Polynucleobacter necessarius STIR1 uid58967

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|171462908|ref|YP_001797021.1| Protein-disulfide reductase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MKLHSLLVRILALALFLSAQVFAAQDFLPPEKAFRAEATWIENSNQIELEFLPAKGYYIYQNSLRFLVGVQTGKLSNIRP
    SLPSGVEKFDETFQKKLQVYKDPFLVFLDIKPVLGQPVNLEITLQGCAEAGICYPPMTLKFLLAGPGVKAAPIPDVLDGA
    PSSNVKTNDQFSLVDLWRERDDVNAIGRFLEGTSTAYLFLAFFVLGLALAFTPCVLPMLPILSSIIFGTQGGKAISKGRA
    SVLALAYVLGLALVYALAGVLMAALGGSVQRALQSPFALAVFALLLLTLSGSLFGLYDLRLPQSWHHHVDRLAGRQKGGS
    LYGAFALGGISTLVASPCITAPLAGVLAFIAQTGSMSLGAGLLFVMALGMGLPLLFITVEARILIPSTGIWMVWLQRTLG
    VLLVATAAWIASPLLDQNNAPGAAKMLNGQRIHQVGDLSFVVIQSPAQLEAQLSKAKEGKKLVLLDFYADW
    CISCKEMEI
    STFANSEVSKELKQFVLLQADVTANSPENQALLKRFGLFGPPGILIFNQNSEEQKDQRVIGYMPPQRFIERLKQAAN

    >gi|171462950|ref|YP_001797063.1| Glutathione S-transferase domain [Polynucleobacter necessarius subsp. necessarius STIR1]
    MMVLYSGTNCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYDQVPILVERDLILYESNIINEYIDERFPHPQLM
    PPDPVARARARLFLFNFEKELFVHVVALENEKGKAAEKVHEKARLAIRDRLTQLAPIFVKNKYMLGDEFSMLDVAIAPLL
    WRLEHYGIDLSRNAAALLKYAERIFSRPAYIEALTPSEKVMRR

    >gi|171462956|ref|YP_001797069.1| glutaredoxin-like protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MDTQAQIKEIVTSHPVVLFMKGTAQFPQCGFSGNAVNILRASGVENLHTVNVLENAEIRQGIKEYANWPTIPQLYINGKF
    IGGSDIMTEMFQSGELQKLVKA

    >gi|171462963|ref|YP_001797076.1| putative thiol:disulfide interchange protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MNKSLSVIALITAALFCTGSALAQPEQQIKTEIQKKLGSNVKVKSISPAPISGLYEVLVGNDIFYADVSGKYLIQGEIIE
    LATGKNITEQRQADLNRIKWSDLSPANAIKYVRGNGSRQLAVFSDPN
    CGHCKRLEKLLQQLENVIIYTYLIPILSSDSAQ
    KSKQIWCSADPYKAYIDWMINGITPSGKGECNTPLDKNMAFAKTYGITGTPTLFFTDGSRFPGAVQITDIEKKFNSLK

    >gi|171462993|ref|YP_001797106.1| Redoxin domain protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MIAVGQKLPNATLYEFMNEETEGCSLGPNAFEVEELAAGKKIVLFALPGAFTPTCSAKHVPGYVEHFDAIKAKGVDEIWC
    VSVNDPFVMGAWGRDQKVGKKIRMLGDGSAEFTKMLGLELDLTARGLGVRSDRYAMIIEDGIVKSLDREAPGKFEVSDAA
    SILKKL

    >gi|171462997|ref|YP_001797110.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MKHVILDNGSAGVIAAETMRKRAPYDQIVMIGSEDAPPYSQMAFPYLLMGNIDEQGTYLRKDANHYQKLKIEQVRGKVVA
    VDAKANKVELEGGQVIQFDKLLIATGSVPVQPPIPGIDLPGVHP
    CWTLEDARAITSLAKPGSRVLHMGAGFIGCIILEAL
    ANRKVKLTVVEMGDRMVPRMMTSVAGGMIKKWVEDKGMQVHISTKVEATTKANSGLTVKLSNGKALEVDLVISATGVRPN
    IAYLKSSGLQIQTGILVNEQMQTSYPDIYAAGDVTESIDFSTGERIVNAIQPNAAEQARIAAIAMTGGDAESLGALQINV
    LDTLGLISSSFGLWSGAKGGDFMELVDFPQFKYLRLEFLEDVLVGATCVGSTEHIGVLRGLIQGKISLGEWKEVLMADPT
    KAVSAYLAAGQAQSNWMI

    >gi|171463007|ref|YP_001797120.1| methylated-DNA--protein-cysteine methyltransferase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MTASPKPLIANSPSYCVIAAPFGRLGISTELVEGGLMLSKIDYLPSAATLIAPKNALAKEVERQCRAYFKDPNWQFDLPT
    KSAGTEHQKKVWASIQDIPAGKTQAYGEVAKKIKSGPRAVGTACGANPYPLITP
    CHRVVSAQGVGGFMKENSPGFYRQIK
    LWLLKHEGAL

    >gi|171463031|ref|YP_001797144.1| Redoxin domain protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MNRRQWIIIVTISLLALLGGVLTSQWIYKTGLASDPAVKAFFANSWQTPDGKVANTQEWQGKVLVVNFWASWCPPCVEEM
    PTLDKLQQEFLQKNVLIVGIGIDSPSNIREFLSKTPVSYPIVIGGLEGSNLAKQMGNSQGALPYTLIINGSGKASYSKLG
    KISEDELRSALNLLYKHF

    >gi|171463209|ref|YP_001797322.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Polynucleobacter necessarius subsp. necessarius STIR1]
    MTVAIGQPIPRCAIPATSGLTFSPASAKGKKLILYFYPKDMTPGCTAESGEFRDNIEAFTKANTLVVGVSRDSLKSHDNF
    RSKLELPFELVADTEEKLCQIFGVMKMKNMYGKQVHGVERSTFLFDSSGKLVKEWRGLKVPGHATEVLQAAQATK

    >gi|171463239|ref|YP_001797352.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter necessarius subsp. necessarius STIR1]
    MAITLTDKAAAHVNRNLEKRGKGCGLRLGVRTTGCSGLAYQLEYVDEPAAEDQVFESNGIKVFVDPKSLAYLDGTELDFV
    REGLNEGFKFQNPNVKDECGCGESFRV

    >gi|171463250|ref|YP_001797363.1| Disulphide bond formation protein DsbB [Polynucleobacter necessarius subsp. necessarius STIR1]
    MKRIHYLFLSIFSLSLVIFAVILQQTGYQGVSFMPCPLCILQRVGYLSIAISCLLAAGIAPFRKLFHGLALLAAGYGVSV
    AGHQVWLLFHPSES
    CGIDPLETWINQFQLTNHLPWLFKADGLCSAKLPTILALQVPEWSLLWFSVLFLILLITFFRKLNP
    NP

    >gi|171463348|ref|YP_001797461.1| HI0933 family protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MSKTWDAITVGGGAAGLFCAGVAGQLGKKVLVLDHAEVLGEKIRISGGGRCNFTNLHSSPSNFLSLNQHFVKSALARYPS
    SEFIKLVTSYRIGYHEKHQGQLFCDDSAKQIIDMLFSECTKGRVSIRNPVSIRSIEQVNDSWIVNTDAGVEKSKAVVMAT
    GGLPVPAIGATAYSLDIAKQFGLNVVEPRPVLVPLSFTADNFGGLNELAGLSVPVRIASGSKGHRYGACRFNEDLLLTHK
    GLSGPAVLQASSYWEEGEPIHIDWLGAIERPGGFNCDELFNNEENRLKLTETILASVLPQRLAKAFADQRNLTGRKWAEV
    SKKDRQALKELITNWSVKPAGTLGWKKAEVMLGGVDTKELDVQTMMSRKHQGLFFIGECVDVTGHLGGHNFQWAWASGFA
    CAHAL

    >gi|171463357|ref|YP_001797470.1| selenide, water dikinase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MNTLNLSTEPRLTSLSHGGGCGCKIAPGVLSEILKNVPQLPFPKELLIGIETSDDAAVYQINESQAIVATTDFFMPIVDD
    PFDFGKIAATNAISDIYAMGGTPLFALALVGMPIKVLSNKTIARILKGGAEACRSAGIPIAGGHTIDSVEPIYGLVAIGI
    VDPKRVKSNASAKPGDVLILGKPLGVGVLSAALKKDLLGPDGYREMIANTTKLNSAGPDLAKLSGVHALTDVTGFGLAGH
    TLELARGSNCTAHIDWNQVPLLSNVQALTNDGMITGASDRNWLSYGNEVNIPADFTPAQRALLTDPQTSGGLLVSCSSDS
    VKEVLDIFNQHHFLGARVIGQMSKRQEKPLVVS

    >gi|171463358|ref|YP_001797471.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Polynucleobacter necessarius subsp. necessarius STIR1]
    MLFTDLGLSESTLRAIAEEGVAINFWASWREPCREEFEELTQLQANYGPKGLVVLAVNLDEIKPRILQFLKGNGFSENSI
    EILLNRNSIVYKAWRVRGLPTTFLVSRAGKIEGVWMGTIENIDSNEVKGKIETLLRQ

    >gi|171463385|ref|YP_001797498.1| thioredoxin [Polynucleobacter necessarius subsp. necessarius STIR1]
    MSAGIKYVTDASFEQDVLKSDKPVLLDFWAEWCGPCKMIGPILEELAGEYGDKLQIAKMNVDENQGVPAQLNIRGIPTLI
    LFKNGTVAAQKVGALAKSQLTAFIDSHL

    >gi|171463576|ref|YP_001797689.1| Methionine sulfoxide reductase B [Polynucleobacter necessarius subsp. necessarius STIR1]
    MIRTEVRCANCDAHLGHIFEDGPMPTGLRYCINSASLHFEPSSNATPAKTED

    >gi|171463680|ref|YP_001797793.1| dihydrolipoamide dehydrogenase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MSQAFDVVVIGGGPGGYIAAIRAAQLGFKVACAESSSYDDPKGEPRLGGTCLNVGCIPSKALLASSEEFEKINHHAADHG
    IKVGAVSTDSKKMIARKDDIVTKMTGGIQYLFRKNKITLLKGHASFEGKGSDGYQIKIDGKDKETVAAKNVIIATGSKAR
    HLPGIAVDNVLI
    CDNEGALKFDSTPKKLGVIGAGVIGLELGSVWRRLGAEVTVLEAMPSFLGACDVSIAKEAQKLFTKQG
    LSINTGVKIGDVKADKKGVVVNYTDSAGKAAKLECDRLIVSVGRVPNTDKLSLDKIGLKVDEHGFIPIDDHTCATSAPGV
    YAVGDVVRGPMLAHKAEDEGVLAAEVIAGQKPHIDYNCIPWVIYTDPEIAWVGKTEQALKEAGVAYKAGQFPFAANGRAL
    GMGRADGFIKVLADAKTDEILGVHIIGANASDLIAEAAVAMEFKAAAEDIARICHVHPSLSEVMREAALATDSRALNM

    >gi|171463703|ref|YP_001797816.1| protein of unknown function DUF395 YeeE/YedE [Polynucleobacter necessarius subsp. necessarius STIR1]
    MQIDWFSFTPVPSLLGGMILGIAAALYVLLHGRILGISGIVSGLLHPKLADSAWRICLVLGLISAPFLAALFFGIFPVVE
    IKSDWIAMVIAGLLVGFGAQYGSG
    CTSGHGICGLSRLSPRSLVATLSFMGVGFIIVYVLRHLIGL

    >gi|171463704|ref|YP_001797817.1| protein of unknown function DUF395 YeeE/YedE [Polynucleobacter necessarius subsp. necessarius STIR1]
    MDVVDINSLSKSVLWATFAITFFLGAVMQKTGFCSMGAVSDVFIMSSWDRLKQWFLAIGVAIIGFTLMSYLGLIDPLKSF
    YTGNKFLWLSTIVGSVLFGLGMVLASG
    CGSKTLIRIGGGNLKSFVVFMVLGLTAYMTMRGFLGVVRINTLDTFFIAFNAP
    QDLPSLLSAPLAIARPQLHLALGLIIGAAFIAYALASKAFWTAENLFAGIAVGLAICAVWWVSGNLGYVAEDPNTLEEVF
    LVTNSGRMESLSFVAPYAYSLDWLMMYSDTSKMLTVGIMAVLGMILGSAVVSIATKSFRWETFRNTKDTANHLVGAALMG
    FGGVTALG
    CTVGQGLSGISTLALGSLIALPGFIFGAYLGLRYLQMRLAPNPCS

    >gi|171463761|ref|YP_001797874.1| dihydrolipoamide dehydrogenase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MAKQTILVPDIGDYSDVPVIEVLVKVGDAIEKEQPLLVLESDKATMEVPADAVGTVTSVAVKLGDKVSKGSVIAEIEAST
    TVPAAKPAAAPVATATATAPVAGQYSGKVDHECEVLVLGAGPGGYSAAFRSADLGMNTVLVERYPTLGGV
    CLNVGCIPSK
    ALLHTTSVMDEVKSMAKHGITFGAPKIEIDQLRGYKESVITKLTGGLAGMAKARKVKVVRGLGKFLDANHVEVELTNGTG
    QDLTGQKEVVRFQKAIIAAGSQPVKLPFLPDDPRIVDSTGALLLKSIPKRMLVIGGGIIGLEMATVYSTLGSRINIAEMM
    DGLMAGADRDLEKVWEQFNAGRFEKIMLKTRAAKAEVKSDGIQVSFEGENAPSEPQTYDLVLVAVGRTPNGKKIDAGKAG
    VQVDERGFIPVDKQMRTNVSNIFAIGDLVGQPMLAHKAVHEGHVAAEAAVGEKSYFDAKQIPSVAYTDPEVAWAGLTEEQ
    CKAQGIAYEKGLFPWAASGRAIANGRDEGFTKLIFDAATHCIIGGGIVGTHAGDLIGEVCLAIEMGADAVDIGKTIHPHP
    TLGELVGLAAEAAHGHCTDLPPVKKKS

    >gi|171463822|ref|YP_001797935.1| thioredoxin reductase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MTTNTPKHSKVLILGSGPAGYTAVVYAARANLNPTLITGLAQGGQLMTTTDVENWPADADGVQGPELMDRFLKHAERFNT
    EIIFDHIHTAALKEKPIRLVGDSGTYTCDALIICTGASAQYIGLPSEEAFMGHGVSG
    CATCDGFFYRNQDVCVVGGGNTA
    VEEALYLTGIAKKVTVIHRRDKFRAEPILNDRLMAKVAEGKVELKLNATLDEVLGDEKGVTGVRIKKQDGSTEDIVVTGA
    FIAIGHKPNTELFVGQLDMNNGYLKTHSGLEGNATATNIPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLETLE

    >gi|171463832|ref|YP_001797945.1| hypothetical protein Pnec_1175 [Polynucleobacter necessarius subsp. necessarius STIR1]
    MSSGALVVMCPMCLKQAGYTESDLIPGIKIGSPKLTGDTLFKDGTQDNELVIEHFLNF

    >gi|171463858|ref|YP_001797971.1| protein of unknown function DUF395 YeeE/YedE [Polynucleobacter necessarius subsp. necessarius STIR1]
    MWFVLGGFIGSLCIAICTKKLRIHSVPALWGKFKDKSSVKRLAYSFLGGFILILGARIADGCASGLILSGNMEMAVSSFV
    FAICVTLSYFVFTKYFYKKG

    >gi|171463977|ref|YP_001798090.1| heavy metal translocating P-type ATPase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MNKTNSLICYHCSSQILPADLIEAELGGESRLFCCPGCMAIAQTIHGEGLEVFYARRSQSGDKPAAYLASNEIPEKLKPY
    DDPSLLGRFTRADGGGDDLVTTLRLEKIR
    CAACVWLCEQHLRRIAGVKDVQINYVTQKVIVHFSPEKTSLARLLFEIERI
    GYEAWPFEHSQSLDKAKTERRKLLMRLGVAMLGMMQVMMYAWPTYTGSDITPEFDLLMGWASWALTVPVMVYSAGPIFQA
    AWRSLRSFRQTYTLGMDVPIALALALAFIAGSINLVTGSGKSYFDSITMFVAFILAARYVELLARQDAQGGAEALAKQLP
    ATCERAPNYPASQEIEVVPVVNCNPGEVLRVSPGEVVPADGILIENVSALDESLLTGESKPVEKTIGDRVYAGTHNILNP
    FFMRVDAVGQSTRIAGIASLLDQALLAKPVMVSLAEKWTAYFVAFLLLSAFASSAIWFYFDPSRAWTVLVSVLVASCPCA
    LSLAVPTAMAAAQGAVTKLGLLIVRGHVIEGLVKATDLVLDKTGTLTMGQPELQEIINLRPGYCREDALALAAALEVGQR
    HPLALSLIRAAEAENLSLPALSEPVTNLLGRGLSSGAYRLGSALWLGVEQGAQLGQYGQVHLADEDGLVASFIFLDTPRV
    GLEQFLKTVKARNISVHLVSGDDQETVAWWAHHVGIESYQGGCTPEDKYDYIECLQKEHRFVWAIGDGVNDAPLLARADV
    SIAVGAGAPLAAAGADAILTAASLEPLAKTLLLADKTQTIIKENLWWALVYNLLAIPAAMMGWVNPWVAGIGMSLSSLAV
    TLNAWRLRKV

    >gi|171463984|ref|YP_001798097.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Polynucleobacter necessarius subsp. necessarius STIR1]
    MKAKFLIPLILFAGLVMFLAIGLNRDPHEVPSPLINKAAPAFEIPQLSEPNKTLSPASMKGQVWILNVWASWCVACREEH
    PVLVELAKSQVAPVIGLDYKDKREDALAMLSKQGNPYALSAFDGNGRVGIDYGVYGVPETYIIDKAGIIRFKHIGPLTMD
    ILNQKIYPVLSELKK

    >gi|171464005|ref|YP_001798118.1| peroxiredoxin [Polynucleobacter necessarius subsp. necessarius STIR1]
    MSIINTVVQPFKTEAFHNGKFVTITDESLKGKWSVLIFMPAAFTFNCPTEIEDAAENYAEFQKMGAEVYIVTTDTHFSHK
    VWHETSPAVGKAKFPLVGDPTHTLTNAFSVHIPEAGLALRGTFIINPEGVIKTAEIHSNEIARDVSETLRKLKAAQYTAA
    HPGEVCPAKWKEGAATLTPSLDLVGKI

    >gi|171464006|ref|YP_001798119.1| alkyl hydroperoxide reductase, F subunit [Polynucleobacter necessarius subsp. necessarius STIR1]
    MLDTNIKSQLKVYFEKIVSPIALVASLNDSDSSKQMLELLNEVAEQSDKITVKTDGKAARTPSFTVGKVDQEARITFAGL
    PMGHEMTSFILAILQASGYPAKVEQEIIERITNLEGKRSFQTFISLP
    CHNCPDVVRALNLMAALNPNITHEMVDGALYQE
    LVDQFQIMAVPTVILNGEVFGQGRMSVEEIVAKLDNSSPKEEAAKLSAKDPFGVLVIGGAPAGSAAAIYAARKGIRTGIV
    AERFGGQVMDTMGIENFISVKETEGPKLVQALEQHVKSYAVDIMNLQRANALRKTAGGVEVELANGVALTSKSVILSTGA
    RWREMNVPGEQEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLIEFDSKLRADAVLQKKMASMP
    NVTVIMSALTKEVLGADGKVSGLRYQDRTNNTEHAIELEGIFVQIGLLPNTDWLKGTIDLSKHGEVIVDAKGETSLPGVF
    AAGDCTTVPYKQIIIAMGEGAKASLGAFDYLIRSSVVEPEEAVAA

    >gi|171464026|ref|YP_001798139.1| Rhodanese domain protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MTSLISANQLEEIINSGENVLLCDSRFDLVDPLIGRKSYEESHIPGAIHVDLDKDLSGNRNGTNGRHPLPSPEAWAKTKT
    RLGISPNTLVVAYDKQGSVYASRLWWMLKATGHANVRVLDGGLDSWNGPMGSIPRAPTPSNQTIAPMPYAGLVLVDEVVT
    NLTTNKNKIMDARAEDRFHGQNETLDPVGGHIPGAMNRFFKNNLNATAFKTPEQLFKEYSECLGPIKASEVIHQ
    CGSGVT
    ACHNLLSMEVARFKGSRLYAGSWSEWCADPKRPVEL

    >gi|171464139|ref|YP_001798252.1| OsmC family protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MRKVVSQFGNGPLQQKLTAGDLHFLSDAETSKGGSGTGPSPHEYLGAALAACTSMTLKMYAGRKTMNLENAIVTVDIERV
    NDVETFFS

    >gi|171464140|ref|YP_001798253.1| Rhodanese domain protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MKLKIGYQELIQSAMAEIETLPLEKVQQLLTDPDVVFVDIRDIRELEREGMIPNAFHAPRGMLEFWVDPDSPYYKPIFGE
    GKRLVLY
    CASAWRSALSTQALQRMGVPNICHLEGGFSAWKKAQLPTVEKISKLHSS

    >gi|171464165|ref|YP_001798278.1| iron-sulfur cluster assembly accessory protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MTQLATQETAQPAQDLAEPPTPLVFTDSAAAKVADLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDDAVNEDDTLFEKNG
    VTLLVDSMSFQYLVGAEIDYKEDINGSQFVIKNPNAQTTCGCGSSFSA

    >gi|171464226|ref|YP_001798339.1| glutaredoxin 3 [Polynucleobacter necessarius subsp. necessarius STIR1]
    MPPVTMYSTQVCPYCVMAEKLLVKKGVANLEKILIDRDPAQREVMMTRTGRRTVPQIYIGDTHVGGYDDLVALDRAGKLD
    PLLA

    >gi|171464227|ref|YP_001798340.1| Rhodanese domain protein [Polynucleobacter necessarius subsp. necessarius STIR1]
    MNFLTQIDNLALIALLLVSGAALFLLTLSTLIGGKGLSPTKATIWINRRKAYVLDLRSDEEFKTGHLPGAKFANASGLTA
    AIEKLKLDRKFPVILV
    CETGAQSKKLVTEAQKLGFSEVGTLDGGMQAWKVVALPLVK

    >gi|171464249|ref|YP_001798362.1| glutathione peroxidase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MLRNLMNWLFGLFILLSGLQLAYAASNLQAAPLPHLPHLQDEAPQNLCQYQGKVILVVNTASFCGFTSQYEGLEKIYTKY
    KDQGFVVLGFPSNDFGQQEPGSNKDIADFCKNTYEVKFPMFAKSMVSGNNPNPLFKMLIAKTGTTPKWNFL

    >gi|171464252|ref|YP_001798365.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp. necessarius STIR1]
    MISFSKRAITLLALLFLSGFASAQTQKIEEGFDYRILPIAQPVEAKGKVEVIEFFLYGCPHCYDFGPELSGWVKRQPKDV
    VFKRVPVAFRDDLMPHSQLFYALEAMGKGDALNEKVMYAMHKENKRLLTESEIADWVASQEIDRNTFLATYRSFAVISKA
    RAAKQMAEAYRIDGVPTIVMQGKYVTSPSIAGSKTKAIVVMDYLEQKIRKDKYKQ

    >gi|171464210|ref|YP_001798323.1| electron transport protein SCO1/SenC [Polynucleobacter necessarius subsp. necessarius STIR1]
    MNLLRICFLAILCFVLTACSPKPKFKNIDITGSTAFGKDFSLLDSDDKVRTLTDFKGKVVVMFFGYTQCPDICPTTLTEM
    QQVMALLGPQSDKVQVLFVTVDPERDTAEILKQYVPAFDPRFLGLRPADEAGLEKVTKDFKIYYKKVPGTKPGSYTMDHT
    AGSYAFDPEGRLRLYVKHAQGPETLAHDLKELLK