Azotobacter vinelandii DJ uid57597

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226942262|ref|YP_002797335.1| Electron transport protein SCO1/SenC [Azotobacter vinelandii DJ]
    MTRIQKTVLILVALIAIVLGLTFSKVLNGPRQADSAQLLEAGIVLLPQGRPLPALSLTDQDGQPVALQSLTGKWSLVFFG
    YTF
    CPDICPTTLAQLRQLESQLPPATRERLQVVMVSVDPQRDTPAQLKQYLAFFDPDYRGLTGELADIQRLANTLGIPFI
    PGDPSRENYTVDHSGNLALLGPDGTQRGFVRAPLNVAKLAERLPLLVETQP

    >gi|226942326|ref|YP_002797399.1| Nitrogen fixation Fe-S cluster assembly protein IscAnif [Azotobacter vinelandii DJ]
    MITLTESAKSAVTRFISSTGKPIAGLRIRVEGGGCSGLKYSLKLEEAGAEDDQLVDCDGITLLIDSASAPLLDGVTMDFV
    ESMEGSGFTFVNPNATNSCGCGKSFAC

    >gi|226942344|ref|YP_002797417.1| OsmC-like protein [Azotobacter vinelandii DJ]
    MKRTGSAVWQGNLKEGKGSVSTQSGVLKEQPYGFNTRFEDQPGTNPEELIGAAHAGCFSMALAKLLGDAGLTPERLETRA
    DVTLEKQGEGFAITVIDLTLKARVPGATSERFNEIANQAKAG
    CPVSKLLNAQINLKATLEG

    >gi|226942358|ref|YP_002797431.1| YeeE/YedE family protein [Azotobacter vinelandii DJ]
    MHIDWAHFTPWTALAGGALIGLAASLFVVLNGRIAGISGLLGSLLQRDSDGRDEKALFLLGLLAAPLLWSLFGALPKAEF
    RTGWFGLAIAGVLVGLGSRYGSG
    CTSGHGVCGISRLSPRSMVATLVFMSGGFATVFVLHHLWGG

    >gi|226942362|ref|YP_002797435.1| Thiol:disulfide interchange protein DsbA [Azotobacter vinelandii DJ]
    MRKLILGAILAGTSLFALGTQAESLSPADIKIGRQYVELPTHVPVAQPGKIEVVELFWYGCPHCYQFEPSINAWAGKLPE
    DVSFRRVPALFGGLWNIHGQLFLTLEAMGVEPKVHTAIFDAIHKDGKKLATPEEMAEFLAGHGIDKDAFLKAYGSFNVKS
    QMEKAKKLAIAYQISGVPVMVVNGKYRFDLGSAGGPENTLQVADYLIEQERSAQ

    >gi|226942433|ref|YP_002797506.1| Molybdopterin biosynthesis protein, MoeB [Azotobacter vinelandii DJ]
    MDLSKREINRYSRHLLLPEVGLEGQSRLKRAKVLCVGTGGLGSPLALYLAAAGVGRLGLVDSDVVDYSNLQRQVIHHTAD
    IGKPKITSAAEKLRDLNPDIEIVKHETMLTAENAFDICSRYDIVADGTDNFSTRYLINDVCVLLGKPNVHASIFRFEGQA
    SVFYAKEGPCYRCLYPEPPPPGEIPG
    CAEGGVLGVLPGLLGVVQATEVIKRILGIGDPLVGRLLMFDALGMRTSELRIEK
    DPDCPLCGTSPSITGLQDYQAFCGALAPGGGARAEIAAGEAAVWLGRPGDVLLLDVREPHEWDICRIAGAVHVPLGELAA
    RCGELDPAKDIIVY
    CLMGARGRKALEILEGQGFHRVWNLRGGLRAWVAEVDGTLPLY

    >gi|226942606|ref|YP_002797679.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Azotobacter vinelandii DJ]
    MKIVIIGNGPAAISAAETLRARDRGCEIVMLSRERVPFYSPCPLAEYVEGSVSRERLFLRDADFYARNAIDIRYGSPVRR
    IEPSARRVWSGDEAVAYDRLLIASGSRAFVPPIPGLAGARGVFELKTLDDAEGILRRLAVARRAVVVGSGFIGLEATQAL
    VRHGLEVTLLEAREHVLPAMLDSEMAALVERRLVEHGVRVRTGCAVERVLEGADGVRAVIADGDEIPCELLVCAAGVRAD
    LSILEGSGIASERGILVDARMRTNVEHIFAAGDIIERPDAPEKNRVAPNWPNAVSSGRIAACNMLGIDRRHPGLEAVNVV
    RVFDMPIASFGVQTGETCLRWQDGAGAVRKVLLESGRVAGGQLIGEINGAGVLHEMMKKGTAVERFGTHLVHPGFGYIHT
    MEPLRAVKWA

    >gi|226942625|ref|YP_002797698.1| Dithiol-glutaredoxin protein [Azotobacter vinelandii DJ]
    MPHIVIYTSAWCPYCIRAKQLLDRKGVAYREIGVDGKPELRAEMTRKAGRTSVPQIWIGDTHVGGCDDLHALERAGRLDA
    LLED

    >gi|226942749|ref|YP_002797822.1| disulfide isomerase/thiol-disulfide oxidase [Azotobacter vinelandii DJ]
    MMRFERLPLLLAGLGLLGLSAAASRAEELPAPIQAAKARGAEIIGTFEAPGGLKGYAARYDGQGMALYLTPDGQHVLIGN
    LLDARGQDLTGPRLEELVYAPLGKEMWARMERSGWIADGSAAAPRIVYLFSDPN
    CPYCTRFWQQARPWVEAGKVQLRHIM
    VGILRADSAGKAAALLAAERPEQALHEHESAGKASTLEALAEIPPRIGERLEDNLELMNALGAMATPAIFYLDARDRLQQ
    QQGAPDAAALAQIMGPR

    >gi|226942820|ref|YP_002797893.1| Thioredoxin protein [Azotobacter vinelandii DJ]
    MSEIPYIFDVTDASFDQLVLENSFHKPVLVDFWAEWCAPCKALMPLLAKIAESYQGELLLAKVNSDIEQQTVMRMGIRSL
    PTVVLFKDGQPVDGFAGAQPESAIRAMLEPHVQMPEAPEADPLEVAQALFAAGRIGETENLLAALLSEDNGNGAALILYA
    RCLAERGELGEAEAVLDAVTGDEHKQALAGARAQLTFLRQAADLPEVAILKSRLAQDANDDEAAYQLAIQQLARQHYEAA
    LEGLLRLFVRNRGYAEGLPHKTLLQVFDLLGSDHPLVSTYRRKLYQALY

    >gi|226942850|ref|YP_002797923.1| thiol:disulfide interchange protein precursor [Azotobacter vinelandii DJ]
    MGGIPGQRGTAPACDQGGACQAACGLQRLAASGIIRPLCISARFCENAMRRLLLPLFLLLLALPAAAGLFDNRPGAALGG
    LDNRGDFLPVREAFRLSLVDATPQAVKLRFVAAEGYYLYRQRLQFRSETLGVAPGEPRLPDGTRKTDEYFGETEVYYGVL
    DVELPVANPDGRPFYLQVGYQGCADKGLCYPPETERLQIGGTPAAGAASPADAPGWGWRELALFFLAGLGLTFTPCVLPM
    LPILSGVVLRGEIGGARGLALSLAYVLPMAACFAVLGALTGLFGAELNLQARLQSPWVLAPFAAFFGLFALAMFGVFELR
    LPPALAAPLERLAGNTRGGSLWGAAVLGVLSSLLVSPCVSAPLAGALLYISSSGDALGGGLKLFALGLGMGAPLVLFAAG
    GGALLPRSGPWMVVVRNAFGVLLLAVAVWLLERVLPGPLALALWGSLAGGVALFLGALEFTAKSHRQKLGQLAGLALLVY
    ALASWTGALRGESDPLRPLGGASLSAAPAARTAGAWQTLDTPEALDAALAEAKNAAQPLLLDWYADW
    CISCKVIEREVFA
    DPRVAAQLVGYRLIRFDITAGTPAQRALLDRYRLFGPPAIQFFAADGTEHERLRVVGEIDAAAFAQRLRESQSQR

    >gi|226942893|ref|YP_002797966.1| Rhodanese [Azotobacter vinelandii DJ]
    MDDFASLPLVIEPADLQARLSAPELILVDLTSAARYAEGHIPGARFVDPKRTQLGQPPAPGLQPPREQLESLFGELGHRP
    EAVYVVYDDEGGGWAGRFIWLLDVIGQQRYHYLNGGLTAWLAEDRPLSRELPAPAGGPVALSLHDEPTASRDYLLGRLGA
    ADLAIWDARSPQEYRGEKVLAAKGGHIPGAVNFEWTAAMDPSRALRIRTDIAGRLEELGITPDKEIVTH
    CQTHHRSGLTY
    LIAKALGYPRVKGYAGSWGEWGNHPDTPVEL

    >gi|226942932|ref|YP_002798005.1| bacterioferritin comigratory protein BcpB [Azotobacter vinelandii DJ]
    MPATSGESVDLSGAGTPWVVVYCYPRTGKPDQEPLGGTPAWNALPGARGCTPQSCAYRDHHAQLHALGASVYGLSAQDTE
    YQREAVERLHLPFRLLSDARLAFAEALRLPTFTVAGQVLIRRLTLIARAGRIKKVFYPVYPADSDAERVIAWLAARKR

    >gi|226943101|ref|YP_002798174.1| thioredoxin-like fold protein [Azotobacter vinelandii DJ]
    MAGFRQWKYGCWLMAIGKFKVLHTIVCQKMNGEKLLFCCFIAFLALVGNGVNANEYVEGRHYKTLSADIEGYQDKVVEFY
    NFA
    CVYCFRAEGGVAYLEQHLPENIQLTRLPLVLGKGERFNSAAYVGWIADELGYMEKYRHYLFQLARAPLPWEIKRYNR
    LSSMENVRTLFMDMGTDAKIYEAAVKSAKARIEITEALARQLKITSTPAFLVRGKYLVQGMRSKPFAEFMMADLILHLAI
    KP

    >gi|226943107|ref|YP_002798180.1| DSBA oxidoreductase [Azotobacter vinelandii DJ]
    MFLVVINSTSSAQEFIAGKDYYIIEPERLEYSGSIIEFFNYACMYCYRVETDIDRLYEHLPEKISFERIPVVMGKKYRYE
    PAAIASYILKFNGLESKYHKYMFQVIRSPLSWELKKYNRLSEKSYLQIFFEDLGLSAEKYQDSYIYAQKKLSDDRERFKT
    LALTGTPTFLVRGKYIVSGLRPEPYAERHLVNTLIYLLRLE

    >gi|226943108|ref|YP_002798181.1| disulfide bond formation protein [Azotobacter vinelandii DJ]
    MMLYFRFVSAGCSVIMIFSLCFAFYLEYYLLLEPCPLCIIQRVFFLLSALGLVAFVFWPKSYWLLSTILWLLVGAIVAGR
    HVWITYLPAESLGG
    CLPGLSYMIEAFPVIDSLQLIFSGSVDCAEVTWTLLSLSIPEWSLLIFTLILCVTLFLLYFYKLQI
    INQHE

    >gi|226943141|ref|YP_002798214.1| heavy metal transport/detoxification protein [Azotobacter vinelandii DJ]
    MQKFQVKGMSCGHCVRAVTQAVQALDAAAEVQVDLPGGEVRVASRLPAEQVMEAIREEGYEVAPA

    >gi|226943152|ref|YP_002798225.1| selenophosphate synthetase [Azotobacter vinelandii DJ]
    MSEPIRLTQYSHGAGCGCKIAPKVLEVILAGSGAQNLDPKLWVGNASRDDAAVYAIDEERGVVSTTDFFMPIVDDPFDFG
    RIAATNAISDIYAMGGDPLLAIAILGWPINKLPPEVAREVVAGGRAVCDAAGIPLAGGHSIDTPEPVFGLAVTGMVEKRF
    LKRNDTASAGCRLYLTKPLGIGILTTAEKRSRLRPQDVGVARDWMCTLNKPGSRFGKLAGVRAMTDVTGFGLLGHLVEMA
    DGSGLSACIEFAAVPRLPELDYYLEQGCVPGGTLRNFDSFGERIAPMPELCKLILCDPQTSGGLLVAVSPEGEAEFLACA
    AELGLALAPIGEMVERQRLAVEVLF

    >gi|226943523|ref|YP_002798596.1| Glutaredoxin4 protein [Azotobacter vinelandii DJ]
    MDIIETIKEQIASNGILLYMKGSPNAPQCGFSARAAQALMACGERFAYVDILQNPEIRANLPKYANWPTFPQLWVKGELI
    GGSDIILELFEKGELQQIVRGAADKADA

    >gi|226943580|ref|YP_002798653.1| Na(+)-translocating NADH-quinone reductase subunit D [Azotobacter vinelandii DJ]
    MAQPTIKEVLLNPIFSNNPIGLQILGICSALAVTSNLKTALVMAIGLTLVTACSSMFISMIRSQIPSSIRMIVQMVIIAS
    LVIVVDQLLKAFAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMQNPPALSFYDGIGNGLGYSVMLIVLGFFRELFGAGKLF
    GFTIIPVVNDGGWYQPNGLLLLPPSAFFLIGLIVWGLRTWRRDQVEKPAYRLAPQVSNKEAY

    >gi|226943581|ref|YP_002798654.1| Na(+)-translocating NADH-quinone reductase subunit E [Azotobacter vinelandii DJ]
    MEHYISLFVKSVFIENMALAFFLGMCTFIAISKKVETAIGLGIAVVVVQAITVPANNLLYAYLLKEGALAWAGLPDIDLS
    FLGFLSYIGVIAAIVQILEMLLDKYVPSLYNALGIYLPLITVN
    CAIMAGSLFMVERDYNFPESVVYGIGSGFSWALAIAL
    LAGIREKLKYSDVPEGLQGLGIAFITIGLMSLGFMSFSGIQL

    >gi|226943585|ref|YP_002798658.1| soluble pyridine nucleotide transhydrogenase [Azotobacter vinelandii DJ]
    MAVYNYDVVVIGTGPAGEGAAMNAVKAGRKVAVVDDRPQVGGNCTHLGTIPSKALRHSVRQIMQYNNNPLFRQIGEPRWF
    SFADVLKSAEQVIAKQVSSRTGYYARNRIDTFFGTASFCDEHTIEVVHLNGMVETLVAKQFVIATGSRPYRPADVDFTHP
    RIYDSDTILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSFLDDEISDSLSYHLRNNNVLIRHNEEYE
    RVEGLDNGVILHLKSGKKIKADAFLWSNGRTGNTDKLGLENIGLKANGRGQIQVDEHYRTEVSNIYAAGDVIGWPSLASA
    AYDQGRSAAGSITENDSWRFVDDVPTGIYTIPEISSVGKTERELTQAKVPYEVGKAFFKGMARAQIAVEKAGMLKILFHR
    ETLEILGVHCFGYQASEIVHIGQAIMNQKGEANTLKYFINTTFNYPTMAEAYRVAAYDGLNRLF

    >gi|226943646|ref|YP_002798719.1| organic hydroperoxide resistance protein (OsmC family) [Azotobacter vinelandii DJ]
    MQRIQALYTATATATGGRDGRAVSSDGVLDVKLTTPRELGGQGGEATNPEQLFAAGYSACFIGALKFVASQGKRQIPADT
    SITGKVGIGQIPGGFGLEVELDIHLPGLERSMAEELVAAAHQI
    CPYSNATRSNIEVRLNVAV

    >gi|226943661|ref|YP_002798734.1| methionine sulfoxide reductase B [Azotobacter vinelandii DJ]
    MDKLEKSLDVWRELLSDERFRICRLGGTERAFSGEYYATSVPGVYHCACCDAPLFDSDAKYDAGCGWPSYFQPVAASALT
    SRDDYSHGMHRIEVLCARCDAHLGHVFPDGPPPTGLRY
    CINSASLRLKPRDEG

    >gi|226943662|ref|YP_002798735.1| Glutathione peroxidase [Azotobacter vinelandii DJ]
    MRDPLFGIPLDDQPRTLADFPGRAWLVVNTASRCGFTPQYEGLQMLWQRYRERGLVVLGFPCDQFGHQEPGNELEIAEFC
    QLRYGVDFPLFQKVEVNGPRAHPLFVELKKRAPGLLGSQRVKWNFTKFLIGREGRVVRRFAPATGPRELCGEIEALLE

    >gi|226943966|ref|YP_002799039.1| heavy metal translocating P-type ATPase [Azotobacter vinelandii DJ]
    MQPLALPAEGPEVVRYRIDNMDCPVEERLIRGRLEAFPGIAGLDFDLLGRTLTVHHRLDSTASVEAQLRAIGMQARRLDA
    AAPSGSQATAEAPGQRWWPLALAGVSATLAEVVHWLNGGNHWLVVVLAVLAIVSGGLSTYRKGWIALRNRDLNINALMSI
    AVTGAMLIGEWPEAAMVMVLFALAEVIEARSLDRARDAIRGLLELAPDTATVLQADGEWRSVPARQVAVGATVRLRPGER
    IALDGVVTDGRSSVDQAPITGESLPVEKAEGDSVFAGTINQTGSFEYRVTAEAGQSTLSRIIHAVESAQAARAPTQRFID
    RFAQVYTPAIFLVALLTAVLPPLFADGAWTDWIYKALVLLVIACPCALVISTPVTIVSGLAAAARKGILIKGGVYLEEGR
    RLATLALDKTGTLTRGKPAQTDFVVWTGDEAPVRALAASLAARSDHPVSRAIAVAAEEAGLAIRPVDELQAIPGRGVRGR
    IDGHLYQLGNHRLVEELGLCSEAIEARLFALERQGKSVVVLVDEQDVLGIFAVADTLRDSSREAIGELHALGVKTLMLSG
    DNVHTAETIARSVGIDEARGGLLPEDKLRIVEGLREAAGKGTVGMVGDGINDAPALAKADIGFAMGAAGTDTALETADVA
    LMDDDLRKIPAFVRLSRATATVLWQNIAFALGIKAVFMLLTFAGLGSLWMAVFADMGASLLVVANGLRLSRG

    >gi|226944035|ref|YP_002799108.1| electron transport complex RsxE subunit [Azotobacter vinelandii DJ]
    MSNPSYRELSANGLWKNNPALVQLLGLCPLLGVSNSTVNALGLGLATILVLGSSSMAVSLVRGVVNTAVRLPVFVMIIAA
    LTTCIELLMQAFTYELYQILGIFIPLITTN
    CVILGRADGFAARHSLLLAGFDGLMMGLGFAVVLVMLGGVREMFGTGGLF
    ANMHLLFGPAATDWHIALIDDYKGFLLAILPPGAFIVLGLLIAAKNRIDEHRAERSRTFQPQTSSPSRRVRVTGVIE

    >gi|226944040|ref|YP_002799113.1| Na(+)-translocating NADH-quinone reductase subunit E [Azotobacter vinelandii DJ]
    MTELVLILVGAILVNNFVLVQFLGLCPFMGVSKRIETAIGLALATTFVLTLAAMCSYLLQRYVLVPLDLEYLRTIGFILV
    IAVVVQFTEMLVNKTSPLLYRVLGIFLPLITTN
    CIVLGVALLNANKAGYGFLESGINGFGAGLGFSLVLVLFAAMRERIA
    IADVPKPFKGAAIGLITAGLMSLAFMGFSGLIKP

    >gi|226944104|ref|YP_002799177.1| Copper-translocating P-type ATPase [Azotobacter vinelandii DJ]
    MATLTPCYHCGLPVPAGSHFQARVLDESRAMCCPGCQAVAEAIVASGLESYYKHRSENAANPEALPQALGEELALYDRPD
    VQQPFVRHDGELSTACLLIEGVS
    CAACGWLIEKHLRSLDGVADAGLNLSNHRLHVQWDARRLPLSRLLEALRQIGYAAHP
    YQPDRAAEQLARENRRALRQMGVAGLLWFQVMMATMATWPEFNLDLSAGMDKILRWISLILTTPIVFYSSSDFFRGAWRD
    LRTRHLTMDVSVSLAIGGAYAAGIWSTLTGQGELYFDAAGMFALFLLAGRFLERRARERTAAATAQLVNLLPPSCLRFDD
    KGHSERVLLRELRQGDLVLVQPGSLLPADGRVVAGQSSVDESLLTGEYLPQPRAPGDAVTAGTLNVESPLTVEVQALGDD
    TRLSSIVRLLERAQADKPRLAELADRVAQWFLLAMLGLAMAVGLIWWQIDPERAFWVVLALLVATCPCALSLATPTALTA
    ATGALHRQGLLLTRGHVLEGLNGIDTVIFDKTGTLTEGRLALSAVHPLGELDSDACLALAAALENRSEHPIARAFGRAPQ
    AAERVDVIPGQGLEGVVQGRLLRIGQPAFVAALQGQAAPPIPGERGQWLLLGDRQGPLAWLVLDDRLREDAATLLDACRA
    RGWRTLLLSGDSSPMVAEVAGQLGIEDACGGLTPNDKLAVLRQLHAEGHRVLMLGDGVNDVPVLAGADISVAMGSATDLA
    KTSADAVLLSNRLEALVRAFDLAHRTRRIIIENLTWAGLYNGLILPFAALGWITPLWAAIGMSLSSLLVVLNALRLTRGS


    >gi|226944204|ref|YP_002799277.1| copper-translocating P-type ATPase [Azotobacter vinelandii DJ]
    MDTSISVTRPDQGAHLTLAIEGMSCASCVGRVERALSKVPGVTGVSVNLASERAEIAFAGAVDVAAAIAAVRKAGYQVTE
    DSIELSVSGMT
    CASCVGRVERALKKLPGVTDASVNLASERARVRVLSGMPAATLIAAIERAGYAAKAMSAGNEAVDAEEA
    RRGAELAALKRDLTLAATLSLPVFLLEMGAHLIPALHHLILASLGQRANWLLQSVLCTLVLFGPGLRFFRKGIPALLRGA
    PDMNSLVAVGASAAWLFSLVATFAPGLLPAGTVHVYYEAAAVIVTLILLGRFLEARAKGRTSEAIRRLIGLQARTARVRR
    DGRVEEVAIEEVRNGDLLEVRPGERIPVDGEVSEGTSFVDESMITGEPVPVEKTPGAGLVGGTINQNGALTLRVTRIGGD
    TVLAQIIRMVEQAQGAKLPIQALVDRVTLWFVPVVMLVALLTFLAWMFFGPAPALTFALVNAVAVLIIACPCAMGLATPT
    SIMVGTGRAAELGVLFRKGEALQSLKDARVVALDKTGTLTRGRPELTDLILAEGFERGAVLGRIAAVEVRSEHPIARAIV
    AAAEAEGLALGRLEDFEAVTGYGVRAMVDGVRVEIGADRFMARQGLDVSGFAQEARRLGDEAKTPLYAAIDGRPAAMLAV
    ADPLKETTPAAIRALHAQGIQVAMISGDNRRAAEAIARRLGIDEVVAEVLPDGKVEALKRLKARHGQIAYVGDGINDAPA
    LAAADVGLAIGNGTDIAIEAADVVLMSGDLRGVPTAIALSRTTLGNIRQNLFWAFAYNTALIPLAAGALYPVNGMLLSPV
    FAAGAMALSSVFVLGNALRLKRFQPPALG

    >gi|226944249|ref|YP_002799322.1| Rhodanese-like protein [Azotobacter vinelandii DJ]
    MSQTITPQQLQQWLHDGREIALFDVREHGQYGAAHLFYGVSLPYSRLELDAVRLAPNPAVRLAIYDETGGELAERAAVRL
    RALGYRRVHILDGGAQGWRAAGFELFAGVNVPSKAFGERVELACATPHISAPELAARQARGEPLLVLDGRPFEEYRKMNI
    PGAICCPNGELGYRLGDLVADERTTIVIN
    CAGRTRSIIGAQTLINLGVKNPVYALENGTQGWFLADLPLEHGSTRRYPES
    TEPAGLAERREAAQRLAARAGVEALAAQQVAAWADDPERSLFLLDVRSAEEFAAGSLAGARHAPGGQLIQATDQYVGVRG
    ARIVLFDAEGIRAPIVASWLRQAGHDAHVLAGGLDSGLALAGRVPAFELPALAEADAATLADELAGDAVRLFDLRPSMAY
    RAVHIKGADWSIRPLLAAAAAGETRPLRLLADDPWLARLAALELPEAQRETVRICRADPAVWRAAGLALEEGGGQPPDAE
    CIDFLFFVHDRHAGNKAAARQYLAWELGLLAQLDARELAAFRPLVAEDRS

    >gi|226944281|ref|YP_002799354.1| peroxiredoxin, thioredoxin-like fold protein [Azotobacter vinelandii DJ]
    MSESLNRLLAELHAERERTWDPAALRVNVEQRRRLVEEARAERFVKAGERVEPFELLRVEGGRLTLDELVANGPAVLVFF
    RFAG
    CPACNIAIPYYQRNLQPILHAWGVPLVAVSPQIPERLGEIKSRHGLTLEVASDRDNALGRRFGILYEFDEPSRRAS
    LAKGPGIGALTGTGTWELPQPAAIVIGRDRRVHFAEVSPDWLVRTEALPILEAVRALLEAPRALRATP

    >gi|226944331|ref|YP_002799404.1| Glutathione S-transferase protein [Azotobacter vinelandii DJ]
    MTVLYIASGACSLAAHSLVHELGLPIQIEPVALRTPDSPIHAVNPLGRVPALQLDDGSVLTENSALLPYLADLRPEAGLF
    APAGSVERARIQSWIGYLTSEVHVGGFRPLNRPERYSADEGAHPGIRAQASEQLHQALAHIERHLNGRQWLVGERYTIAD
    AYLGVFAGWLPRLGEPFADLVQIARIGAAFRARPAVRKALATEGLL

    >gi|226944587|ref|YP_002799660.1| glutathione reductase [Azotobacter vinelandii DJ]
    MAYDFDLFVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHYAEDFEQARGYGWSLGEARFDW
    AGLVANKDREIQRLNGIYRKLLTDSGVTLLEGHARLTDAHGVEVNGQRYSAEHILVATGGWPVVPDIPGREHAITSNEAF
    HLPA
    CPERVLVVGGGYIAVEFASIFHGLGAKTSLLYRGELFLRGFDAAVREHLRDEMLKRGLDLQFNADIARIDRQADGS
    LRATLRDGRSLESDCVFYATGRRPMLDDLGLEEIGVELDERGYIRVDELYRSSQPSILAIGDVTGNVQLTPVALAEGMAV
    ARRLFRPEQYRPVDYRLIPTAVFSLPNIGTVGLTEEQARKAGYRVKIFESRFRPMKLTMTDSQERSLMKLVVDAASERVL
    GCHMVGPEAGEILQGLAVALKAGATKQVFDETLGIHPTAAEEFVTMRIPVDR

    >gi|226944710|ref|YP_002799783.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Azotobacter vinelandii DJ]
    MLDESLKTQLQAYLERVTLPFEIVASLDGSAKSQEMLGLLQDIQALSDKIALRTDGKDARVPSFALERPGADISLRFAGI
    PMGHEFTSLVLALLQVGGYPPKASEDTIAQVKALEGEYRFETYFSLS
    CQNCPDIVQALNLMAVLNPRVSHVAIDGALFQD
    EVEKRQIMAVPTIYLNGELFGQGRMELEQIIAKLDTGASAREAEKLNAREAFDVLVIGGGPAGASAAIYAARKGIRTGVA
    AERFGGQVLDTMAIENFISVPETEGPKLARALEEHVRQYEVDIMNLQRAVKLVPAAAKGGLHEVRFESGAALKARTVIIA
    TGARYRALGVPGEQEYRTKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVAHVTLLTHGEALRADAVLQRKLH
    SLPNITVLLNAPIAEVLGDGQKVNGLVYKDRLGGEAHRIELEGVFVQIGLLPNTEWLKGSVELTERGEIITDAHGATTVP
    GVFAAGDATTVPYKQIVIAVGEGAKASLGAFDHLIRSSAPA

    >gi|226944876|ref|YP_002799949.1| hypothetical protein Avin_28020 [Azotobacter vinelandii DJ]
    MEIKVNFLDNLRLEARFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCQTRDIPTDNIRLSQNNIVDPE
    NRYKQILKIQVELPADISEKDRLGILRSIDRCTVKKVVQTGPDFVIEEVENLDADAQALLMLNPDADASTYILGKDLPLE
    QTIANMSEILAGLGMKIEIASWRNIVPNVWSLHIRDAQSPTCFTNGKGATKESALASALGEFIERLNCNFFYNDQFWGED
    IANAAFVHYPDERWFKPGRKDALPAEILDAYCLEIYNPDDELRGSHLYDTNSGNVERGICSLPFVRQSDGEVVYFPSNLI
    ENLYLSNGMSAGNMLAEAQVQCLSEIFERAVKREILEGELALPDVPHEVLAKYPGILAGIQGLEEQGFPVLVKDASLGGE
    FPVMCVTLMNPRTGGVFASFGAHPNFEVALERSLTELLQGRSFEGLNDLPAPTFESHALTEPNNFVEHFIDSSGVVSWRF
    FSAKADFEFVEWDFSGQGEDSNAEEAATLFGILEDMGKEVYMAVYEHLGATACRILVPGYSEIYPVEDLIWDNTNKALSF
    REDILNLHRLDDARLKALLKRLENCEVDDYTDITTLIGIEFDDNTVWGQLTLLELKLLISLALRRFEDAKELVEAFLQYN
    DNTVERGLFYQTLNVVLEVVLDEELELADYEVNFRRMFGNERMDAALGSVDGSVRFYGLTPTSMKLEGLDRHLRLIDSYK
    KLHGARARVAALSQ

    >gi|226944897|ref|YP_002799970.1| thioredoxin-disulfide reductase [Azotobacter vinelandii DJ]
    MNDVKHSRLIILGSGPAGYTAAVYAARANLKPLLITGIQPGGQLTTTTEVDNWPGDVEGLTGPALMERMQKHAERFDTEI
    VYDHIHTAKLQQRPFTLIGDSATYTCEALIIATGASAQYLGLPSEEAFSGKGVSA
    CATCDGFFYRNQVVGVVGGGNTAVE
    EALYLSNIAKEVHLIHRRDKLRAEKILQDKLLEKARNGNIRLHWNQTLDEVLGDASGVTGVRLKDTLSGATETLSLTGVF
    IAIGHKPNTELFEGQLDMHNGYLTIKGGSSGDATATSIEGVFAAGDVADHVYRQAITSAGVGCMAALDAERYLDD

    >gi|226945004|ref|YP_002800077.1| hypothetical protein Avin_29330 [Azotobacter vinelandii DJ]
    MTAQAAVKTVIFYEKPGCGGNRRQKTLLQEHGIELQVRDLLSTPWTRERLEPFFAGLEKDAMVNAAAPKIKSGEVDVAAL
    SRDELIEKMLAEPLLIKRPLLEVGETRICGFDIPRLNALLEVGMPVPETINSCLKTDKCSSH

    >gi|226945043|ref|YP_002800116.1| dihydrolipoamide dehydrogenase [Azotobacter vinelandii DJ]
    MSQKFDVIVIGAGPGGYVAAIKSAQLGLKTALIEKYKGKEGKTALGGTCLNVGCIPSKALLDSSYKFHEAHESFKLHGIS
    TGEVAIDVPTMIARKDQIVRNLTGGVASLIKANGVTLFEGHGKLLAGKKVEVTAADGSSQVLDTENVILASGSKPVEIPP
    APVDQDVIVDSTGALDFQNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPAVDEQVAKEAQKILTKQGLKIL
    LGARVTGTEVKNKQVTVKFVDAEGEKSQAFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDYCATSVPGVYAIGDV
    VRGAMLAHKASEEGVVVAERIAGHKAQMNYDLIPAVIYTHPEIAGVGKTEQALKAEGVAINVGVFPFAASGRAMAANDTA
    GFVKVIADAKTDRVLGVHVIGPSAAELVQQGAIAMEFGTSAEDLGMMVFAHPALSEALHEAALAVSGHAIHVANRKK

    >gi|226945106|ref|YP_002800179.1| cytochrome C biogenesis protein [Azotobacter vinelandii DJ]
    MKRAIFLLPLALFLGVAAFLYRGLFLDPAELPSALIGKPFPAFSLPAVQEPERTLTVEDLKGKPALVNVWATWCVSCKVE
    HPVLNELAGRGVNIVGVNYKDDNASALKWLKEFHDPYRLNIRDEQGSLGLDLGVYGAPETFLVDRHGIIRHKFVGVIDER
    VWREQLAARYQELLDE

    >gi|226945120|ref|YP_002800193.1| peroxidase [Azotobacter vinelandii DJ]
    MSIRLGDIAPDFEQDSSTGRIRFHEWLGDGWGILFSHPADFTPVCTTELGFTAKLKDEFAKRNVKAIALSVDPVDSHLKW
    IGDIEETQGVQVGFPIIADADRKVSDLYDLIHPNANDTLTVRSLFIIDPNKKVRLIITYPASTGRNFHEILRVIDSLQLT
    DNYKVATPANWKEGDEVVIVPSLQDPEELKQRFPKGFRAVKPYLRLTPQPNR

    >gi|226945134|ref|YP_002800207.1| arsenate reductase [Azotobacter vinelandii DJ]
    MSTITIYHNPDCGTSRNVLGLIRNSGEEPTIIEYLKTPPDRETLVALIRAMGISPRALLREKGTPYAELGLDDSKWSDGQ
    LVDFMLQHPILIERPIVVTPLGTRLCRPSETVLDILPRLQRGAFDKEDGEPVVDAQGRRV

    >gi|226945162|ref|YP_002800235.1| Rhodanese-like protein [Azotobacter vinelandii DJ]
    MSRIAIRSFADIRAALLAREEVALLDVREEAPFAEGHPLFAANIPLSRLDIEVYARVPRRTAPVTVYDDGEGLAERAAER
    LLALGYSDVALLEGGLAGWRAAGGELFIDVNVPSKSFGELVEAERHTPSLAAEEVKALLDEKADVVVLDARRFDEYQTMS
    IPGGTSVPGAELVLRVRELAPNPRTRVIVN
    CAGRTRSIIGTQSLVNAGIPNPVAALRNGTIGWTLAGQRLEQGQSRRFPE
    VSAENRAIAAQSARAVADKAGVGRAALADLARWREEAGRTTYLFDVRTPEEYEAGHLPGARSTPGGQLVQETDHFASVRG
    ARIVLADDDGVRANMSASWLAQMGWEVHVLDGLDAADFTERGGWSAPVPPAPQAEEIAPETLQAWLAEGDTLVLDFTTSA
    NYVKRHIPGAWWALRAQLPQALEKLPPAARYVVT
    CGSSLLARYAVDELHALSGKPVFVLAGGSATWIAAGLPLEEGETAL
    AVPRSDRYRRPYEGTDNPREAMQAYLDWEFGLVEQLGRDGTHGFFVI

    >gi|226945337|ref|YP_002800410.1| SelT/selW/selH selenoprotein [Azotobacter vinelandii DJ]
    MTATKPEILITYCTQCQWLLRAAWLAQELLSTFGEDLAKVSLEPGSGGVFRITCDGVQIWERKADGGFPEAKALKQRVRD
    LIAPDRDLGHSDRPRGSR

    >gi|226945356|ref|YP_002800429.1| 3-mercaptopyruvate sulfurtransferase protein [Azotobacter vinelandii DJ]
    MSHAQLLDPARLAERLDQPDLRILDCRFALEDPAYGARSYAEAHIPGARFADLERDLSGPVHKGVTGRHPLPDPVLLTER
    LRAWGIDNDSQVVLYDDGPGAFAARAWWLLAWLGKRDGVFLLDGGLNAWRAAGLPLSGEPPAPAAGTFRGQPDASLLVDA
    QDLLARLGDARLTLLDARALPRFRGEVEPLDPVAGHIPGARCAPFTDNLGADGRFLPADELRARFAGLLGERPVERLVAY
    CGSGVTACHNLFALSLAGYPLAPLYAGSWSEWLTDRSRPVATGD

    >gi|226945587|ref|YP_002800660.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Azotobacter vinelandii DJ]
    MPVVLEQPVPDFQAQATGGQTVSLAALRGRQVVLYFYPKDSTPGCTTEGQGFRDRHDEFQAANTLVFGVSRDGLKSHENF
    KSKQAFPFELISDKEEQLCRLFDVIKLKKLYGKEYLGIDRSTFLIDEDGVLRQEWRGVKVPGHVDAVLAAARALQQSR

    >gi|226945679|ref|YP_002800752.1| DSBA oxidoreductase [Azotobacter vinelandii DJ]
    MKGERLSKRHTGVKGPQWNWVEDCLVPLLLVVALLGTVAILAYLHQEATRSETGPWPLGEPDARWTITEYADLECPYCKT
    YTPDLKRWVGRHPQVNLQWHHVPLPGHGQAAVHEARLVQCAGVHGGREAFWTAIDQVLARTGSNGLGFTGPLDVPNVKPD
    VLELCADTDPGIALLVEQQRIEAKKRGIQATPSVEITDNRSGRSLTLEGPADEATLLSAMDWLDRQASVGSEPPGANGGN
    P

    >gi|226945728|ref|YP_002800801.1| thioredoxin [Azotobacter vinelandii DJ]
    MRGRTGIVLALAAGLALAGCSEDWGVDQHGRPVAAEQLEGQWLVINYWAEWCSPCRSEIPQLNALAEQLQGRGVRVVGVN
    FDGLQGGELARASEALGIRFGVLAQDPAERLKLPPGEVLPVTYIVDAQGRLRERLLGEQNAVGLAARLQTLRGGGS

    >gi|226945730|ref|YP_002800803.1| arsenate reductase [Azotobacter vinelandii DJ]
    MTDLTLYHNPRCSKSRGALELLEARGLQPKVVRYLETPPGAEELRELLGKLGIPARQLLRTGEEEYKTLKLADPALDEER
    LIAAMVAHPRLIERPILVVGERAVIGRPPEKVLEILP

    >gi|226945950|ref|YP_002801023.1| arsC family protein [Azotobacter vinelandii DJ]
    MTDGTPVLYGIKACNTMKKARAWLDAQGVAYRFHDYKSAGIDRAHLEKWCAEHGWQVVLNRAGTTFRKLDDTQKADLDQA
    RAIELMLAQPSMIKRPVLDLGERSLVGFKPELYSAALA

    >gi|226945991|ref|YP_002801064.1| Disulfide bond isomerase [Azotobacter vinelandii DJ]
    MRVSSLFAAVALGLASTLALAADPGQAIRKALQQMQPGLPIESIAESPMTGLYQVQLKGGRMLYASADGQFVMQGYLYQL
    KDGKPLNLTERAESLAVAKAINGIPAGEMVIFAPKEPKTHITVFTDTD
    CGYCQKLHSEVPELNRLGVEVRYVAFPRQGIG
    SHGYGDLVSVWCAKDRQAAMNKAKAREKVPAATCDNPVAKQFELGQMIGVQGTPAVILANGQMIPGYQPAAQLAKQALTA
    QSTN

    >gi|226946076|ref|YP_002801149.1| Iron-sulfur biogenesis protein [Azotobacter vinelandii DJ]
    MAVTMTEAAARHIRRSLDGRGKGEGIRLGVRTSGCSGLAYVLEFVDEVASEDQVFESHGVKVIVDPKSLVYLDGTELDFV
    REGLNEGFKFNNPNVRGECGCGESFNI

    >gi|226946110|ref|YP_002801183.1| Methylated-DNA-(protein)-cysteine S-methyltransferase [Azotobacter vinelandii DJ]
    MLLVTDEQGRLRALDWHDHEDRMCLLMRRQYPGVRVGLRKAMCESCAAQAMRAYFDGDIAVIDKLTVATGGTDFQRQVWA
    ALRDIPGGETLSYRDLATRIGRPSAVRAVGLANGANPVGIVVP
    CHRVIGSDRTLTGYGGGLERKQWLLDHERKWRDAGSV


    >gi|226946145|ref|YP_002801218.1| Glutathione peroxidase [Azotobacter vinelandii DJ]
    MSAFHDLTLRGLDGQDLPLAQFRDKVVLVVNVASKCGLTPQYAGLEKLHLQYRERGFSVLGLPCNQFAGQEPDNEAQIRE
    FCSLNYGVTFPLAAKLEVNGSGRHSLYRLLAGEGAEFPGDITWNFEKFLVGRDGRVLARFSPRTAPDDPALLQAIEKALG


    >gi|226946179|ref|YP_002801252.1| molybdopterin biosynthesis protein MoeB [Azotobacter vinelandii DJ]
    MLSDQELLRYSRQILLPQVDVDGQLRLKRSRALIVGLGGLGSPVALYLAAAGVGELHLADFDSVDLTNLQRQVLHDTPSV
    GQGKVDSALARLAALNPEVVLRPLRGALDADSLAAAVAAVDLVLDCSDNFATREAVNSACVAAGKPLVSGAAIRLEGQLS
    VFDPRSEGSPCYHCLYGHGSEAELT
    CSEAGVVGPLVGLVGSLQALEALKLLAGFGEPLVGRLLLVDALTSRFRELRVRRD
    PQCPVCGARHGQ

    >gi|226946513|ref|YP_002801586.1| Peptide methionine sulfoxide reductase [Azotobacter vinelandii DJ]
    MVLRSQIPAHELALPDPARALPGRAEAMPVPAAHYVNGHPLKPPFPAGMRQALFGLGCFWGAERRFWQQPGVWTTAVGYA
    GGLTPNPTYEEVCSGLTGHTEVVLVVFDPQETDYRTLLKVFWEIHDPTQGMRQGNDIGTQYRSAIYCFDASQRASAEASR
    ERFQAELAKAGYGPVTTEIADAPPFYYAEDYHQQYLAKNPGGYCGLGGTGVCLPPA

    >gi|226946528|ref|YP_002801601.1| hypothetical protein Avin_45110 [Azotobacter vinelandii DJ]
    MKRLSELAFDNRFARLGDTFSTAVTPLPIASPRLVVASPAALALLDLEPAVADDPQLVEYCAGQCPWPGAEPRAMAYSGH
    QFGFYNPQLGDGRGLLLGEVINAAGERWDLHLKGAGKTPYSRMGDGRAVLRSSIREFLASEHLHALGIPTSRALCVTASD
    TPVWRETEERAATLLRLAPSHVRFGHFEFFYYSRQHEALRQLLDYVIGEYFADCLAQPDPYRAFFDRVLERTAALLARWQ
    AYGFCHGVMNTDNMSILGITFDFGPYAFLDDFDPGFVCNHSDDTGRYSFDNQVPIAHWNLSALGQALTPFVDKDALLGSL
    KRFLPLFRGAWLELMRRRLGFTTAEADDRERIQRLLQLMQGSAVDYSRFFRELGDRPAAAALRRLREDFVDLAGFDAWAG
    DHLARLARENEADEAARRARMHAVNPKYILRNYLAQQAIEAAERGDYSPVRELHAVLSRPFDEQPGMERYAERPPEWGKH
    LEIS
    CSS

    >gi|226946531|ref|YP_002801604.1| thioredoxin 2, TxrC [Azotobacter vinelandii DJ]
    MTDALLIPCPHCHSLNRIPAARLGEAPRCGRCKSPVLPGKPFAVDAAGFAAQLKGDLPLLLDVWADWCGPCKAFAPVFDQ
    AARELAGRVRLAKLDSEAEAPLAGQLGIRSIPNLILFRAGREVARQSGALPLPQLLAWLRQQGV

    >gi|226946597|ref|YP_002801670.1| thiamine biosynthesis protein ThiI [Azotobacter vinelandii DJ]
    MKLIVKVFPEITIKSPPVRKRFIRQLAKNIRTVLRDLDPELAVTGVWDNLEVETAVEKPRLLREMIERLCCTPGIAHFLE
    VHEYPLGDLDDILEKCKRHYAGQLPGKIFAVRCKRAGRHPFTSMEVERYVGGCLRQQCGAAGVSLSAPEVEVRMEIRDQR
    LFVVHRQHDSIGGYPLGALEQTLVLMSGGFDSTVAAFQTMRRGLMTHFCFFNLGGRAHELGVMEVAHYLWQKYGSSQRVL
    FVSVPFEEVVGEILGKVDNSQMGVILKRMMLRAATRVAERLKIDALVTGEAISQVSSQTLPNLSVIDSATDMLVLRPLIA
    SHKQDIIDTATRIGTAEFARHMPEYCGVISVNPTTRARRDRIDYEERQFDMAILERALERAHLVPIDRVIDELGEEICVE
    EVREALAGQIVLDIRHPEAVEDGPLELPGIEVRALPFYALNNRFKELDSNRQYLLY
    CDKGVMSRLHAHHLLSEGHANVRV
    YRPA

    >gi|226946603|ref|YP_002801676.1| Alkyl hydroperoxide reductase [Azotobacter vinelandii DJ]
    MSLINTEVKPFKATAYHNGKFIDVTEADLQGKWSVFFFYPADFTFVCPTELGDLADNYAEFQKLGVEIYAVSTDTHFTHK
    AWHDSSETIKKLQFPMVGDPTLAISRNFEVLIEEAGLAERGTFVVDPQGKIQIIELNAGNIGRDANELLRKIKAAQYVAS
    HPGEVCPAKWKEGEGTLKPSLDLVGKI

    >gi|226946614|ref|YP_002801687.1| iron-sulfur cluster insertion protein ErpA [Azotobacter vinelandii DJ]
    MTVETFTPTPLLFTQGAANKVKTLISEEGNPRLKLRVFVTGGGCSGFQYGFTFDEDVAEDDTIVEREGVSLVVDPMSFQY
    LAGAEVDYQEGLEGSRFVIKNPNAATTCGCGQSFSV

    >gi|226946620|ref|YP_002801693.1| OsmC family protein [Azotobacter vinelandii DJ]
    MKARIQWAGEAMFIGESGSGHAVVMDGPPENGGRNLGIRPMEMVLIGLGGCSSFDVVSILKKSRQAVESCEAFLEAERAG
    EDPKVFTRIHLHFVIKGRGLKEAQVKRAVELSAEKYCSASIMLGRAGVEISHDYEIVDLG

    >gi|226946637|ref|YP_002801710.1| Methylated-DNA--(protein)-cysteine S-methyltransferase [Azotobacter vinelandii DJ]
    MNTTNPSAARTLRDPRWSALLARDPAADGRFVYSVRTTGVYCRPVCPARRPRPENVDFHASALDAERAGFRPCRRCRPER
    RSPARERAAKVAALCRFIESAERPPDLEELARRAAWSRWHLQRTFKAITGLSPRAYAEAQRAGRLRRELARGAPVTDALY
    AAGYGSSGRFYAQADASLGMSAGSYRKGGAGRAIRFAVGQCSLGAILVAQSERGICAILLGDDPEALLRDLQERFHAAEL
    IGADAGFEELVARVVGFVEAPRLGLDLPLDIRGTAFQMRVWEVLRRIPPGTTLDYAEVAELVGAPRAVRAVAGACAANAL
    AVAIP
    CHRVVRRDGGLGGYRWGVERKRALLERERE

    >gi|226946693|ref|YP_002801766.1| thiosulfate sulfurtransferase [Azotobacter vinelandii DJ]
    MSEFRRIPPQQAQVLRSQGAVVVDIRDPQSYAQGHIAGARHLDNQSLADFMAQADFQRPLIVACYHGNSSQGAAAYLAQQ
    GFTEVYSLDGGFELWRATFPDEVAPGTAGQPG

    >gi|226946700|ref|YP_002801773.1| Rhodanese-domain protein [Azotobacter vinelandii DJ]
    MKSAHDLVAEAKARIHEVELQAAEAAIRNADLLLDVREADEFQAGHIPGALNIPRGILEFKIDNAPELSARDLGIVLYCK
    TSGRAALAAATLQDMGYRKVRSIAGGFDAWSAAGKAVTTPSLPSFE

    >gi|226946749|ref|YP_002801822.1| Thioredoxin 1, trx1 [Azotobacter vinelandii DJ]
    MSELITNVSDASFEQDVLQAEGPVLVDYWAEWCGPCKMIAPVLNEIAKDYEGRLKICKLNIDENQGTPAKYGVRGIPTLM
    LFKGGNVEATKVGALSKSQLAAFLDSNI

    >gi|226946763|ref|YP_002801836.1| disulfide bond formation protein [Azotobacter vinelandii DJ]
    MNLASPRSLFLLAFLGCVALLGGALYLEHGVGLEPCPLCIVQRIFVILFGLICLVAALHGPALAGQRLYAGFALLAALGG
    AATAGRQVWLQNIPPEQLPS
    CLPSLEYMLEALPFQEIVRQVLHGTADCAEVGWTLFGMSLPEWSLLAFVAMLLFALLQLL
    RRA

    >gi|226946871|ref|YP_002801944.1| Rhodanese-like protein with Ankyrin repeat [Azotobacter vinelandii DJ]
    MAPAERIPYQCLSAVEAAALIRAEPELSLFDVRDLHSYRQEHLDGAMHLSEDRVPLWLGRLPKDKPVLIYCYHGNSSKTF
    AQMFSDFRFARVYSVDGGYRPLANALAGATAPDAAPSAELAAFLDEWRYPADDLEARGQHGLTPLMRAALQGRREIVREL
    LALGADIRARNDDGNTALWLACVSRDSGLVQDLIDAGIELDNRNDAGSTALMYTASSDRPELLKILLEAGADPQVRNFDD
    LRAVELAASRACLKLLRHTAD

    >gi|226947082|ref|YP_002802155.1| Electron transport complex, RnfABCDGE type, E subunit [Azotobacter vinelandii DJ]
    MSHCGAPSVPEPEKKVPWQYFTSALWQYNVALVQMLALCPTLAVTTTATNGLGMGLATTLVLVMTNALISSMRHTISPEV
    RNPVMIGVIAGVVTLTDMAMNAWMHELYKVLGLFIALIVTN
    CAVLGRAESFCLRNPVIPSILDGAGMGAGFTAVLVVIGG
    IREILGSGTLFSQASSLLGSHFKWMEITVIPDFQGILLAILPPGAFIVLGFLLAAKRVIDRKRAERRQQTHGELVVLQ

    >gi|226947087|ref|YP_002802160.1| Electron transport complex, RnfABCDGEFH, A subunit [Azotobacter vinelandii DJ]
    MEYVLFLLGTVLVHNVVLVGFLGLCPFMGVSSKLDPSIGLAVATTLVMGLGGASSWLLEHYVLLPLGIGFIRILAYIVVI
    AGMVQLIEMIIRKASPSLYRSLGIYLPLITTN
    CAVLGVPLLSVREGHDLTMAVLFGLGSGLGFSLIMIIFAGLRERLALA
    NVPAAFSGPPIAFVTAGLLALAFMGFGGLI

    >gi|226947092|ref|YP_002802165.1| nitrogenase-associated protein [Azotobacter vinelandii DJ]
    MTSTSIVFYEKPGCATNRLQKQLLRSAGLHLEVRNLLSEPWTPERLRPFFGDRPVVEWFNRSAPAIKYGELDPTQLSASQ
    ALELMLAHPILIRRPLIHYGSQYMAGFDLVKLCTHLPAKNDLPDAGEDLEKRSVGQNPIGCLAAGNQ

    >gi|226947094|ref|YP_002802167.1| rhodanese/sulfurtransferase-like protein [Azotobacter vinelandii DJ]
    MTRFSRIAAEQAEALLAGQDSVMLLDTRDARAYCQGHDPRAIHLNDLNLRTLLKVTPKQVHLLFCCEDGTTSPDMARLFS
    EFGFINCYSLEGGYGAWKARPQQAARAHAARARHAAALLG

    >gi|226947095|ref|YP_002802168.1| glutaredoxin-related protein [Azotobacter vinelandii DJ]
    MQVQDTEARIRKQIAENPVILYMKGTPAAPECGFSRAAVGALSKAGKPFAYVNVLTAPHIREKLPKLFQWPTFPQLFVNG
    ELIGGSDIILEMEADGSLKELLEKAVPQA