYGFGSGIGWMLAI
    VGMAAIREKLAYSNVPKPLRGLGITFIITGLMGIAFLSFSGVKL

    >gi|34541750|ref|NP_906229.1| Na(+)-translocating NADH-quinone reductase subunit D [Porphyromonas gingivalis W83]
    MSLWNKKNKEILLGPLSSNNPVIVQMLGICSALAVTAKLQPAIVMALSVTAVVAFANVIISLLRNTIPGRIRIIVQLVVV
    AALVTIVSQVLKAFAYDVNKQLSVFVGLIITN
    CILMGRLEAFALANRPWESFLDGIGNGLGYGWVLVIIAFFRELLGSGT
    LLDIKVIPKSFYESGYVNNGLMILPPMALITVAVVIWVHRARNKDLQEN