Porphyromonas gingivalis ATCC 33277 uid58879

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188993897|ref|YP_001928149.1| thioredoxin [Porphyromonas gingivalis ATCC 33277]
    MALQITDATFDGLVAEGKPMVVDFWATWCGPCRMVGPIIDELAAEYEGRAIIGKVDVDANTELPMKYGVRNIPTILFIKN
    GEVVKKLVGAQSKDVFKKELDALF

    >gi|188993981|ref|YP_001928233.1| Na(+)-translocating NADH-quinone reductase subunit D [Porphyromonas gingivalis ATCC 33277]
    MSLWNKKNKEILLGPLSSNNPVIVQMLGICSALAVTAKLQPAIVMALSVTAVIAFANVIISLLRNTIPGRIRIIVQLVVV
    AALVTIVSQVLKAFAYDVNKQLSVFVGLIITN
    CILMGRLEAFALANRPWESFLDGIGNGLGYGWVLVIIAFFRELLGSGT
    LLDIKVISKSFYESGYVNNGLMILPPMALITVAVVIWVHRARNKDLQEN

    >gi|188993982|ref|YP_001928234.1| Na(+)-translocating NADH-quinone reductase subunit E [Porphyromonas gingivalis ATCC 33277]
    MDYISMFVRSIFVDNMVFAYYLGMCSFLAVSKNVKTSIGLGAAVTFILVCTLPINYLLQNYIFKAGALSWLGSQYAEVDL
    SFLSLIIFIAVIASFTQLVEMVVERFSPSLYASLGIFLPLIAVN
    CAILGGSLFMQQREFINVGMATVYGFGSGIGWMLAI
    VGMAAIREKLAYSNVPKPLRGLGITFIITGLMGIAFLSFSGVKL

    >gi|188993984|ref|YP_001928236.1| hypothetical protein PGN_0120 [Porphyromonas gingivalis ATCC 33277]
    MKCFFIALIGLLFSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQDVYADWQDETGVRL
    IAVSIDEGQNAQKVKPLADGNGWEYEVLLDSNGDFKRAMNVSLIPAVFIVDGNGKVVYNHTGYTEGGEAELIKKVRELMK


    >gi|188994004|ref|YP_001928256.1| peptide methionine sulfoxide reductase [Porphyromonas gingivalis ATCC 33277]
    MKYLSLILISMASFSFSLSAGSCSPSAKHNDSIPETKTIYFAGGCFWGTEHFFKQVRGVVATEVGYANGNVEDPSYEEVC
    SQTTGFAETVRVEYDPSEVSLSLLLDLFFKTIDPTILNRQGNDVGSQYRTGIYYTDQEDLSLISSALSALATKYDQPIVV
    ENEPLKNFYPAENYHQDYLDHNPRGYCHIDPSLFELARKANPARFYKKADDAELRARLTPEQYAVTRNNATEPAFDNEYW
    NEFREGIYVDVTTGEPLFLSTDKFDSGCGWPSFSKPIGKELISERIDRSFGMTRTEVRSTTGDAHLGHLFNDGPLEKGGL
    RY
    CINSASLRFIPKEDMKKEGYGSLLPLLNKR

    >gi|188994149|ref|YP_001928401.1| pyridine nucleotide-disulphide oxidoreductase [Porphyromonas gingivalis ATCC 33277]
    MFAPEKRTKKKSNMRYVIVGGVAGGATAAARLRRIDEKAEIILFEKGQNISYANCGLPYYIGGVIKERENLFVQTPEKFG
    RLLNLDVRVQSEVLSIDRSDKQIRVREANGREYSEHYDKLLLSPGALPFVPPLPGVDSPGVFTLRNVEDTDAIKSYLDTH
    KVKRAIVVGGGFIGLEMAENLHARGIAVNVIEMAPQVMAPVDFSMATIVHAHLQEKGIGLYLGKAVKSIEKRGEVLTASL
    DSGEKIEAELILLSIGVRPNTKLAADAQLAIGPARGIQVNEYLQTSDPDIYAIGDAIEYPHPLTGKPWTNFLAGPANRQG
    RIVADNMHGQTLRSYEGAIGTAIAKIFDLTVAATGLPAKALKREGLPYESVTVQPNSHAGYYPNAYPLTLKITFHPESGM
    LYGAQCVGIEGVDKRIDSIAQIIKRKGGIADLMQTEQAYAPPFSSAKDPVALAGYVADNIITGRMKPLHWREMKEVDPNR
    VTLIDARPRQAYEVEHIPGAISMPVEEIRARIGEIPHDKPIYVY
    CTVGMRGYFASNILRQCGFSNVRNLIGGYRLYSTIT
    ADYSSAAKPTIAQLPAKDSPSSHTQVPEVDACGMSCPGPILKLKQSIDQIAVGEQLCILATDPGFARDAQAWCDTTGHNL
    IRQETIKGQYKVTIEKTACKEEGTCVSETPSKGKTFILFSDDLDKALATFVLANGAAAMGQPVTIFFTFWGLNAIKKPHA
    VKAKKDIWGKMFGMMLPKNSKGLGLSKMNMFGLGAKMMRMVMKEKHVDSLESMRKQALENGVEFIACQMSMDVMGINREE
    LLDEVSIGGVATYMNRAEEANINLFI

    >gi|188994237|ref|YP_001928489.1| putative thioredoxin [Porphyromonas gingivalis ATCC 33277]
    MKKNICSKAILLASLFLLSVGTMTASCTSKNDTRQEETVSAESKGEKDGKIIHITAEYMREHIYDYTANPQEWVYKGDKP
    AIIDFYADW
    CGPCRSLSPKLEEVAKKYAGKLTVYKVDVDKEKELAGIFGVRSIPMVLFVPVKGIPTQTMGNLPMENIEEA
    IAKIMQSDL

    >gi|188994252|ref|YP_001928504.1| putative thiol peroxidase [Porphyromonas gingivalis ATCC 33277]
    MSLKIFLTALSVMATVTLQGKININTNGQLPGVGSVAPDFKAVKADLSEVSLSEFKGKRVVINIFPSIDTGVCAASVRRF
    NQEASSLDNTVVLCLSKDLPFAQARFCGAEGLDKVITVSAFRCDCFEKGYGLLMTDGPLKGLLARAVVVVDENGKIIYEE
    LVPEITQEPNYEAAIAALK

    >gi|188994268|ref|YP_001928520.1| hypothetical protein PGN_0404 [Porphyromonas gingivalis ATCC 33277]
    MKQKLILAILLMSFVSLFSCACKNAAQTNTPADKSIVNNVNADRFRELLADPAIQLIDVRTAEEYAQGHIANAKLLPVTD
    SNFKEQADQELDKAHPVAIY
    CRSGGRSAKAADILLRRGYFVYNLLGGYKGYPYK

    >gi|188994275|ref|YP_001928527.1| thiol-disulfide interchange protein [Porphyromonas gingivalis ATCC 33277]
    MTNKNHRNSKWTVALALLFLSMLPIGASAQIIKDVVVWKTSLQDSDTPEKTLVFTATIKPGWHLYDQNLPEDGPTSTEFL
    FDKMTGAKLVGKAIPDKAPVNRYDKQFEMDLRWYEKTVSFRQKIQVTDPAKFSIKGGVRFMACNDENCLPPETSDFSFDA
    SMIKSKAAAPDTEAEAAEAVAAETAADTTSQTDAAEALSSKADLWTPVVSELRAYGDDTLKQAESAPWKIFLYGFLYGFV
    ALLTPCVWPMIPMTVSFFLKRNKDKKKAVRDAFTYGASIIVIYVVLGLLITGIFGVNSLNSLATNAVFNIIFFLLLVVFA
    ISFFGAFELVLPSSWTNKLDSKADSTTGLLSIFFMAFTLALVSFSCTGPIIGTLLVQAATAGSKLAPAMGMLGFATSLAL
    PFTLFAVFPSWLQGMPKSGGWLNMVKVVLGFLELALALKFLSVADLAYGWHILDRETFLALWIVIFALLGCYLLGWIRFS
    HDSEWPHLSVPRFMMATVSLAFAVYMIPGLWGAPLKAVSAFAPPLHTQDFNLYSGEVHAHFTDYEAGMAFARQENKPVLL
    DFSGHG
    CVNCRKMENAVWIDPTVKSMLEKDYVLITLMVDEKKPLAEPLTIVFDGKEKTLRTVGDKWSYLQSHKFGANAQP
    FYVAIDHEGKPLSASYSYNEDVPLYVDFLKGGLQEFKKRKNK

    >gi|188994352|ref|YP_001928604.1| hypothetical protein PGN_0488 [Porphyromonas gingivalis ATCC 33277]
    MKRINLLAATMKLTYIAIAATAITLLSASCSDKGKSGYKIVGTVEYAADGDTVFLESIENMEVTRLDSAIIRNGTFSFKG
    RQDSTVARYLSCMTATDVFSIPFFLENGHIEVKMKSGNESVTGTPTNDIYQEIRSKMAEIMNKMNEIYSDSTLTEEVAEE
    KMDQMEREYTIAQKEAVKKNIANPVGVFLFKEQYFENSLAENQALFRQIPPKYLNDPVLMGMQKQMESQEKTDMNTPFTD
    FTMQTPEGKTVKLSDYVGKGKLVLVDFWASW
    CGPCRQAMPDLIKVYADYKGKLEIVGVSLDENPGAWKKAIARLGITWPQ
    MSDNKGWASPAAMQYGVHSIPHTLLIDNDGTIIGRNLHGEELTDKLSAALL

    >gi|188994356|ref|YP_001928608.1| cation-transporting ATPase [Porphyromonas gingivalis ATCC 33277]
    MKEQKRFPVVGMRCAGCAHSVEQAASKVEGISDANVQLAENILSVSVDERLASAEDLRKAIRSIGFDLIVEDSEAEQLRR
    RDAMEAAELRRMKCDTIIAWSSAILLMLLMLMPHFQIMPYLMMLIALPGYTWAGRTFHRSALKQLRHGVFSMDTLVSLST
    TISFFYSLIVLLFFREGPAGMKLHLYFDASAMIIAFVLLGKLMEKRAGRSTGQAIRELMRLQPAEALVVRNGRETVMPIA
    ALVAGDFVRVRPGEQIPVDGIVTEGSSSVQESMISGEPLPREKEVGSMVFSGTINGSGVLTVQSTHVGSDTVLGRIIRTV
    REAQASKAPIQRLADRIAGIFVPIVIGLSILTYIIWQLTGAIDASVYGLLCAISVLVIACPCALGLATPTALVVGIGRSA
    RNGILVRNAEALERFATIDAVVLDKTGTLTIGKPEVTGIDWFVSDTDVPKVRRLLYSAEILSTHPLAAAICRAFAEDGRT
    EELSEVQNFPGRGIEFSFEGEIYRVGNQTFVEELGAQIPTDITALSEDAAVLYFSRAERLLGRFCVTDELQPQAAEVLAQ
    LHRHGIRTIMLTGDRPEAAEALARKLGLQDYRGGMMPSDKADYIRMLKDKGHHVAMVGDGINDSEALSTADVSVAMGDGS
    HIAIEVAGITLMRSDLRLLPAAFELSRATRRTVKENLFWAMCYNLIAIPIAAGLLFPVNGFLLNPAIAGAAMAFSSISVV
    TNSLRLRTKRLPLLR

    >gi|188994357|ref|YP_001928609.1| hypothetical protein PGN_0493 [Porphyromonas gingivalis ATCC 33277]
    MYKPKSKTKDHKKKLLVKMKTTTFSVEGMMCGGCAASVEKAALGVQGVQTAFASLDSHSLTVDYAPETTSPEAIMKAVRL
    AGFECKL

    >gi|188994403|ref|YP_001928655.1| metallo-beta-lactamase superfamily protein [Porphyromonas gingivalis ATCC 33277]
    MKIEQIYTGCLAQGAYYITSMGEAAIIDPLREITPYLERLKCDGVKLKYILETHFHADFVSGHLDLSRATGAPIVYGPTA
    KPGFDAIVAEDNQIFELGNVKIRVLHTPGHTMESSCFLLIDENGRETALFSGDTLFLGDVGRPDLAQKAANLTQEELAGL
    LYDSLYTKILPLSDDIIVYPAHGAGSACGKNMMQETVDSLGNQKRVNYALNQPSKEAFIASVIEGLLPPPAYFGGNVAMN
    KMGYDSIDNVMERGLSALSATDFEAIAETSDALVLDTRAPGVFAQGFIPRSINIGLDGDFAPWVGTMIVDVKQPLLLVAD
    PGREQEVITRLSRVGFDQVLGYLDGGFDTWNTSGKEIDHVECITANEFAERFCPEESLVFDVRKESEYAAEHVEGAYSRP
    LAYINDWIQDIPRDRHFYLH
    CIGGYRSMIASSILLSRGYRNFTDIEGGFASIAQTGVPKTDYVCQSKVSKK

    >gi|188994404|ref|YP_001928656.1| hypothetical protein PGN_0540 [Porphyromonas gingivalis ATCC 33277]
    MSKQSVKKIISFSLTIIIAIVMLGLLKNLFSQSDDKALSEAIRNGAFLVDVRTPGEFASGSVAGAVNIPLDRIASRLNEL
    KNKKTIIVF
    CRSGNRSSRAKSILERNGFSNVLDGGTWGHVASLKGDQ

    >gi|188994524|ref|YP_001928776.1| putative alkyl hydroperoxide reductase C subunit [Porphyromonas gingivalis ATCC 33277]
    MTPILNTVFPEFKLNAYHNGEFKVITNEDLKGKWSLVVFYPGDFTFVCPTELEDLANKYEEFKQLGVEVYSCSCDTHFVH
    KAWADASPAIKKVQYPMLADPSGALTRDLGILIDDVHMAYRGSFVINPEGIIKIVELNDNSVGRDAEEILRKIKAAQYVA
    AHDGQVCPAKWREGQQTLKPSIDLVGKI

    >gi|188994525|ref|YP_001928777.1| alkyl hydroperoxide reductase F subunit [Porphyromonas gingivalis ATCC 33277]
    MLDKDTLTQVGSYFAQLKKSYTLRLNAHTSHPSYNEAKEMLDGLASVSDHVRAEYNAADDFRIDLLVDGADSGIGFRGIP
    GGHEFSSLLLAILNNDGIGRNIPDGGVQDRIRRINGPIELKTYVSLS
    CTNCPDVVQTLNMIAILNPTINHTMVDGSFFPD
    EVESLGIASVPTVMAGDEVIHVGRGDMAALLNKIEAKYGSVPAESADKTLRPFDLLVVGGGPAGSAAAIYSARKGLKVAI
    IAERVGGQVNETVGIENLISVPYTTGSELASNLNSHIKANTISLFEARTVSSITQQEGISRVEVTSGEVFTAPSLIMATG
    ASWRKLGVPGEKEYTGNGVAY
    CAHCDGPFFKGKRVAVVGGGNSGLEAAIDLAGICEHVTVVEFLDVLRADEVLQKKARET
    ANIDILLSTATKEIMGNGQKVEGILLTDRNTGEEKQIALSGVFVQIGLAANTSLVKDLVETNSRGEVLIDTSCRTNTPGI
    YAAGDCTTVPYKQIVIAMGEGAKAALSAFEDRIRG

    >gi|188994596|ref|YP_001928848.1| hypothetical protein PGN_0732 [Porphyromonas gingivalis ATCC 33277]
    MYPVMYRRFCMTIGMVALFGSITSFAASCSQQPNKIEQPTDSITSNVSVQEPELAFPLPEIPLSITSPRERALYFVKHYW
    DEFNFMDSAYLEKPQNMEVSIANFLGVAIALPVDEVKSSIIYPLEKSSGALLELFIKFYKKYLYEPNSPMLNEEYYIPAV
    AFLMKSPKVSFAERIRLKERYELMLRNRIGTKAEDFIYEQSNGSLHRLSSRFTLNTILVFYEPG
    CHTCSELIRQLHQDDW
    LRNLVESKQLSILFIYPDNDKNAWVAGLSGFPDFVEVGINSDSSITDRQLYDIKASPTIYLLDNHGHVILKDVQIGVIKE
    YLKEKKE

    >gi|188994690|ref|YP_001928942.1| dihydrolipoamide dehydrogenase [Porphyromonas gingivalis ATCC 33277]
    MRYDLAIIGGGPAGYTAAERAAKGGLKTLLIEKNALGGVCLNEGCIPTKTLLYSAKVLHQIATASKYAVSGTADGLDLGK
    VIARKGKIIRKLTAGIRSRLTEAGVEMVTAEATVMGCDADGIIGITAGEAQYKAANLLL
    CTGSETFIPPIPGVEQTEYWT
    NREALQNKEIPTSLVIIGGGVIGMEFASFFNGIGTQVHVVEMLPEILNGIDPEHAAMLRAHYEKEGIKFYLGHKVTSVRN
    GAVTVEYEGETKEIEGERILMSVGRRPVLQGFESLGLELAGKGVKTNERMQTSLPNVYAAGDITGFSLLAHTAVREAEVA
    VDQILGKTDETMSYRAVPGVVYTNPEVAGVGETEESLRKAGRAYTVRRLPMAFSGRFVAENEQGNGECKLLLDEENRLIG
    AHLIGNPAGELIVTAAMAIETGMTDRQIERIIFPHPTVGEILKETLAGG

    >gi|188994922|ref|YP_001929174.1| putative bacterioferritin comigratory protein [Porphyromonas gingivalis ATCC 33277]
    MIQIGDRIPEILGIDQDGNEVKRDDYRGRKIALYFYPKDNTSGCTAQACSLRDGHSTLRAAGYEIIGVSRDSAKSHRNFR
    EKYELPFPLIVDEEVRLNELFGVWVEKSMYGRKYMGTERTTFLTDEEGVVTRIIRGKEVKTKDHADQILNG

    >gi|188995045|ref|YP_001929297.1| probable thiol:disulfide oxidoreductase [Porphyromonas gingivalis ATCC 33277]
    MKKLLFAAAVLLAGLTSCQQKGYTITGTVDSTLNLDGNMVYIQLSQGNNLDSTTIRNGAFTFTGEHIDTAKLAYIVTASP
    EHNVVPIIFILEDGKISAKIGEYAAKGTPLNEENFKYSAKINELENSFKLKMEEIQADTARAAEETQAMLEKEYTAMLGE
    KSKITTELYQSHTNDALGARLLQNILYGEGSDSDVIAEARKKAGPIVLAHPNIVHLLAMIDNLADTQPGKMAKNFAGTDA
    EGNEVELFKYVGQGNYAVVDFWASW
    CGPCRREIPYIAEANAKFAEKGLQVVGIVVWDKMEDHLKAKEALNVVWPQIFDAK
    NVATDMYGIQGIPQVILFGPDGTIIERDIRGEKLIEKLSEIYNSNKK

    >gi|188995096|ref|YP_001929348.1| thioredoxin reductase [Porphyromonas gingivalis ATCC 33277]
    MSEHARCLIIGSGPAGYTAAIYASRANLNPILYEGIQPGGQLTTTTEVENFPGYPEGITGTELMEDLRKQATRFGADIRS
    GIATKADLSKAPYRITIDGEKEITADTLIISTGATAKYLGLADEAKYAGMGVSA
    CATCDGFFYRKKKVAVVGGGDTACEE
    ALYLASLAEHVYLIVRKNYLRASKVMQERVMNTANITVLFEHNTVGLFGENGVEGAHLVKRKGEPDEEMVDIAIDGFFLA
    IGHTPNSKIFADYLDLDEVGYILTEGSSPRTKVPGVFAAGDVADPHYRQAITAAGSGCKAAIEAERYLGEHGL

    >gi|188995348|ref|YP_001929600.1| putative methylated-DNA-protein-cysteine methyltransferase [Porphyromonas gingivalis ATCC 33277]
    METIRIQHYQSPCGDLILGSYGHQLCMCDWAHKERKEIIDTGLQKRLCSSYEIALSPVLKETIAQLDEYFSHKRETFDIP
    LLMAGTEFQQTVWGELLNIPYGTTISYATLARRIGNPKAVRAVARANGANPISILVP
    CHRVIGSDNTLTGYGGGLDKKEF
    LLRHEMSLPV

    >gi|188995506|ref|YP_001929758.1| hypothetical protein PGN_1642 [Porphyromonas gingivalis ATCC 33277]
    MIVSTFRGLLFFLFLLTPLLLTAQESPEIQVEEQSFNFGLIPEEKGSVGHSFKFRNSGTAPLLITRVTADCGCTTPTWPE
    EAIAPGEEAEIRVLFDPVGRSGAFVKRIRVFSNAPSSPLELSISGTVTTLGGAIPHAYVLAIGPLQVSNARLLFPISMPE
    DEGVVRLVVNNTDESDLQVAVVSLPSFVSLDDRAFRLQAREPRELNLSLAVLRNMPPGMKDEPLVLEVTSPETGIKAVDS
    VLVSLPLVDNFLALTAAQTGVMELSTYLDMGQLDGETTKAAIEIRNVGAGPLRLHSVTTRNPALTAVPDRTEIKPGGSTL
    LRIAVDPQVMKAEGWQSIAADISIICNDPQAPLRRIKVKAEL

    >gi|188995507|ref|YP_001929759.1| hypothetical protein PGN_1643 [Porphyromonas gingivalis ATCC 33277]
    MKRIVFVMIALLIGIGVATAQNAKKAVISSDNVEHDFGTIKEADGSVTHTFVIKNTGDAPLVITRVVASCGCTTPQFSKE
    PIAPGQTSKIDVTYNPAGRPGQFVKTIAVYSNGKDGTFTLRIKGVVE

    >gi|188995518|ref|YP_001929770.1| putative electron transport complex RnfABCDGE type A subunit [Porphyromonas gingivalis ATCC 33277]
    MEFFMLFIAAVFVNNVVLSQFLGICPFLGVSKKVDTSIGMGAAVTFVLALATLVTFLIQKFVLDRFGLGFMQTIAFILVI
    AALVQMVEIILKKVSPPLYQALGVFLPLITTN
    CCVLGVAILVIQKDYTLLQSFVYAISTAIGFTLAMVTFAGIREQLDMT
    NLPKAMKGIPSALLAAGILAMAFMGFSGIA

    >gi|188995519|ref|YP_001929771.1| electron transport complex RsxE subunit [Porphyromonas gingivalis ATCC 33277]
    MSKNLSVIINGIIKENPTFVLLLGMCPTLATTTSAINGMSMGLATMFVLICSNMVVSLVKNLIPDMVRIPAFIVIIAGFV
    TILQMLIKAYMPDLDKSLGIFIPLIVVN
    CIVLGRAEAVASKKGLLHSMFDGIGIGLGFTLSLTVLGIVRELLGSGKLFDF
    AVFNESYGALIFVLAPGAFIALGYLIALVNKMKKKA

    >gi|188995557|ref|YP_001929809.1| selenide water dikinase [Porphyromonas gingivalis ATCC 33277]
    MNRSSFDLLSTVEYGGCSAKLDPAKLSELLHDIPLPVDSRIMVDVSTHDDAGVYRLNDDTALIVTTDFFPPVCSDPYTFG
    RIAAANALSDVYAMGGRPLLVLNLTMFPSEGIPVEVLADILRGGQQTIDESGAFTMGGHTIDDPIPKYGLAVTGIVHPEH
    LVTNAGVRAGQCLVLTKPLGIGVAMAAHRLGLIGSEVYEAAIGQMCLLNRAGAELMQKYGIRGATDITGFGLLGHAKELA
    EASDVCLHIDSRSVPVLPECLSLLRDGCIPGATFRNLRFVGDMLRADCPTEYKMLLADAQTSGGLLMAVDADRAEDLVAD
    LHRTGLHPFAAIIGYATDAEDAAKLIVT

    >gi|188995851|ref|YP_001930103.1| hypothetical protein PGN_1988 [Porphyromonas gingivalis ATCC 33277]
    MMKPSLFLTLVAVFFMATIKGLAKPQIDKEVDPITKLTLRNPQNGGSGVLWTNIPCSADSDLAGLVTPIFFENGEVTISI
    PLKRSVCIQFAGNQLFPKSKIILCPGDHLILTADNSSGKWSFGATGDNASGNLYLLDSTLFAGYRWLNEYLTILRTGKGK
    AELIDQVDSMLDMELESFLSMEKQGDISDAFLSAVKAEMQQMVLYAAGLAVRNIEEANRLRQKAKELYFYYLERYSPLAE
    MYKGSEMSLRNAGTATLRGHKNLAGGKRIDIGLWDGSKEFFHEYCYLPDDVQIRLFISKIQLLHFVVGAITTPQYVEKVA
    LLGKVVGSSRYLELLRSFIDLNDPSGKNYSRGLFFYDHKFDKLEEVGKEVGENLPEVIKRFFPDKWVLVDVWATW
    CSPCK
    KEFGYNKQLHAFLEEKGIAMLYCSVDEPENSDNWRNNLSAFDLTGYHYYITSKAEKELLKIPDFRMLIPRYLLFDNKGKL
    VHANLPRPSSEKALYEEIEKLMQGN

    >gi|188995678|ref|YP_001929930.1| tRNA 2-selenouridine synthase [Porphyromonas gingivalis ATCC 33277]
    MLIDTDFFLSNRSDSLVLDVRSPEEYRRGHIPSAESFPLFSDAERAEVGTLYVRHSRQAAVERGLEFVGPRMAEMVREAR
    SLAAGRDIILY
    CWRGGMRSESVAWLLSVAGLRIRRLRGGYKAYRRHFPDILKLYPWRFIVLGGYTGSGKTPILNELSQMG
    EQVIDLEGLANHKGSAFGALGQEQQPTTEHFMNLLHDAVSACDPGRPIWVESESKTIGRVFLPDDFYKVMRQAPLIELSV
    PRPVRIAHIAKEYGVYDAEALANSFEHIARRMGGAATTQAIKALKEGRLEEAVSLALDYYDKAYAHSLAEFRESSSARLA
    VETDTPHETAIKLLELSHIKGLQS