Polynucleobacter necessarius asymbioticus QLW P1DMWA 1 uid58611

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145588270|ref|YP_001154867.1| protein-disulfide reductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MRMQSFLKTAIALLLLFAAQVFAATDFLPPEKAFKAEATWLENSNQIEIEFLPSKGYYIYQESLKFQAGTDVGKLSSVKP
    SLPAGIEKFDETFQKKLQIYKQPFLVSLEIKPIAGKPVLVEVTLQGCAEAGICYPPMTLKFLLAGPGVKAAPIPDALDGT
    QGVVSQDQEEFSLSNLWRERDNVNAIGRFLENTSTTYLFLAFFVLGLALAFTPCVLPMLPILSSVIFGVQDGKAVSRARA
    SLLALSYVLGMALVYALAGVLMAALGGSVQRALQSPLALGAFALLLLALSGSLFGLYDLRLPQSWHHHVDRLAGRHQGGS
    VFGAFALGGISTLVASPCITAPLAGVLAFIAQTGSMSLGAGLLFVMALGMGLPLLFIAIEARILIPSTGIWMVWLQRTLG
    VLLVATAAWIASPLMQKNTGIDAVSVVNGQKERHVGELSFAVIYSPAELDVQLNKAKQENKLVLLDFYADW
    CISCKEMEV
    NTFTNAEVSKELKQFVLLQADVTANSPENQALLKRYGLYGPPGILIFTQNSEELKALRIIGYMPPQRFLEQLQKIVRN

    >gi|145588316|ref|YP_001154913.1| glutathione S-transferase domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MMVLYSGTNCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PPDPVARARARLFLFNFEKELFVHVAALENEKGKAADKVHEKARLAIRDRLTQLAPIFVKNKYMLGDEFSMLDVAIAPLL
    WRLEHYGIDLSRNAAALLKYAERIFSRPAYIEALTPSEKVMRR

    >gi|145588322|ref|YP_001154919.1| glutaredoxin-like protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MDTQAQIKEIVTSHPVVLFMKGNAQFPQCGFSGNAINILKASGVEKLHTVNVLEDEGIRQGIKQYANWPTIPQLYINGEF
    IGGSDIMTEMFQSGELQKLVKG

    >gi|145588328|ref|YP_001154925.1| putative thiol:disulfide interchange protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MIKFLSAVLICVGLICSTSVQAQAEQQIKVDIQKKLGTTVKVKSVHPAPISGLYEVLVGNDIFYTDASGKYLFQGEIIEL
    ATGKNITEQRQNDLNRIKWSDLNQSNAFKTVRGNGSRQLAIFSDPN
    CGYCKRLEKSLQQLDNITIYTYLIPILSPDSAQK
    AKQIWCSADPSKTYIDWMVNGVTPNGKSDCTTPLDKNLAFAKTYGITGTPTLFFIDGSRFPGAVQITDIEKKFGSLK

    >gi|145588361|ref|YP_001154958.1| redoxin domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MISVGQKLPSATLYEFLNEETEGCALGPNAFEVEKLAAGKKIVIFALPGAFTPTCSAKHVPGYVEHYDEIKAKGVDEIWC
    ISVNDPFVMGAWGRDQKVGKKIRMLGDGSCEFTKKMGLELDLVARGLGVRSDRYAMIVEDGVIKTLDREAPGKFEVSDAA
    SILKKL

    >gi|145588376|ref|YP_001154973.1| methylated-DNA--protein-cysteine methyltransferase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSELLFIYVRMGIMKLSQQPASSNSAQYCVIAAPFGRLGILTELVEGSLMVSKVDYLSKEAPLSTPKNELAKEVARQCKA
    YFADPLYQFDLPLKPAGTIHQQKVWKHIQAIPVGKTQTYGELAAKIKSGPRAVGTACGANPYPLISP
    CHRVVSTQGIGGF
    MKENAPGLYRQIKLWLLQHEGVL

    >gi|145588400|ref|YP_001154997.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNRRQWITITGISLLALFAGILSSRWISKTGLASDPSIKAFFANTWQTPDGKVVDTKNWQGKVLVVNFWASWCPPCVEEM
    PALDKLQQEYLQKNVLFVGIGIDSPSNIREFLQKTPVSYPIVIGGLEGSNLSKQMGNSQGALPYTVIISPNGKSTYTKLG
    KISEEELRKAINSAL

    >gi|145588569|ref|YP_001155166.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MLHSPIEADAVIIGAGPVGLFQVFELGLLEIKAHVIDSLPEAGGQCIELYPDKPIYDIPAVPVCTGRELTQNLLKQIEPF
    GAQFHLGQEVRTLEQQADGRLLIGTSQNQYFLSKTVFIAAGVGAFQPRKLALEGIEALEDKHIFYHVKHPEQFSGKKIVI
    CGGGDSALDWALFLVEKAASVTLIHRRDDFKAAPKSIAKMRELCASKQMQLLIGQITSYEAQDDHLKEIVVTDIDGKTQA
    LPVDDLLIFFGLSPKLGPIAEWGLDIERKQLVVDTEKFQTSIPGIYAVGDINIYPGKKKLILSGFHEAALAAFAAAAYLN
    PEKQIQLQYTTTSPKLHKALGVGSPTFE

    >gi|145588616|ref|YP_001155213.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MTVAIGQPIPPCSIPATSSLTFSPASAKGKKLVLYFYPKDMTPGCTAESGEFRDNIEAFTKANTLIVGVSRDSLKSHDNF
    RSKLQLPFELVADTEEILCQLFGVIKMKNMYGKQVRGIERSTFLFDSSGKLAQEWRGLKVPGHVTDVLQAAQATK

    >gi|145588638|ref|YP_001155235.1| heavy metal translocating P-type ATPase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNKATHMTCYHCSSVILPGELIEAELGGILRPFCCPGCMAIAQTIHGEGLEVFYVRRAQSGDKPAAYLASNDIPEKLKPY
    DDLSLRGRFTRPYGDTGVLETTLRLEKIR
    CAACVWLCEQHLRRIDGVSDVQINYVTQKVMVRFSPEKTSLARLLFEIERI
    GYEAWPFEPSLSLDRVKKERRQLLTRLGVALLGMMQVMMYAWPSYVGANDITPEFDLLLGWTSWALTVPVMVYSAGPIFQ
    SAWRSVQSFRQIHMLNMDVPIALALALAFIAGTINLITGSGQSYFDSITMFVAFILAARYVELLARQDAQGGAEALAKQL
    PATCERLHSYPDSFEVEVVPVVNCNPGEVLRVSPGEVVPADGVLIENASALDESLLTGESKPVEKKIGDRVYAGTHNILN
    PLLMRIDAVGQSTRIAGIASLLDQALLAKPVMVSLAEKWAAYFVGCLLLSAFISSAIWLYFDPSKAWTVLVSVLVASCPC
    ALSLAVPTAMAAAQGAVTKLGLLIVRGHVLEGLVKASDLVLDKTGTLTMGRPELQEVIHLRAGYRREDALALAAALESGQ
    RHPLALSLLRAIESERLSLPILADPVINLLGKGLSSGSYRLGSAAWLGITPDARVGQYGQVHLADDQGLIATFVFLDTPR
    PGLVNLLQAAKTRNIRVHLVSGDDPATVAWWASHVGIHSYRGGCTPEDKYEYIEQLQESGRFVWAIGDGVNDAPLLARAD
    ISIAVGAGAPLAAAGADAILTASSLEPLAKTLKLADKTAVIIKENLLWALIYNLLAIPVAMMGLVNPWIAGIGMSLSSLA
    VTLNAWRLRKA

    >gi|145588671|ref|YP_001155268.1| rhodanese domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MREKMKSILNIAAYLFVSLDALTDLRAKMLDECNARNLKGTILLTGEGINMFLAGGENEMRGFLEWLRSDPRFQTMQAKE
    SWSDTQPFKKMLIKLKNEIIRMNHPSIRPEEGRANFIAPKKLQEWLDRGTDDLGRPVVMVDTRNAFEVEYGTFENALHFN
    IEKFTEFPAAISAQKEALAGKTLVSF
    CTGGIRCEKSGLYMREIGMDHSYQLEGGILKYFEEVGAAHYKGSCFVFDEREAL
    EPNLETIPIEQSIRKKLKTE

    >gi|145588728|ref|YP_001155325.1| glutathione S-transferase domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MPPILYSYRRCPYAMRARMALKYAGIEVEHREIQLRSKPQSMLRLSPKGTVPVLCVGDQILEQSLDIIDWALDQADPDGW
    RSADESISQAWIDKNDGPFKKLLDQYKYLERHPELNQEEVLAQAMDLMLVPMETVLKSTQYLMGEKKSWVDVAIFPFIRQ
    FAMADLEKFNDLSLPALKRWLNHYLESELFLSVMHKYPAWTD

    >gi|145588847|ref|YP_001155444.1| peptide methionine sulfoxide reductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNEITDKNLPTLERATLGGGCFWCLEAVYQQIQGVKSVVSGYAGGARPNPSYESVCTGATGHAEIVDIEFDPKVVSFRDL
    LEIFFVIHNPTTLNYQGNDHGTQYRSVIYTHSDEQAKIANEVVQELEDSKIYADPVVTQIESAPTIYPAEDYHQNYFQQH
    PHQGYCAAVVAPKLAKFRAKFKSLIAPQYA

    >gi|145588863|ref|YP_001155460.1| redoxin domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MKKFLIVFTCLFVMMQSVMAGGETVKPYQKGDWKTLMKPYAGQTVIIHFWGVTCAPCAKEMPLWGKFLAQNKNANIVFIQ
    VDDVSSESVIKMLNIANISSSASYTLATPFDDSLRYEIDPKWRGETPFTLLIDRNGKVIRKTGSLDFDKLKQWYSQAG

    >gi|145588874|ref|YP_001155471.1| thioredoxin reductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MTTNTPKHSKVLILGSGPAGYTAAVYAARANLKPTLITGLAQGGQLMTTTDVENWPADADGVQGPELMDRFLKHAERFNT
    EIIFDHIHTAALKEKPIRLVGDSGTYTCDALIICTGASAQYIGLPSEEEFMGRGVSG
    CATCDGFFYRNQDVCVVGGGNTA
    VEEALYLTGIAKKVTVIHRRDKFRAEPILNDRLMAKVAEGKVELKLNATLDEVLGDEKGVTGVRIKKEDGSTEDIAVTGA
    FIAIGHKPNTELFVGQLDMHNGYLKTHSGLEGNATATNIPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLETLS

    >gi|145588921|ref|YP_001155518.1| dihydrolipoamide dehydrogenase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MAKQTILVPDIGDYSDVPVIEVLVKVGDVIEKEQPLLVLESDKATMEVPADASGTITSITVKLGDKVSKGSVIAEIEASA
    GAAKPAPAVAPIAAPAPAAVSAPVAAPKAGQHSGKVDHECEVLVLGAGPGGYSAAFRSADLGMNTIIVERYATLGGV
    CLN
    VGCIPSKALLHTTSVMDEVKTMAKHGITFGAPKIEIDQLRGYKDSVIAKLTGGLAGMAKARKVKVVRGLGRFLDANHVEV
    ELTDGTGQDLTGKKEVVHFQKAIIAAGSQPVKLPFLPEDPRIVDSTGALLLKSIPKRMLVIGGGIIGLEMATVYSTLGSR
    IDIAEMMDGLMAGADRDLEKVWEKFNAGRFEKIMLKTRAAKAEVKPDGIQVTFEGENAPAEPQTYDLVLVAVGRTPNGKK
    IDAGLAGVQVDERGFISVDKQMRTNVPNIFAIGDLVGQPMLAHKAVHEGHVAAEAAFGEKSYFDAKQIPSVAYTDPEVAW
    AGLTEEQCKSQGIAYEKGLFPWAASGRAIANGRDEGFTKLIFDANTHRIIGGGIVGTHAGDLIGEVCLAIEMGADAVDIG
    KTIHPHPTLGESVGLAAEAAHGHCTDLPPVKKKS

    >gi|145588973|ref|YP_001155570.1| protein of unknown function DUF395, YeeE/YedE [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSETKISNLPQPYWNPLVAGILLGMVLLTTFVITGHGLGATGFTTRLTAWLGMNLAPVATSANDYLGGMVEDGKPLNAWI
    TWQVAGVAIGALISAYFAHRIQFQMDGRKFLGGSKRPITALMGGVLAGFGARIAAG
    CTSGLGLSGAAVLSLAGFTFLCTF
    FAVGLLANRFIKEEK

    >gi|145588977|ref|YP_001155574.1| rhodanese domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MKKIQWMLAVVLSSLIGLVHAIDLPGPVVTADWLSKNQSEVQIVEVRTDAASYLKTPEFDVDKKTGKKFLVEMGGHINNS
    SLLDFKKVRVERVVDGKKVKFLIPEKADFEKLIQSAGVNADKPIILVPVGQDMSDVDEALRTYWEFKVYGEDRVAVLDGG
    IAGWLNEGREFTTTNSQKADGNWVAKAYRKELIASSDEVAAASKTGKPQLLDARQPAQYWGVAKSPSVLTYGHIAGAKEL
    APELLAKPSNGALYFWSKNTYEALMAGNGLSNKAPTITY
    CNTGHLAAGGWFVMSELVGNKSTKLYDGSLHLWTLEGRPLV
    GVPLN

    >gi|145588996|ref|YP_001155593.1| protein of unknown function DUF395, YeeE/YedE [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MEVLDIHSLGKAVLWTTFAITFALGMVMQKTGFCTMGAISDVFIISSWNRLRQWFLAIGVAILGFTFLAHLGLIDSLKTI
    YTSNKFLWLSTIVGSILFGMGMVLASG
    CGSKTLVRIGGGNLKSVIVFMVLGLTAYMTLRGFLGVIRINTLDTVFITFASP
    QDLPSLLSAPLGMARANLHLALGLIIGIAFIAYALADKAFRTAENIFAGISVGLAITAVWWVSGSLGHLAEDPNTLEEVF
    LLTNSGKMESLSFVAPYAYSLDWLMMYSDTSKVLTIGIVAVVGMILGSAVVAVMTKSFRWESFHNSEDTANHLVGAALMG
    FGGVTALG
    CTVGQGLSGISTLALGSLLALPGFIFGGYLGVRYLQMRLAPNPCS

    >gi|145588997|ref|YP_001155594.1| protein of unknown function DUF395, YeeE/YedE [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MQIDWLSFTPIPSLLGGMMLGVAAALYVVLHGRILGISGIVSGLIHPKAGDITWRLSLVLGLLSAPFLAALIFDIRPIIQ
    IDTEWLGIITAGLLVGFGVQYGSG
    CTSGHGICGLSRLSPRSLVATLTFMGAGFITVFVLRHLIGA

    >gi|145589027|ref|YP_001155624.1| dihydrolipoamide dehydrogenase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSQAFDVVVIGGGPGGYIAAIRAAQLGFKVACAESSSFDDPKGEVRLGGTCLNVGCIPSKALLASSEEFEKISHHATDHG
    IKVGAVSIDSKKMIARKDDIVTKMTGGIQYLFRKNKITLLKGHASFEGKGADGYQIKIDGKDTETVTAKNVIIATGSKAR
    HLPGITVDNVLI
    CDNEGALKFDSAPKKLGVIGAGVIGLELGSVWRRLGAEVTVLEAMPSFLGACDISIAKEAQKLFAKQG
    LSIHTGVKIGDVKADKKGVVVNYTDSSGKAAKLECERLIVSVGRVPNTDKLGLDKIGLKVDERGFIPIDDHTCATAAPGV
    YAVGDVVRGPMLAHKAEDEGVLVAEVIAGQKPHIDYNCIPWVIYTDPEIAWVGKTEQALKEAGIAYKAGQFPFAANGRAL
    GMGRADGFIKVLADAKTDEILGVHIIGANASDLIAEAAVAMEFKAAAEDIARICHAHPSLSEVMREAALATDSRALNM

    >gi|145589154|ref|YP_001155751.1| hypothetical protein Pnuc_0971 [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MAFTLSGDDACRTTFPTPIPDPYWVAFSPSASQLIHLELDASGLPVDSSWLEVLAGNQLKTSSHEFSNPIATAYSGHQFG
    VWAGQLGDGRAILLGEIAGQELQLKGAGKTQYSRMGDGRAVLRSSIREFLCSEAMHALGIPTSRALSVVGSDMPVRRETI
    ETAAVCARLAPSFLRVGHFEHYAASQNQVRVKELADLLIQEHYPDCLSSKDPYLELFKQICIRNAELVAQWQAVGFCHGV
    LNSDNISAIGITLDYGPFGFLDEFQIDHICNHSDQAGRYAYHRQPQIMHWNMACLASTFIPLLENQYSEEKAQDILRDAL
    EIFPKSYASTWQSLFRRKLGFAIDHENDIKLVERLLQAMHDSRVDFTTLFRKLSDIKKTDCVDAIALRDEFIDRVSIDQW
    LSDYLLRLQMELDDDATRKIKMDGVNPKFILRNHLAQEAINKAQQHDYAEIKTLLNILSRPFDDQPQHEKYAIAPPKDLQ
    KVDVS
    CSS

    >gi|145589155|ref|YP_001155752.1| methionine-R-sulfoxide reductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MKKTDQEYKQSLSDIEYRVTREAATERPFSGKYWDHWDQGKYSCVCCGTLLFLSNTKFDAGCGWPSYNAPEQAAAIKEIK
    DASHGMIRTEVRCSHCDAHLGHVFDDGPMPTGLRY
    CINSASLSFEPGDNAKLTK

    >gi|145589488|ref|YP_001156085.1| thioredoxin [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSAGIKYVTDASFEQDVLKSDKPVLLDFWAEWCGPCKMIGPILEELSGEYGDKLQIAKMNVDENQGVPAQFNIRGIPTLI
    LFKNGTVAAQKVGALAKSQLSAFIDSNI

    >gi|145589525|ref|YP_001156122.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MTIINKPALRFFLALAFVLNVTISNEAVAQWRPASEAGLTQAPPLQLNNLAGKAVDLNALKGKVVIVNFWASWCEPCREE
    FFELIQLQENYQAKGLVVLAVNLAEMKPRITQFLKGNGLPENGIEILQDRNSIAYKSWKARGLPTSFLVGKTRKIEGVWI
    GAIENVDSNEVKGKIEVLLRQ

    >gi|145589526|ref|YP_001156123.1| selenide, water dikinase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNTETPSSEPRLTSLSHGGGCGCKIAPGVLSDILQSVPQLPFPKELLIGIETADDAAVYQINESQAIVATTDFFMPIVDD
    PFDFGKIAATNAISDIYAMGGTPLFALALVGMPIKVLSNKTIARILEGGAEACRSAGIPIAGGHTIDSVEPIYGLVAIGL
    VDPKNIKSNASAQAGDVLILGKPLGVGILSAALKKDLLGPEGYREMIANTTKLNSAGPELAKLSGVHALTDVTGFGLAGH
    TLELAKGSGCTAHIDWSQVPLLSNVQTLADDGVITGASDRNWASYGDKIGLPADFTIAQRALLTDPQTSGGLLVSCSPDS
    VQNVLNIFSQHQFLGARVIGQMSKLQNKHVVISA

    >gi|145589563|ref|YP_001156160.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSKTTFKSALLLIGALTLSLQLNIAYSQTPSSTPTTEQIIQSLEKSGALDRAIDRGIERYRQKQINAAQAKQQKEEAQKV
    AMAKNARAVDVKNDFIYGKPDAVISIIEYSDFE
    CPFCKQFGDIPNKVVDSMPDQVNLVWRNFPLSFHDPVATKEAIAAAC
    AAQQGGNNAFWKYAQGIFKNTRSNAQGMPSVNGVDPLLALAKEQGLDTDKFSTCMQSEAVAKQVSADLEDGMNAGISGTP
    GVILVNHKTGAFNVLAGAVPEDVLKQEVKNLLNAKK

    >gi|145589588|ref|YP_001156185.1| heavy metal translocating P-type ATPase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSPPKETNSHLFTLDIGGMTCASCVGRVEKALNQTPGVEAASVNLATEQAKIRLQTGAETTINSVIASVQKTGYDAKIST
    PNGKSEIKPQQALWGSDGLGRVLLSFTLSAPLFLPMLLMPFGIHWSLSPKWQLLLASPVQFFFGWRFYKAGFKSVLAGAG
    NMDLLVALGTSAAYGLSVYLMVASPHANHELYFEGSSVIICMVLLGKWLEARAKQQTSEAIRALQKLWPEQAKVLLPEAV
    IEGNAFLDQYRELALDQVFAKDRILVLPGERIPVDGVILFGSSHIDESLLTGESEPVKKTLEDKVIGGSLNGEGVIVVDA
    QAVGIESVLSKIITLVEDAQTQKAPIQKLVDQVSAIFVPSVLIIALLTGLVNWFYLDSAAIAILRAVSVLVIACPCALGL
    ATPAAIMAGTGVAARFGILIKDPQVLEQAHRLNIVAFDKTGTLTIGKPRLLSLIPLSEKFNRSDILATAAGLQLGSEHPL
    AKALLDAAKEAGISPFPPTESKAIPGVGITGKTNSGPWSKQNLSLQSVASLHAGLETGNIAQKAQACLEAGQTVSVLMSK
    DIPETPIAIIAFGDELKSNAQQAIKALHQLRIRTVMLSGDNSAAANRVGNSIGIDEVFGQIMPSNKAEIIRKLQSADADH
    SRQWVAMVGDGVNDAPALAAADVGMAMSTGTDVAMQAAGITLMRGDPSLVADAIDISKRTWQKIQQNLFWAFIFNATGIP
    LAALGYLSPMLAGSAMALSSFCVLSNALLLKRWRPGQV

    >gi|145589659|ref|YP_001156256.1| disulphide bond formation protein DsbB [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSKSQYLYLSLLSLALVAFAVILQQVGYQGVSFLPCPLCILQRVGYLGIAICCILAVGVQPLRKFFHGLAIIAAGYGLSV
    AAHQVWLLSHPESS
    CGIDPLETWINQFQLAQGLPWLFKADGLCSAQLPSILGLQVPEWSLLWFGIFLAVLLVTFFRKQK

    >gi|145589672|ref|YP_001156269.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MAITLTDKAAKHVNRNLEKRGKGCGLRLGVRTTGCSGLAYQLEYVDEPAPEDQVFESNGVKVFIDPKSLAYLDGTELDFV
    REGLNEGFKFQNPNVKDECGCGESFRV

    >gi|145589693|ref|YP_001156290.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MKLKFLIPLLLFVILVGFLAIGLNRDPHELPSPLIGKPAPAFQVPQLEQANKTFSPESLKGQVWILNVWASWCVACREEH
    PMLLQLSKAQIAPLIGLDYKDQRDDALAMLARQGNPYTLSAFDGNGRVGINYGVYGVPETYVIDKAGIIRFKQIGPITTE
    ILHQKIYPLINELKKS

    >gi|145589715|ref|YP_001156312.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSIINTAVQPFKTEAFHNGKFVTVTDESIKGKWSVFIFMPAAFTFNCPTEIEDAAENYAEFQKMGAEVYIITTDTHFSHK
    VWHETSPAVGKAKFPLVGDPTHTLTNAFGVHIPEAGLALRGTFIINPEGIIKTAEIHSNEIARDVSETLRKLKAAQYTAA
    HPGEVCPAKWKEGAATLTPSLDLVGKI

    >gi|145589716|ref|YP_001156313.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MLDTNLKTQLKAYFEKIVDPITLVASLDSSPSSAQMLELLTEVAEQSEKITLQTDGKSGHVPSFTVGKSGSDARITFSGL
    PMGHEMTSFILAILQASGYPPKVEEDVIARIKTLNGQFKFQTFISLS
    CHNCPDVVQALNLMAALNPQIEHEMIDGALFQG
    LVDQYQIMAVPTVILNGEVFGQGRMGVEEIVAKLDTGSSEEEAAKLNAKDSFDVLVIGGGPAGSAAAIYAARKGIRTGIV
    AERFGGQVMDTLGIENFISVSHTEGPKLVQALEQHVKSYEVDIMNLQRANALRKTANGIEVELANGAVLNSKSVILSTGA
    RWREMNVPGEQEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVSHVTLIEFDSQLRADAVLQVKLASLP
    NVTVIKSALTKEVLGDGSKVNGLRYQDRISNEEHAIELEGIFVQIGLLPNTEWLKGAVELSPRGEVMVDAKGETSVPGIF
    AAGDCTTVPYKQIIIAMGEGAKASLGAFDYLIRHSVSEEAPVKVAA

    >gi|145589822|ref|YP_001156419.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MKPTIKIDYVSDVACPWCAVGLGNLNQAMAQLSDKINFEVHFRPFELNPKMPHGGQDAIEHLTEKYGLTAEQVKVNQANI
    RTKALEAGFAFHPDGRKRVYNTFDAHRLLYWAGKEYDLQKQAALKKELLNTYFCLAVSLDDPENVLDAVMRAGLDKDRAQ
    EVLKGNEYSKEVRDEEATYTSAGISSVPSIIIDDQYLLQGAQPPEAFVNAFEQINKTI

    >gi|145589857|ref|YP_001156454.1| heavy metal translocating P-type ATPase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MSECNTSCSCSASTPVTKASEMPSKNKAIYRIENMDCPTEEALIRKKLASVSGIESLDFNLMQRMLTVGHNLNSLDAIES
    ALGSIGMQAVLQSGETSTKGGSIEPMPKTNWWPLAVAGITATLAEIMELLQLGNQWIVITLVIASIASGGLTTYKKGWIA
    LKNSNLNINALMSIAVTGAMAIGSWPEAAMVMFLFTLAEVIEAKSLDRARNAIRGLLDLTPETATVQQADGSWVLTDVKA
    IALGALVRVRPGERIALDGILISGNSAVNQAPITGESLPVDKIVGDEVFAGTINQTGSFEYKVTAEATHSTLARIIHAVE
    AAQGSRAPTQRFVDQFAKIYAPAIFLLAVLVAVLPPLLMAQSWQEWIYKALVMLVIACPCALVISTPVTIVSGLAAAARK
    GILIKGGAFLEAGRSMKVLALDKTGTLTYGKPAQTDFFVLSGNDKYIHEIAISLAARSDHPVSLAIAHANQEQKNDLKTV
    DSFEAILGRGVKGVIEGNLYYLGNHRLIEELGLCSDDIENRLLPLEQQGKTAVLLTNQTEVLAIIAVADTVRETSKQAID
    ELHQLGVTTIMLTGDNQHTAKAIGKQVGVDEIMGNLLPEDKLKIIDSRLKKDPNVKVGMVGDGINDAPALARASIGFAMG
    AAGTDTAIETADVALMDDDLRKIATFIRLSKSTALILTQNIVLALGIKAIFLVLTFTGQATMWMAVFADMGASLLVVANG
    LRLLRS

    >gi|145589888|ref|YP_001156485.1| 3-mercaptopyruvate sulfurtransferase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MTPLITANQLEEIINSGENVLLCDCRFDLVDPLIGKKSYEESHIPGAIYVDLDHDLSGPKTGSNGRHPLPSPEVWAKTKT
    RLGIAPNTLVVAYDKQGSVYASRLWWMLKSTGHANVQVLDGGLDSWNGPMGTVPRQPKPVTQAIEARPYVGLVLVDEVLA
    NLQTKKNVVIDARANDRFHGQNETLDPVGGHIPGALNHFFKDNLSATAFKPAEQLFKEFVEFLGPIKPSEVIHQ
    CGSGVT
    ACHNLLAMEIAGLKGSRVYAGSWSEWSADSSRPVEL

    >gi|145590035|ref|YP_001156632.1| OsmC family protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MRKVTSQFGDGSLQQKLTVGDLHFLSDAGLQNGGDGAGPNPHEFLGAALAACTSMTLKMYAGRKAMNLENAVVTVDIERN
    DEVEKFSRDIQLIGNLSVEEKERLLEIANK
    CPIHKALTGQIQIKTQLVS

    >gi|145590036|ref|YP_001156633.1| rhodanese domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MKLKIGYQALIDNAMEAIETIPLDKAQELLSDSNAVFVDIRDVRELEREGMIPNALHAPRGMLEFWVDPDSPYYKPIFGE
    GKRLILY
    CASAWRSALATEILQKMGVPNVCHLAGGFNAWKKASLPTVEKASKPHSG

    >gi|145590062|ref|YP_001156659.1| iron-sulfur cluster assembly accessory protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MTELATQPAQDLAEPPIPLVFTDNAAAKVADLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDDAVNEDDTLFEKNGVTLL
    VDSMSFQYLVGAEIDYKEDINGSQFVIKNPNATTTCGCGSSFSA

    >gi|145590066|ref|YP_001156663.1| OsmC family protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MECRVSWLGNDGMAFSAETGSGHLVNMDGAPEAGGRNLAPRPMELLLAGAGGCSAFDVVLILQRARQAISGCEVVLQAER
    ATEDPKVFTKINLHFTVKGKDLDQAKVDRAVKLSHEKYCSATTMLAKTAELTYSVEVIAE

    >gi|145590125|ref|YP_001156722.1| glutaredoxin 3 [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MQQVTMYSTQVCPYCVMAEKLLQKKGVNNLEKILIDLDPAQREVMMTRTGRRTVPQIYIGETHVGGYDDLVALDRAGKLD
    PLLM

    >gi|145590126|ref|YP_001156723.1| rhodanese domain-containing protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNFLTQIDNLALIALLVVSGIALFLPTLSTLIRGKGLTATEATIWINRRKAYVLDLRPEEAFKVGHLPGAKLANASAIAA
    AIEALKLDRKRPVVLV
    CETGAQSRKALSEVQKLGFLEVGALDGGVQAWKLAALPLVK

    >gi|145590129|ref|YP_001156726.1| UBA/THIF-type NAD/FAD binding protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNDEQLLRYSRHLLLEDIDVEGQEKLLNSHALVIGAGGLGCAAAPYLAAAGLGHITLIDHDEVEITNLQRQIMHTESSIG
    KSKVDSGKHFLCQLNSGVRIQTVQAKVTKSILDDLLPSVDIVLDCTDNFQTRHLINASCVQYQIPLVSGSALRFDGQITV
    FDLRNTASPCYACIFSPDETFEEVS
    CSSMGIFSPLVGIIGSIQAAQALQVLIGFGEPLVGRMLLWNARATNIDEIRIARN
    TECSVCGKAH

    >gi|145590149|ref|YP_001156746.1| glutathione peroxidase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MIRKILAKLAYFACSFLILGVAMEGAIAAPACSPLLSHTFLRLQDEAPQNLCQYQGKVILVVNTASFCGFTSQYEGLEKI
    YAKYKDRGFVVLGFPSNDFGQQEPGSNKEIADFCKNTYDVKFPMFAKSVVSGNNPNPLFKMLIAKTGTTPKWNFYKYLIN
    RNGEVVNSFNSMTKPTSPNVTNEIEKLLEEKPQ

    >gi|145590154|ref|YP_001156751.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MISLSKRIFVFTTFLFLSGLANAQGQKMEEGFDYRILQAPQPVEVKGKVEVIEFFWYGCPHCYDFEPDLSAWVKRQPKDV
    VFRRVPVAFRDDFLPHSQLFYALEAMGKGEAMNEKVMYAMHKENKRLMTETEIADWVASQGIDKNTFLATYRSFAVVSKA
    RAAKQLTEAYRIEGVPTIVMQGKYVTSPSIAGSKAKAIAVMDYLEEKIRKDKYKQ

    >gi|145590251|ref|YP_001156848.1| hypothetical protein Pnuc_2073 [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MEIKVNFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCETRNISTDNIRLSQNNIVDPD
    NRYQQIFKIQVELPADISANDRQGILRSIERCTVKKVVQAGPEFVIEVVENLDSDAQSLLALKPAADASTFIAGKDLPLE
    QTIANMSGVLGNLGIKIEIASWRNIIPNVWSLHIRDAHSPMCFTNGKGSTKESALASALGEYIERLSNNHFYAGTFWGED
    IGNAEFVHYPSERWFQPGPNDTLPTEILDDYCRTIYDPDGELRAIHLIDTNSGNVDRGICSLPYIRQSDGRVVYFPSNLI
    ENLFVSNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEIALPDVPQEVIAKYPRILAGIQGLEEQGFPVLVKDASLGGI
    YPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSLEGLNDLPPPTFASEAVTEPNNFVEHFIDSSGIVSWRF
    FSAKPDYEFVQWDFSSHGENSNADEAATLFGILKAMGKESYVAVYDELGAIACRILVPGYSEVYPVEDLIWDNTNKALLF
    RNDILNLSRLDNVGLEGLLERLENNELDEYGDIATLIGVEFDENTVWGQLTVLELKLLIHLALRQLDEAHELVGAFLQYN
    DNTIDRKLFYQALDAVLEVKLNEDLKLEDYIANFRRMFGNPRMDAVVGSVEGGIRFFGLTPTSTKLEGLDRHHKMIDSYR
    KLHAARAKASASGQ

    >gi|145590109|ref|YP_001156706.1| electron transport protein SCO1/SenC [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
    MNLHFLRFFCVAIICCVLAACSPKPEFKNIDITGSTSFGKDFSLLDPDGNVRTLADFKGKVVVMFFGYTQCPDVCPTTLT
    EMQQVMTLLGPQSDKVQVLFVTVDPERDTAAILKQYVPSFDPRFLGLRPADDAALEKVTKDFKIYYKKVPGSTPGSYTMD
    HTAGSYAFDPEGRLRLYIKHAQGPETLAHDLKELLK