Planctomyces limnophilus DSM 3776 uid48643

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296120476|ref|YP_003628254.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MLFHSIARNMIFIGLWLAWPALLAAGEFNTVLSIGDKAPAWSKLPGADGKEHSLADLAECKAVVLVFTCLSCPTAVDYEE
    RIEKLRKDYAPRGVEVVAVCVNQVPQDRLEAITQRVQKKGYSFPYLYDETQKIAKDYGAIFTPEFYVLDGERKIAYMGAM
    DDKTEAESVEVKYVSAALDAILSGQPVPKAEVIARGCRIRYARERRESK

    >gi|296120516|ref|YP_003628294.1| thioredoxin [Planctomyces limnophilus DSM 3776]
    MAGDHVLEITDANFQSEVLDSSTLTLVDFWAPWCGPCRMLAPTIDELATEYAGKVKIGKLNTDENPRIPSMHGISSIPTV
    LMFKGGIIVDKFVGVVPKAKLAGSISTNM

    >gi|296120804|ref|YP_003628582.1| cytochrome c biogenesis protein transmembrane region [Planctomyces limnophilus DSM 3776]
    MPYAATSQPAQTDHCDSKHADYSNHSEIDCLDFHRPSVVKGRHNTSHGLWQSLWKLSAVVLAVLVFPITAQAQFDDLFGD
    SAGDSLLGGAAAKPEVSAQLILLPEQASGLQAQHLQAQLSVTVVLPEGHYIYDVQGKFEGRTQIRTKLPEGVTAAGAFVS
    AKPPQKIFEPLFGVDLFKLHDSATWTQVLNIAPTVDLKNLVISGGLEGQYCSAGEGGQCLPIIPAIKFSTKLEGNIPERM
    AAKASTTTTVEQPAPAQMLPFRVTERLKRGVKPQPIEFTAQLTPENAKPGEKVELVLTAKIDPKYHTFSMTQPDGFGGSA
    TVVDFEQLNGLSEAGPFVADHPHEIEPGAGGPLEVYHDRVTWTKPFVVNAGQTPGAYGLKAIVHSQACTQGSCVPMPKFK
    LALGMQEPSRAGVEALPQERGSPAETGNTKAPVPPEESTRESTTGTAETSASQAGALSGVTFWEDDGDAQEESSAAAGTL
    GYLLTAFLAGWLALLTPCAFPMVPITVGFFLKQGHGKSVGLAVVYCLAIIGTFTLLGVGLSLIFGATFLTQLANNPWMNF
    AIGAIFVAFGLSMLGLFEIQPPSWLLTYTANQEAAGGYLGVIFMALTFTLTSFTCTFPVAGTILVAASQGNVFWPILGML
    AFSTAFAMPFFLLALFPSMLRKLPKSGGWLFTLKVVLGFVEIGAAIKFFSVADLSLNPQPMLFDFAFVMVAWSVLAITAG
    LYLLGIFHLSHDQPQDRISPLQALAGTTFLGLSLFLMVGVLTPEKSGGALMPQILAFAPPQLKQGFKETEELGPVMVHDG
    IPFALDVNRALSLAKSKQQPLFFDFTGVN
    CVNCRLMEQKMKLPDNHSRLERFLATQLFADRVPHITDADYAESLRDRNID
    LQVKWFGDVSLPSYAVVSPDGKTILAVYKGLERKEGEFAAFLDKGWNRFEKWKAKQVASKEPASVERR

    >gi|296120865|ref|YP_003628643.1| Redoxin domain protein [Planctomyces limnophilus DSM 3776]
    MSQRAFLYTLAGVVIAVVIFTRIYFPTKTGGEFQRQGALPAFAEEGWINGPGPTAEELKGKVLVIDLWAFWCGPCKRAVP
    EIIALKETFAPRGVVFLGVTNEGKERLKESEAFVKETAIPWPNAYGAESFFDELSVEGIPTILVVGRDGQIVWREHHPEG
    IEKAIETALAEVK

    >gi|296121074|ref|YP_003628852.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MTARVGKPAPDFSVQAYDRTKDNTDAQFTKVSLADLRGKWVCLYFYPLDFTFVCPTEIVAFDNAVGDFTDRDCVLLTAST
    DSVFSHKGWCDSHKDLATLKHLMLADTAHTLSTAYGVLDEEQGIAYRGIFLIDPTGTVRWLAVHDLSVGRSVEEVLRVLD
    ALQTDKLCPCNWKKGESTLN

    >gi|296121215|ref|YP_003628993.1| methylated-DNA/protein-cysteine methyltransferase [Planctomyces limnophilus DSM 3776]
    MVVKTPARKLRTKESQLSLAIFPSGSQDAARSAGIISGEMIPYTITPTELGLLMVAGSSRGLLYVAMSGDAESLAEDFSR
    RFEKKGLQLGVRLTDSSASKLFHWTQQILEYLAGKLRDWSLPIDMQGTPFQQEVWEALRQIPYGETRTYAQLARNIGKPA
    AVRAVANACGANPLAIVIP
    CHRVIGSDGQLTGFRWGIERKAALLQLERVLAD

    >gi|296121367|ref|YP_003629145.1| HesB/YadR/YfhF-family protein [Planctomyces limnophilus DSM 3776]
    MSPGFQRLMCCGFALMVLGCEQLSLPSLNAKPGSVPVVNETGQEQASSRPEIIITPEAFNEIRQIMKRIHVADDEYLRIV
    LKSGG
    CTGYLYELGFAEEIEEGHQVIQYQGLNIITPRHLAKVIDGTTISFLELEDRKGFQMTNPKFEGENSDYWIQWLKE
    HDQK

    >gi|296121436|ref|YP_003629214.1| protein of unknown function DUF255 [Planctomyces limnophilus DSM 3776]
    MNLVNRLAAETSLYLNQHAQNPVAWQPWDDEAWRLARELDRPVFLSIGYSACHWCHVMEHESFENPRIAELLNQWFVSIK
    VDREERPDLDQIYMAAVIAMTQQGGWPMSVFLTPQGHPFYGGTYFPPTSRYGRPGFAEVLAAIHDAWENRREVVTEQASQ
    LTMTVHDQLSERQEPTTLHENLLEKAGRTLVRVCDRVNGGFGHAPKFPHAMDLRLAMRLAHRFDTTETAEVAELGLTAMA
    KGGIHDHLGGGFARYSTDEIWLVPHFEKMLYDNALLLQAYLDGWQFNKTDFYRRTAQSIVHYVLREMQVPRAELPGGFCA
    AQDADSEGEEGRFFVWSQSEIRDVLSGSELGNDDSRLFERAYGVTSGGNWEGHNILNLPKTIAALGRELGMAETALEQKL
    SLLRTKLFEHRKNRIAPGRDEKLIVAWNGLMISALARAGLVLDDQEALQAAQRAARVILDMAESLPYGLPHSIQKGQPKH
    GAYLDDYGCFLEALIELFLADGDPSWLSRAVPLIDRLVNEFHDDEQGGFYFTSSQAEKLISRSRDFQDNVTPSGNAAVAN
    ALLKFGRITGDARSEELAHEVLQAASGLMQQSTMATAHSLAALDWWLGPSYECVYVPAETTSTTDSEPLKQDAVQRVAHE
    LYLPNVLFLTGRAQWEGTLAAGLVQGRLAPASEPVLYVCQKGVCQLPVVGEAAIIARLKGLAQSIDE

    >gi|296121440|ref|YP_003629218.1| Rhodanese domain protein [Planctomyces limnophilus DSM 3776]
    MTIPTILPIELKTRLDAAEPVTIIDVRTPLEFQEVHAEGAVNIPLDELEAEKLSRFVNPESKTVYLICRSGGRGKKACEK
    LLATGPWQPINIEGGTQAWEAAGLPVHRGKKVMSLERQVRIAAGSLVVLGCALGAFVTPYAFGLAAFVGAGLVFAGVTDT
    CAMGLLIARMPWNSTPRSTPSCSLNPTSPPVTSH

    >gi|296121481|ref|YP_003629259.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MSEQWLWSSRVRPVVDGSGSHSQNVVDRATYSGRSTGSLFSNSSIQLRTSLALALMITLMCPGREAQAQVTAKQILQAYS
    PRQKDVDYEVPTPADLEKCQVTVERLGKVSGYVVLGAQGQLLRRFMDTNGDNKVDQWRYYNHGIEVYRDVDSNFNEKPDQ
    FRYVNLGGSRWGIDQNEDGKVDSWKSISAAEVSREAIKSMTTGDFGLLETLLINAADLRTLGVNAALQKKMLENVSQPEA
    KVRQIFSKSRDFTPKSVWVRFDALMPGSIPADDGKAETDLQVYENAMCIVDNGGGKTALIQLGELVRVGDAWKLTQIPEP
    IGSDSITVAGGVLMQPLLASAESAAPSVSPEMQALLDKLQKLDASSASLAGTPEAMAKFNNARIELLLQIVNATTSEDDK
    EQWMQQLADGYAAAIQTGQGGDSLDRLKDMETKLKKDAAASPLVPYVTYRRMLAQYSVEMNTANEAKRADIQKAWLESLE
    GFITTYPNSEDASEAMLQLAITEEFNGRIKEAVAWYSKLAAAQPQSIAGKRAAGAVTRIQLNGQPLKLSGTLLEGGSFNV
    SQLKGKAVLVVYWATW
    CQPCAADLPQIRALYEQYRAQGFEIVGVCLDVDTSPQDVNKFRVENKMRWPQIYERGGLESPAA
    VQLGVITLPTMILTDRAGRVVNRGATVQDLKTTLPQILK

    >gi|296121502|ref|YP_003629280.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MIAFNRAVALCLTLCTLGLGGISASAADLKVGDKAPQFEALDTQGQAWKSAEHVGKKLIVVYFYPADMTGGCTKQACAFR
    DDLSKLAGQDVEVVGVSGDSVRNHQLFSKKHNLSFTLLADTEAKVAEAFGVPYTKGEKSVKAEVDGKEETLLRNVTIQRW
    TFIIDKDGKVAYKNTKVAAADDSKAVAEAVASIKKK

    >gi|296121546|ref|YP_003629324.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MVRVPSTMLPLGTVAPGFSLPNIDGTIVEKSAFASGAPLLVMFICNHCPFVKHLRSGLAQLGRDYQKTALKIVAISSNDV
    VAYPQDDLAAMTREAAEAGYTFPCLLDESQEVAKAYRAACTPDFFLFDAAHRLVYRGQFDASRPGNEIPVTGSDLRAAID
    SVLKGQSPAAEQTPSIGCNIKWKPGNNPDYFPG

    >gi|296121787|ref|YP_003629565.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MVNARRQFEIHHRFSSNVWRLQRTFWIWSVVTCLSLALQVNGVCPAQESSASLVKTNTKPAISLPDSKPQHALETGEASK
    PLLNTQLLDQHSRVHEFREKSDTPLRVVVFINGD
    CPIARSYIPELNRLHEKWNEKTETVSLHAVWGNPFSTHAELRKFVE
    DYAIKFPIVFDPLAQLAHALKPTHVPESFLLDVQGRIAYRGRIDERWAAPGVKRAVVKTRDLETAVETLLLNPAAKIAST
    SAVGCLYDLIPTQELLRPNNDSTQQKLTWSQVTASIIYANCTHCHQANAVGPFPLETWQDVVNQRAQMIEEIQTSRMPPW
    MPDANCGEFLGQRSLSEIEKQALSKWVEQGTPSGELNEAPVPPPKKSTWELGPPDLIAEMAADFFIPADGPDLFQNFVIP
    LPLDSDKVVAAIEFQPGDASVVHHTLCFLDANHQGRKLDAKTPEPGYSSFGSPGFLPTGSIGGWSPGNTPRKLPGHMGRY
    LKKGSDLVLQIHYHPSGKATKDRSRVGIYFADQPKNIVAAVWAASYDIDIPAGERNYERRASYKLPQPVTLMGVIPHMHL
    LGKSFTAQAVLPDNTIQPIIRISNWKYAWQDEFHLSQPIHLPAGTRLEIIAAWDNSEENPLNPSNPPRRVTWGEQTTDEM
    VYGFFLVAAEEPKKLIPLALDNISVDLKSRALHGHPIR

    >gi|296121790|ref|YP_003629568.1| hypothetical protein Plim_1536 [Planctomyces limnophilus DSM 3776]
    MIRQNFPAQSMTKLRSEQALTERFFTERWLCLVLSCLCISCLTASSALAQISPSATEAQLKISNRSWADLIAMLPMYRGK
    VVVIDLWSTS
    CDPCLKEYPGILALQKKYPQEIVCVSMNCDYIGVKTKPVEYYRPRVVEFLQSQNSNIVHLMCNEPADELF
    EKLKLDSIPAVYVFDQQGQQVKRFDGQYTREGSNASATQSPGKPAADSEEDEEESKFSYIEDVAPFVEKLLKK

    >gi|296121806|ref|YP_003629584.1| Redoxin domain protein [Planctomyces limnophilus DSM 3776]
    MMFRLLGFCLALGLTPFLLTTAHAQEARVVDKAGFDKAIAAHRGKIVVVDCWATWCVPCIKQFPKSVELADRHAKDGVVL
    VTLNFDDVSGTKVPAKVNKFLSEKAGKGDHLVSAHSLSDDGAEIFGISDAALPHYIIYGRDGKIAARIASTEDLPATHER
    VEQAVQSVLSKSPR

    >gi|296121810|ref|YP_003629588.1| Redoxin domain protein [Planctomyces limnophilus DSM 3776]
    MSGSTPSFLKPLVCVGGLLAGSLALLPTFAVENVPQASATAGSPQGKLAGLSELTDKTWKDVEGNVWTFPKSETSPVVVV
    AFLGTE
    CPLALQYAKTLNLLAERFANRGVQFVGVNANPQDSLAEIQAQARRQKLSYPILKDIHQDWLKALGAERTPQVVV
    LDQNRVIRYSGRIDDQHGIGKSRPAPTREDLALAVEQILAKKNVEISKTEVIGCLIGRLSSPKAQPQVTWAKDIAPILDQ
    HCVECHRPGEIGPFSLVNYEETAGWAEMIAEVTSERRMPPWHAEESHGKFLNERRLSQKEIDTLKQWVAEGTPAGDVSQR
    PPLPVFTNGWQLPRQPDQVVWMSERPFSVKSTGEVKYQYFSADPGITEDRWISGVEVQPGNRAVVHHVIVFLSEDGKKFD
    HDKQFLVAYVPGLRLKPLPEGYAKRIPKGSKFIFQVHYTPNGEAQEDRTKVGLIFADPAKVTHEVKTESVAQLRFRLEPY
    KDNQRVDAKPTKAPVELELLSMSPHMHLRGKSFRYELQPPGGERQVVLNVPHYDFNWQTQYRLAEPIKVARGSTLYASAT
    FDNSPDNLANPDPSQVVTWGDQSWEEMMIGYFDIAIPRSTAGSANLMTDWLDSKEGPRKLLKALDRNGSGEVDESEVQSG
    HRQFLKQIDADNSGGLSEEELRSNWTKVLKAISAKKS

    >gi|296121886|ref|YP_003629664.1| thioredoxin reductase [Planctomyces limnophilus DSM 3776]
    MTERVVIIGSGPAGWSAAIYAARASLEPLVFEGAISEENRIRGTLPLGQLALTTEVENYAGFPAANLTQFLETALPKERR
    QYMAPHSGHGVTGPELMELMRAQAVNFGTRIITADIVSADLSQRPFVLKTSDDTVVEAHSLIIATGARANYLGLPSEDRF
    KNYGVSA
    CAVCDGALPRFRNKPLVVVGGGDSAMEEATYLSKFASKVHLVHRRDEFRASKIMAARVLDNPKIQVEWSSAVT
    EVLGDDQHGVTGVRLKSLKDDSERTLEAAGMFCAIGHTPNTDFLAGQIETDDKGYVVYKTPFRTETSVEGVFAAGDVADS
    YYRQAITSAGTGCMSALDAERWLASQGIH

    >gi|296121889|ref|YP_003629667.1| Thiol:disulfide interchange protein-like protein [Planctomyces limnophilus DSM 3776]
    MVFAERRMCVVLAVLSAVVCQTWLILAAEQNSPPVTPQVPAAPQSISWRASYRKAWDESKATGKPMLINISAKWCLACRT
    LEQQTLNQPQVQQMVNENFIAVQLDADAHRELVQSFRVTGLPTCLVVAPDLTIEDRIIGMQPANTFTGRLSESVRPDIEM
    ASTPAPASATQPANGI

    >gi|296122103|ref|YP_003629881.1| periplasmic binding protein [Planctomyces limnophilus DSM 3776]
    MQRRPERIVSLIASATEIVDRLGLVEELVGRSHECDYPPQVLSLPKCSSAKLDVNGSSLEIDQRVKDVLKDATSVYNVDV
    ELLNHLEPTLILTQTQCEV
    CAVSLKDVEAAMCAVVTSQPRIVACEPNWLSDVWKDIERVAVAAGVAERGAQLIADSQRRL
    DEISQTASKVTRRPRVACIEWMEPIMAAGNWVPELVTLAGGENLFGVAGQHSPWMTWNELLASDPDIVLVMPCGFDIPRI
    QQEWPCLAKQPEWAKLRAVQGGQVYIVDGNQYFNRPGPRLVESAEILAEIFHPQIFSFGHRGNAYIPSE

    >gi|296122138|ref|YP_003629916.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Planctomyces limnophilus DSM 3776]
    MIRPAHEFDVVVIGAGPAGIGVACVLKALGLENFVVFDRYEVGASFQRWPREMRLITPSFPSNAYGFPDLNAITVDTSPG
    YTLETEHPTGRQYACYLRRVVKEFNVPVQTGVNVTEVRSTTDGFEIMTHAGTRTAKYVIWAAGEFQYPKIDPFPGAEY
    CP
    HTATVSSWRDVAGDEFLIIGGYESGIDAATALCRLGKTVTVLDRRSISSSVTSDPSVVLSPFTQARLRQADRTGRLSVLE
    NFKVMQVQREGEEFLVIGRQRQKKQTVLRTKTPPLLATGFDGSLSLVKSHFARDEAGVLQLSPDDESTITPGLFLCGPMV
    RHGAIIMCFIYKYRQRFAVVANAIGQRMGLDLSPLEVYRKKQMFLDDLSCCLDECAC

    >gi|296122150|ref|YP_003629928.1| Rhodanese domain protein [Planctomyces limnophilus DSM 3776]
    MNLVVRNSLVIVALVFAGFGHAQGADYTTDSLDVVKQQVQEKKALLVDVRDQAEWDRGHVEGALLVPFRKLQKGMTQADV
    EKILPKNQIIYTH
    CAVGARSLGAAGVLKDYGYDVRPLQKGYKDLVKEGFPVAK

    >gi|296122278|ref|YP_003630056.1| hypothetical protein Plim_2029 [Planctomyces limnophilus DSM 3776]
    MIAKNMTSKAGWTGVLLAFVFVLLVADSRKALAQPPLPKNPGQWVNSQPLSYEQLRGKAVYLVFFEETCPKCRAAWPDIL
    SAAKSNEKLPVVFIAVNSGTQRAEVERYAQQVKINWPIIVDTDRSFEKEFASSSVGEISLQNIRQIRGISAAGKIESLPY
    DDYSDAIKGLAQGATWKVERAEVPPEMIPLWQQVEFGAYGGVAQPLKKAALSNRPEVKSVAEKMLAVVDAERQELENEAL
    ASAEAGNKFKAYELLLKLNDTFKGYPLSDGAAKLKKDLPKDPQVKSGLAALKQIQNIERQLANAKPQLKEKLGEQLSKMV
    TDYPETQLATHAAALLKGAGLDVPEAGGAAGSQNPPAIKSGTF

    >gi|296122287|ref|YP_003630065.1| Thioredoxin domain protein [Planctomyces limnophilus DSM 3776]
    MLSSCLHCSSQDSQSHFCSNPIVAFQKGLRSMGLVLLIFITTQSAWAQYPQGGHPQGGQGSVWLGSYNTALQEASRTNKP
    VLLHFSATW
    CGPCQQMERGVFPHPQVQQLLRTSVAAVKVDSDQNPQLVQQYGVRGLPADVMIDPRNGKVLLHSENYLDVG
    AYTSMIGGVAQKYSMSLAQAAPAQRMQNKVPATLPGNQNFERKSAPSQSMANADDVGLDGFSPVALQRARQWMRGDSRFA
    WDHQGITYFMATEQELADFKLTPEQFAPKLLGCDPVVLWDTTKAVSGSTQFAAFYDDSLFLFVSRESRDRFKENPRRYMR
    TEQVLRRTDVQRLVQALPDESSESTRQAENPAKTEVR

    >gi|296122681|ref|YP_003630459.1| 5'-nucleotidase/2' 3'-cyclic phosphodiesterase-like esterase [Planctomyces limnophilus DSM 3776]
    MPRHRRQRAISCPLGGQNRPAQSTSPKLGRVLWPCLLGLACLTTLLTGGAWVTRLVPSDAQLASRTSTQAVSSSSLPLQN
    SVLSVIPWNTTLAQAAQVPAGQLPSDTKSSEATSQSTSHTSEPPVAEDWPRPQAVLMLSAETNGYLEPCG
    CSLTQSGGMS
    RRLDLFQRLTKRGWPVAGLDAGGFVKRSRRQDQIKYEAILTALRSLNYQVIGLGPADLRLGADFLLTQQVADPEEVQKSL
    AISGANVTFFESPDLGTPLRTKTFKIGEVKACVVSVLGKSRRDDVAPAGVANNITFSDPDEEIRKAIEQFKGEKPHLLIL
    LNNGTVDEAKEFARKFPAFQLIVTTGGPEDPQSKPVMEGRSWIIQPGQKGKYVSLVGYFPDDVKTPFRYELIDLDNRRFK
    ATKPMENLMADYQKRLELEQISLTPELVIPHPSGRKFVGSKVCGDCHTKAYEKWEETGHAKATKSIIHGRGGIEGEYISR
    IYDPECINCHTTGWEAQQVLRYDSGYRDLETSAHLFGNGCENCHSPGSEHVRIENGGKATEEEQAAARLAMRVTLDQAKK
    TTCYQCHDGDNSPGFEFDKYWKEIAHPWRD

    >gi|296122682|ref|YP_003630460.1| protein of unknown function DUF1573 [Planctomyces limnophilus DSM 3776]
    MKPAAMAVCAFLTVMTLAAIAFFGRGTATLPVNVAQPVPETEIGPKVAKEGPQPKAVIPEVEYDFGKMEMGDEGSHVFII
    KNEGEAPLEILARKEETT
    CSCTVGNVAGDGKLAPGQQTEVTLNWKIKLANPSFRHHAVIRTNDPGNRRIELTVVGKVENG
    LQLKPEGEWAMGQLKIGAPSEATGSIYSPLFDKFEITEVKTDLPTTQITWVPLTEEQLGERGAKSGYLLKATVSGDVPVG
    SYSDRVVLQTSLEKHKEVSFTIKATRPGPIDVIGRGWANESTALILGDFPAKDGKTAELSLFVRELEGDLELKSYETAHN
    AVEVALRKDDKYMGKGVQRYFLTVKVLPGLPADRQFKKSEKVILKLNHPLIPEYKFFVSYLSL

    >gi|296122715|ref|YP_003630493.1| protein of unknown function DUF1573 [Planctomyces limnophilus DSM 3776]
    MSQASIPPASRTTSTRGNLPLAVVLCLIVMAPPALAWAAPFWSQPTPWKQALPAGPALAFSQYAVDLGKVRPADELRATF
    RFRNTSTVPVTIQELIPS
    CGCLMPRLDKQVYAPGEAGQINLRMQPANETPGEKEFFCDVVYRDTQTRTDRLTFRLHLPEQ
    RLSVRPPALIVYQLSNQPTTQPLFVHDSRGHQVEILSLRTGSPFVKASLTPPEGFSLEQIQPAQKSKEAAQAVSALTPAN
    INPPVKPSLTPIPETEPLPETTAGKNRSQRRPSAGHSDPFVTEEAHQPNEKIVYITVVAELPPGRHHALIEIETTDPETR
    FLKVPVMIQGRNVERPKDMHQSHGLRK

    >gi|296122767|ref|YP_003630545.1| Redoxin domain protein [Planctomyces limnophilus DSM 3776]
    MLKTVIANFRQRLRYEWLVPMLLVAMSGFWFSVATAAPPKSGEVAPDFELANVDGGTTKLSTIAERGPVVLIVLRGFPGY
    Q
    CPLCNVQVNDFLKSQEKFQQAGAQVVFVYPGAGSGLAQKAKQFRGERVIPEHYTLLVDPDYQFTKQYGLRWNAPNETAY
    PATFVLNSDRKIAFSKVSDSHGGRTSAKDVLEQLAKSQNQSAK

    >gi|296122780|ref|YP_003630558.1| Redoxin domain protein [Planctomyces limnophilus DSM 3776]
    MKRAGATTLKGNPVDLKGRAIVVGDVAPTFSLQANDLSEVTLSGKTTIIATVPSLDTSVCALETKKFNDEVKNLPNVDVF
    VVSMDLPFGNKRWCASEGVENIKTLSAHRCTDFGVDYGVLISGGPLDRCLARAVFVVGADGKVKYVEYCKEIADHPNYEA
    VLAAAKS

    >gi|296122910|ref|YP_003630688.1| alkylhydroperoxidase like protein, AhpD family [Planctomyces limnophilus DSM 3776]
    MPRITPLDPQNATGHVKELLDGVGRKLGMVPNMMRTMAQAPAVLEGYLQFSGALARGQLSAKVREQISLAVAQANSCDYC
    LAAHSAIGKMVGLTVDQLRDSRHGEAVDPGTDALLRFAHRVVETRGHVNEADVQAVRDAGFGDGVIAEVVAGVAHDILTN
    YFNIVAATEVDFPHAPAL

    >gi|296123060|ref|YP_003630838.1| Rhodanese domain protein [Planctomyces limnophilus DSM 3776]
    MRNTLKTFLHVALLPFAMLFIGEVLPAEIGIISPQDAVKLIEHPDPAKRPVVLDTRGGYKDYFRGHLPTAHHLNFDTLRG
    TDLGVPVQYLPDDLTRALLVRAGVHRDRTHLIYATGEALPNDEILSATMVAYVLEKFGVEDIRIVDGGLPDWKAAGLPVT
    QEYFGNPPGLLPVKGQPSIALTVEEVLARKGKPGVVLVDARPKNEYLGQDDVWLRKGHIPGAISFHWARLMEEENTHQFK
    PFEQVQAELKAAGLTPDKELLVY
    CGTSREGSLLRFYLKHIAGYPNVRLYEGSWKEYASLKQHPAELEESRIGEESGASGV
    LKSSR

    >gi|296123065|ref|YP_003630843.1| methionine-R-sulfoxide reductase [Planctomyces limnophilus DSM 3776]
    MLTWKDVLNFAQQGNPVPPRKVEKSEAEWKDLLTDEQFRITREKGTERAHSSQMCRLFEPGEYACTCCGTTLFDASEKFE
    SGTGWPSFTQPQDVGHVAYHLDNSYGMVRVEVTCNICGAHLGHVFPDGPAPSGLRY
    CINAVSLKKVQNLA

    >gi|296123152|ref|YP_003630930.1| Peroxiredoxin [Planctomyces limnophilus DSM 3776]
    MRSLVRGLMILALVSAAVVTGLMTKGDKMTTVAADATGSIYRHKLTTLSGEPVELSKYKGKVILFVNVASACGYTGQYKP
    LQAISEKYKDQGLEVVGVPCNQFGGQEPGSADEIQTFCSNKYGVTFDLLAKTDVNGPKASPLYVDLKAQSPNGNGDIGWN
    FEKFLVSRDGKVVGRYKSGVKPDSKELVSAIEAELAKK

    >gi|296123212|ref|YP_003630990.1| pseudouridine synthase, RluA family [Planctomyces limnophilus DSM 3776]
    MLNSMDCFEVSQGRQFPFELLVGMSVYTNISTYRFAPLADLKPLREKLLSFCHARELKGTILLSTEGINMFIAGFPEKVA
    ELLEEVRKIPGLEGLPAKYSPSDHQPFTRMLVRIKREIIAFGLPEIDPSRQPAPKLSPKELKAWLDEGRPVTLLDTRNDY
    EVKLGTFENAIDLNLATFRDFPEVSRQKLPPELKKQPVVMF
    CTGGIRCEKAGPFFVKEGYEQVYQLDGGILKYFEECGSA
    HYQGECFVFDQRVGVDPNLEESSTTQCLRCQTPLVPEEQADPRYVIGQSCPYCFKTTAQEMEDRLRERERMLQGLIDPLP
    GCVPYVNDRPLQVSQKHAGLTVREFLQQVLPHLEASLWESAESEGRLLSETFAPMRLDETVQPGQRIIHRLPGTLEPAVN
    ADIRWLYEDESIVVINKPAPLPVHASGRFHRNTLQYLLAQIYDPQSPRAAHRLDAMTTGVLVLSRTRHMAGRLQPQFSRR
    EVEKVYLARVQGEPAEESFECHAPMTDVAGVMGSRDIDESGGVEASTLFRLVQRLEDGTSLLEVRPITGRTNQIRVHLWH
    LGLPILGDPLYLPSGELATEPKDSEQVMCLHAWRICFQHPVDRTTMEFMAPPPAWAGEAGAVS

    >gi|296123221|ref|YP_003630999.1| iron-sulfur cluster assembly accessory protein [Planctomyces limnophilus DSM 3776]
    MPVTLTESAAKEIQRIISEQQMSESTLVRVGIAGGGCSGFKYNFGFEEAADPVNDHLIEYHGVKVAIDKKSALYLDGTTI
    DFYSGLDRRGFVFENPNAVKSCGCGSSFSA

    >gi|296123344|ref|YP_003631122.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MLSKMWRLLSVMALLSYAVCPVMYGQDTAPDQQSTDQKTVPESIADMQKQLQSLGSRAKVATLKPSERVEQLAGLLVQAE
    ELSGKAVTEVDQRALVLARVQILLGLISLKSARSEEKLEELISGLQAQEDKSLYRIARLKCLEVELSKPGTPLDRTIAKL
    KDHQKLLDEASFSEKMGVMATIVQLANSALPAQQKAAAELLEGYVADLKTVTDPKAERLLASAEGVLRRLQLPGQEMVLT
    AEKTITGESFDWAAYKGKVVLVDFWATW
    CGPCVAEFPRMTKFYETYHPHGFEIVGISVDSNRKALDQFLEKKPLPWTIVH
    DHQEGEGSPNARYYSINSIPRMILIGRNFEVISINARGQALEEQLKKDFPGVELPVEKEPESEAVTDKSSDKP

    >gi|296123543|ref|YP_003631321.1| dihydrolipoamide dehydrogenase [Planctomyces limnophilus DSM 3776]
    MKEHDLVVIGGGPGGYVAAIRAAQLGLNVACIEKESALGGTCLRVGCIPSKAMLESSELFQMAKNHLAEHGVSINADSVK
    LDLPAMLKRKDGIVSQLTKGIDGLFRKNKITRYLGHGKIVAPGKVLVEGAQPEEIVCKNIVIATGSKSAPLKGVEVDNER
    IGTSTEALAFPEVPGTMVVIGAGVIGLELGCVWSRLGAKVIVLEYLDRILPGMDSEIATEAQKIFTKQGIEFRLGMKVTG
    AKVSGKKCVVTCEGAEPITADRVLLAVGRIPNTENLNLDGVHVAYDNRGRIQVDQHFQTTIPGIYAIGDVIGGAMLAHKA
    EEEGMAVAEGIVWGHCHVNYDAIPAIVYTHPEIASVGKTEDQLKEAGVPYKKGSFPYMANGRAKAIAANEGRAKVLAHAE
    TDRVLGVHIIGAHAGDLIAEAALAIEFGASSEDIARTSHAHPTLAEIVKEAALAVDGRAIHF

    >gi|296123687|ref|YP_003631465.1| peptide methionine sulfoxide reductase [Planctomyces limnophilus DSM 3776]
    MTNAQSDRSMATLAGGCFWCLEAVFENVIGVDRVVSGYMGGATVNPTYEQVCTGRTGHAEVVQIEFDPQIISYSDLLEIF
    FAIHDPTTKDRQGNDIGTQYRSAIFFHDSEQQTVAQSRFTELEAAGIWPGRFVTQIVPAVTFYPAEDYHQGYFRAHPAQA
    YCAAVVAPKVAKFRQKFSQRLKSR

    >gi|296123728|ref|YP_003631506.1| Rhodanese domain protein [Planctomyces limnophilus DSM 3776]
    MTEELPLETNCSLVKQWLDEGKPFLLIDCREPDEHLIVHLEAALLLPMSQLQERVSELAGQKENDIVVHCHHGGRSLRVA
    QWLRQQGFPKAVSMAGGIDHWATAIDPTLPRY

    >gi|296123801|ref|YP_003631579.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Planctomyces limnophilus DSM 3776]
    MTGLPATTAPAKPETFDFDVLVIGSGPGGEGAAMQAAKHGKRVGMVEKYHQIGGNCTHRGTIPSKALRYAIFQMMEVNSN
    KLFAEHGLSAHLSFQKLRRTARAVIERQVQMRSTFYERNDVPVLKGTAKFIDQHTILVTEHDEGHKLVTAEHIVVATGSR
    PYRPAEVDFNHPRVFDSDTILDLAYDVRSATVYGAGVIGCEYASMFRNLDCKVNLVNTRDKLLEFLDEEIVDALSYHFRD
    RGMLIRHHETLDFVEPREDCVIVHLKSGKQLKTDILLYAAGRTGNTDDMNLEAVGITPDQRGNLKVNDHYQTAVPTIYAV
    GDVIGFPALASAAYSQGRHAASHLLGEDQLVGIGEIPTGIYTSPEISSIGKTERELTEAKVPYEVGHSQFKSLARAQITG
    QTTGMLKILFHRETLEILGIHCFGANASEIIHIGQAIMAQPAPNNTLLYFINTTFNYPTMAEAYRVAALNGFNRVA

    >gi|296123903|ref|YP_003631681.1| protein of unknown function DUF1573 [Planctomyces limnophilus DSM 3776]
    MIANMFRQVSRLFQATCLAIGLLTVCSTNLLAQELNWANKMLERQNIDFGTVARGADTVYRLKIRNIYKEDVQLLGTRTS
    CGCSKAKLSTNLLKSGEEGYVEIAMDTYKFMREKTSNVFVTFSIANIGTVEVQIPLRVYIRTDVVLTPGAINFGGFDVGA
    GKESTVNVAYAGRPDWTVTGINSSNPLVTATVVETSRSGGAVNYQLIAKVSPDAPVGDFGGIISLTTNDVGTPAVPVPFN
    GRVEAEFVITPSLLTLGNLVPGTTKALQVVIRSKKPFAIEKIECETVDGAFQVKLPTTTAPVHVLPMTLKVPDLAGPLNE
    TFTISLPGRPNVIQFKATGTIISAPAAPPTNPAASIPAPAGVPATTSGL

    >gi|296123937|ref|YP_003631715.1| hypothetical protein Plim_3704 [Planctomyces limnophilus DSM 3776]
    MWVVPPAIIPSLAIVTAWRTGGVTAARMWLHGQAVQLEPTVLVVPVEILAPDQTGPMNVVDYPAPFVTLRNLQGKPLQVL
    GAKES
    CACATATSLPATIEPFGTLRIPLRLSETARGTQTLTFFTDAPTTPRLTCRVEFRGE

    >gi|296123949|ref|YP_003631727.1| UBA/THIF-type NAD/FAD binding protein [Planctomyces limnophilus DSM 3776]
    MPNLSRYHRQMLLPQFGTTGQERLSRAVVAILGMGALGSCAAELLARAGVGTLRLIDRDFVDLTNLQRQSLYDETDARER
    IPKAIAAARRLGEINHEITLEPIVADIRPENILELLAGVDLVVDGADNFELRLLLNDAALERNLPWVHGGCVGTSGQAMA
    FHPTHTPCFRCLVNPVDDDASGQTSSSATTPAT
    CDAVGVAGPAVHLVASLQAMMAIQILLGEREVLGSQLKLIDAWSGQI
    RSMDLSGLRETNDCRACQQGERLWLSGQQTSQTTVLCGRNAVQISPAHPRPLDLNLLANQLAPLGDVRPNPYLLRFKPTG
    HNCELTIFRDRRAYIEGTEDPTLARTLYTQFLGD

    >gi|296124034|ref|YP_003631812.1| Thioredoxin domain protein [Planctomyces limnophilus DSM 3776]
    MDRDSTIARHVSPTTESFAGQVPGWYGEIPSADQPVPVADSSRRPAEVNSLPETKLTQEASRVSRSAVVSESGVESSNKS
    SLHSRSHDQVSKPAKTQAHALQIALSHRSIIAEADATAEATTPEVPVASAFEPELPATIRSSRFFVHGKLSRTAGLASAM
    ALTMTLLVAAVVAIVCPTTWPAGLGGSNQTLKAAGTPANSVVLDFTASW
    CGPCQQMSPIVSKLQRQGYAIRKVDVDQEPN
    LARQFRVDSMPTFILVIDGKEVNRIVGMTNEAQLRRMAEQAVQGSQLARGQQERLAVPGSKPLPKTNSSPFDADGVPTTV
    LGESSRLEAEIVSNPRNAPAAPRTGILNSISEGMGLTRSANPSIPAEPKPPAAPANELFRGNNAEDDAEMTVAHVDPTLA
    SVRIRVRDSQGGMSNYGSGTIVDSQAGRTTIITCGHIFRDLKSKPVVEVDVFQAQGSPRTYLGEVMDFNLDADVGLIMIP
    TEKAVSLARLSPVDVRLGPGEEMFSIGCGGGANPSRESHKVTAINRYNGPENIECTGVPIQGRSGGGLFRADGQLAGVCI
    AADTKERRGLYAGLEPICTMLEKHRLGALVRREGRGRANTAVASAARTADAGSSSEAMGDILMAGGGNNRAVSGAAGSNN
    SGTNAAAEAALMNQSPDAEIICIVRPRGGAGDNSRIVVLNRASQTFMTYLMGEVDSQSQRLPVSLRVDDNQRQTASSVSE
    KSVAAVEPAREPAREALGPRPWVSSNSTAFKRQVLPRREELVPLTERK

    >gi|296124173|ref|YP_003631951.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MSHTSHLLHHSRSPFRFGVTVTCLAAAFWVTPRWEAWVADTSVSLNAAEIPASAVAPENAVVAGHSYHGDAFDQGPRQAA
    YLMGTTGQIHFPVTSQHSQVQAWINQGVGQLHGFWYFEAERSFRQAAQLDPDCAIAYWGMAMANTNNETRARKFIEEAVK
    RKEQASPREKLYIDALANWYAFDTKGEGDKKRERAQKSIKDYEKIVYENPADLEAKAFLALQTWQVRNDLPITNHLAMSA
    LLDSILAKNPQHPCHHFVIHLWDYERREQALASAAQCGQVAPGIAHMWHMPGHIYSGLKRYADAAFQQEASARVDHAYMM
    RDMVMPDQIHNFAHNNEWLCRNLIFLGRMHDVINVASNMASMPMHPKYNRFPSNGSQHFGRLRLWEAYSQFELWEKLIES
    AHQSVLSPTGHTPEQIKRLRALARAYDATDHLAKFNETSAIIRGWRERLAEDRELEMTRAEARVLAKEPGKPRDEKAIES
    ARKSAVRSTDETLRQLDRAIDEITAIELARKGEYAEAIRKLNTAGGASARELARLRLAAGQKEEARKELEKYVSQHAEEV
    LPLAWLVELLIDLNDEAAARTRFEELRAVAHSADLDAPALQRISNKARAWGFADDWRISRILPTDIGARPTLASLGPIQW
    VPPASAAWQLPGHLPGSTEISTVSSRDYRGKPTIVIFYLGAG
    CLHCVEQIQKFLPKVNDFQAAGISVVAISTDDLSDLKK
    SIDRFGSQISMPLLSDDSLEVFKRFKAYDDFENQPIHGTFLIDGQGLIRWHDLGADPFMDVDFLLEESQRLLHPTSVKSV
    TYPQPRPAGTPASALEPLNQPAKDQPQRDQRRKDRGSSDPSEKGKSTSPANSPAAAQQPLAPPTAIKADVS

    >gi|296124174|ref|YP_003631952.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MRQINEHWFSRISWASVGKKWAALAVVAMTSSVCLAQEKPATVPAAQITTGNSEAKPTDDKQASDEAKAKAAKIRAAAMQ
    GLLPEDLDLKLPEDIFQLPESGIPELLASARRLSSPMALSKQKVSSFEEMNALRLKANNLVTTATEKVLADPAANEKQAL
    QAAGLLLNAQSMLLRVEAPGSAQSALAIANRLATDSRPAIAKMASEKIDGLRILTIPQLEPAAVDTLLAETLNRVKVADF
    STESIKLASEAGRTLEYGKDPALAASYMSRLADLLESTDKETVTPIAERVRGISRRLGLVGNSMEVVGTTVEGKDFDLAS
    LKGKVVLVDFWATW
    CGPCIAEIPRVKKLHEAYHDKGFEVVGISLDNSIEPLKEFIEKREIPWVNLYPANTSETKAAGWSN
    PIAKFYGVNAIPTCILIGADGKVITVKARGQVLEDALAKIYGPLPEVEEKAGGQK

    >gi|296124175|ref|YP_003631953.1| Redoxin domain protein [Planctomyces limnophilus DSM 3776]
    MEQPESHHMLRSRIRWSMTQNSTHQPSMSRNVCTWPVVAGKFVFAIALMTGSQFSAMAQEAGAPPAAAAKPAPQDPLKQE
    EVSDALYAIPKGSADDILEFLEDLQQKRPRLKSRQQAIEHAIRVQKTIIEGTGQVLAMPKVELDTAVEAAEMHLQAHTLL
    ASAQIDGAQEAALAAATKLKADTRKEISELANQQLLMLRVLSAPTLTAQERATLSADILKAIETTKYSEESIGMGMQLAM
    VLESMPETGPAVDFLGDLANLLDKADKKEIKQAAEQVRGMARRINLPGNTMVLKGTTVDGKPFDLASLKGKVVLVDFWAT
    W
    CGPCIAEMPNLKKAYEAYHDKGFEVVGVSLDDSKEDLMGFLKEKNVPWTTLFHEGTEEAPGGWSSPQAAYYGISGIPTC
    ILINAEGKVISLEARGENLTNELAKLLGPVKEEPKDETTDDAPAKKK

    >gi|296124270|ref|YP_003632048.1| Rhodanese domain protein [Planctomyces limnophilus DSM 3776]
    MQHNPRFLQLVESVRTNIRECSIADLKLLLEKKSPVLLFDVREDHEWVNGHIPTAKHLGRGIIERDIETLIPDPETEIYL
    Y
    CGGGFRSALAADTLQKMGYMHVISVDGGFRGWKESGGEIVTPSA

    >gi|296124312|ref|YP_003632090.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MSTIDTPDSASNTALLRQQQTRFRRRVFLVIAAVIVSFYGVIFTYHLLTPTPSQSASLQVLEQCREICLKYGLIPTGNIK
    QDAEAYLEAVKKPRLSEPLRELLADGQFIVAESRPHPLLKQPAPDFQLKNHEGQLVSLQETLAQGPVVLVFYYGYD
    CSHC
    VAQLFGLQEDLKYFQELGARIVAISADPPEETKARFEEYGAFNFTVLSDPENKIAQQYGVFIPETAERPSDLKHGTFLIN
    PAGKVFFSTFGYKPFLDNKSLLFMLNEFSQQSSPEHKSPNET

    >gi|296124331|ref|YP_003632109.1| NHL repeat containing protein [Planctomyces limnophilus DSM 3776]
    MMTCSNRAWFRHFESWPQRCGVWRWDGNALVGCLAAILLCLFFVPAVAQETSDGQSPAASTPKPAPEAGKPENPFPNRIP
    APSLDGGIEWLNTSQPLSLKDLRGKVVVLDFWTYC
    CINCIHVLPDLKYLEKKYGKELVVIGVHSAKFDNEKESGNIRKAI
    LRYEIEHPVVNDAEMTIWRKFSIRSWPSLVLIDPEGQFCGVASGEGNRELLDQVIAKVIDYHRAKGTLNEKPMAFDLESG
    KEAATPLRFPGKLLVDPAHERVFISDSNHNRIVVASLAGQLLKVIGSGKIGAKDGPAESAQFDHPQGMALDGNTLYVADT
    ENHLLRTVNLTTWEVSTLAGTGEQARGRDRGGELRTTALNSPWDLYIQQGVLYVAMAGPHQLWSHALGSKTIQNYAGSGR
    EDITNGSLAQSALAQPSGITSDGESLYVVDSEGSSIRKITTSEADKLEDPEGKVTTVVGASDLPRGASLFEFGDIDGKGS
    AVRLQHPLGIVFHEGKLFVADSYNHKIKVIDPIKRTCESWLGNGKPGAALAPVQLSEPAGLATYGGVLFIADTNNHRVLK
    VDLKTKAATELKIEGLTAPKP

    >gi|296124438|ref|YP_003632216.1| Peroxiredoxin [Planctomyces limnophilus DSM 3776]
    MSAVPEVGSKAPAFDLPAFPKGRYKLSGLKGKYVVLYFYPRDNTPGCTTEACDFRDRHEAIAAANTVVLGVSTDSVDSHQ
    KFIEKFELPFPLLADEDHALAEKYGVWVEKNMYGKKSMGIQRATFLIDPAGKIAAVWPKVKVDGHAEAVMAKIQELQAAG


    >gi|296121439|ref|YP_003629217.1| beta-lactamase domain protein [Planctomyces limnophilus DSM 3776]
    MLLKYFYDPALAHASYLVGCQRTGQALVIDPGRDVDGYIATAQEQGLKIVGAAETHIHADFVSGSRELADRVGATLYLSD
    EGPADWKYQYISKHQVQLLHDGDVFGVGNVQLKVMHTPGHTPEHISFVLTDGGSGATEPMGIFTGDFVFVGSIGRPDLLE
    TAAGVVGSAEVGARQLFHSISKFMSLPDFLQVWPAHGAGSACGKGLGAIPSSTVGYEKLFNPALQIRSEQAFVDYILDDQ
    PETPPYFAVMKRVNKVGPQLIRELPAVSRLNIEQLVDAQSTRLVIDTSPAALYAQKSIPQTINIPATQLAQWSGFFVDDG
    EPVLLISNAEGLSAQLKALRSIGVDNIQGYVDRSDLEQNDLATAAYRSISPTELKELMENHSIELLDVRSAHEFAEEHIE
    GATHAFLGGLRKSSKELSPDETFVVQ
    CQAGGRSAIAASLLSRSGLKVINLAGGLNAWKRANLPVVHQSVDQHVVGA

    >gi|296122452|ref|YP_003630230.1| hypothetical protein Plim_2205 [Planctomyces limnophilus DSM 3776]
    MASETSKVNWFTALKPAHQQALSRQKPLLIIFGASWCGFCHKLEKETLGEKRLAQFVMREFVPVKLDFDKDDKAAKILDV
    EALPATVVINTEAELLARSTGFHEPDKYAEILQSAIRRQSEILQARHTQTRPS

    >gi|296123842|ref|YP_003631620.1| hypothetical protein Plim_3608 [Planctomyces limnophilus DSM 3776]
    MFRSITFSLIYPAGLIMWLATGPQAGAQPHVMAEEALSQSTKAAWPSLFAEAASPASPVNTAQNSRALQWLVFYGPGCVP
    CMRAIHDFQPWLKASGWEVSEVPQAHIRLIDANREQSLARQFQIEAWPTFVLMHEGKVLERHTSYPGRQFLADRYLAAAA
    RVRDQRSFTSHEPVSAISMGTLSNTSREVALLLESTRPLLEAGLMFEGRLLPASQKASGSLPASTTISLTESAAIRLYWP
    LVFRLSRQQNSLHLDFEKPYPQFRMSNIFPVEQSIEGLTATTQSLTIELPRMIDLKWQLD

    >gi|296120808|ref|YP_003628586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Planctomyces limnophilus DSM 3776]
    MRAVLALMITFISLMGYGCGAIKETAPERSSTTVTTHEGGADVDSSVITFHDEVISQDTPVVELSSLELTTPDGKPVRLS
    DFLKTGNLVVVVTSGYAGSI
    CPVCSTQTSRFIANHEAIKSRGAEVVVIYPLGSENDRSRSGEFLAAANKRVALAPGAQPS
    FPLLVDVGLKVVDLLGIRQDLSKPATYILDRTGAIRFAYVGESMADRPSVQAILRQLDTLNTSMTNAARVGT

    >gi|296121073|ref|YP_003628851.1| alkylhydroperoxidase like protein, AhpD family [Planctomyces limnophilus DSM 3776]
    MHPYWPARTPAEIDEKAQQTLSRLAEVFGTDSIPEFFHHMAIVPSFVNDYYMNFKKFCYTQGKLSLKDKALIGLAVSHTA
    GVKSMTEFFAQRLRNLVEGSESAQSQFVADALAVQATCAMYNVFFKFRDLSGSDLFSGMPVGLRAHTFAGTSLTDTEVEL
    INITVSDVNGCKP
    CTEGHVAKARQLGLADEAILEAIQCAATVYAGCQFAKAL