Pirellula staleyi DSM 6068 uid43209

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|283777816|ref|YP_003368571.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MSRPAAVTFKGTPMTLAGEAVKPGQAAPDFTIHFFEGGLKTITLADLKGKPSFLSIVPSLDTGVCKIQTKKFNDELASLK
    DKINAVTISLDLPFAMNRFCGAEGITNMKVGSDYQNRSFGNAYGMLIEELKLLARGTVVIDADGKIVHAETVSEVTSEPN
    YDAAMTAIKSLL

    >gi|283777880|ref|YP_003368635.1| cytochrome c biogenesis protein transmembrane region [Pirellula staleyi DSM 6068]
    MQFLSFTATNHSRAMPLDLFTATAWRIVRQGLIAATLLGLVVCANSAKGVDPNRTADPTRPIAPAGELDAPFDPSAPASE
    GASQPRFNLPAALPGLAGDGGIAGGLGLGDSSGEHVFFSAKLTAEEGTNRGTISLTADIEQGFHIYSITQPPKGPQKSVI
    ELVPHPQVKLSGRFTPDQEPKLHDTGIFPVLAEEHTGKITWSAPVEFSEGVNPEELTLEISFQGQVCDDIKGSCQNIEPT
    KVAAKFSGTTQPAESSGVYLPKFGKLKLEGTIEPAVANPGSVITVTIKATPIDGYHVYAYAPVDRPDVIANKPTLIDISR
    RLGWKMGEVKASSEPIFKKGDAVVGDSYYHEEPITWTTTVAVPMEATFGDFDLVGYIGYQTCLDTSCLQPTGAQFKATVT
    VSQDSPSGVQKLAFSDYSYAKVAELAKESSELKLAASPSGRDLPINWGTLTPILGLAFLGGLILNLMPCVLPVLGLKILS
    FAKQGGQSRSKVILLNVAYTAGLLSVFLVLAALVAFANMGWGEQFTQLWFRVTVTAIVFVMSLSFLGVWELPIPGFATSE
    KASELQSQEGVQGAYYKGIFTTVIATPCSGPFLGTVLGLTLDQPIPAIFMIFTMAGLGMASPYLLVGLFPQLSRVIPKPG
    AWMETFERLLGFLMLLAAVVQFSTIGAEHYTAALMLMVGLAFACWMIGRVPETATTNQKISSWFTGTAVAATIGFLAFAF
    LTAPHASEELPWQPYSKASLAQLQSEGKTVLVDFTADW
    CLTCQYNSRTAINTPKVQELVKKNGVVTLLADWTNPSPEIKD
    QLTALRKASIPLLVVYPAGKPQDAIVLPDLIFENQVIEALEKAGPSQGESAAAQAVVGSTNHAAR

    >gi|283777987|ref|YP_003368742.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MIVPHALRWTVFLASISLVLPLLAPRNATAQAGASLETEATFDEVLEETARMLATLKSYRVDVEGTWESEGQEPAACGSS
    KHTLIVQQPRKFRIEATASEKAEPDLVCVSDGQKSTTLLAARKIFSQSPVISAQNKVATNTMLAMSLAGSGIDVLLQPDL
    VNFMHSRATGIKHVGDTKIEDTRCHHFEMMFGEHHVQLWVSAEEHPLLLQIVRRTTVPLGEGKSYSLVATSKLKWTLDKT
    YPEETFAIAIPEGSRKVGDIYEALTGDEAATRVGQQLPDFELTKLDGTKISLNKQENRKPTVLIFWATW
    CVPSVSDQSST
    SDFVKRSIEQGVDFYAVNVGESLADVRKFVASAKPASTMVLDSQGSAATALRLDALPAAVIVDASGKVTKIIHGEPEQLR
    KDLAAAVLPFLTTASAPESPTTPAPKQE

    >gi|283778043|ref|YP_003368798.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Pirellula staleyi DSM 6068]
    MMPSENPREHAVVIEPRDEHNQLLVARTHPPAWKNPSAKPVYNMVAIGGGTAGIIAALGAAGLGAASALVEKHLLGGDCL
    NFGCVPSKALLASAQAAYDARHTAHLGVNLQGEVQVDFAAVMQRLRARRAAISEHDSAERFTKLGVDVHLGGAKFTSPET
    IEVGGQTLRFRRACIATGGRAAIPEIAGLRDVGYLTNETVFSLTELPQRLLVVGGGPIGCELAQAFARLGSRVTIVQRPD
    RLLPHDEPDASAIVAQQFANESIAVYTACEVARTSQQHGVIEVELKFAGGQAAGPQKIVVDKILIAAGRQPNVADLGLEV
    AGVKYTSRGIEVNDFLQTSNPKIYASGDVIGRQLFTHAADAMSRAVLQNAFFFGSKRLSQLVIPRCTYTDPEIASIGLTA
    SQLSEKNIPFTSYREEITRNDRAAIEGDTQGFALVHCAKGTGKVLGATIVARNAGDMIGELSLLVTQKLPLGTLASVVHC
    YPTQIEMLKRLGDQFNKTRLTPSVAWLLKSILRWR

    >gi|283778075|ref|YP_003368830.1| uncharacterized peroxidase-related enzyme [Pirellula staleyi DSM 6068]
    MSRIQQIAPEAATGTAKELLDAVKAKLGLVPNMTRAMANSPAALQGYLGLSGALGKGSLSAKNREQIALAVGEANQCDYC
    LAAHSAIGKMVGLTPDQILDSRRGTAIEPRSDAVIRFARKVVNERGLVSDADIAEVRAAGLDDGGIAEVVANVALNIFTN
    YFNHVAATDIDFPKAEALVDHHEVCATIPGCDETR

    >gi|283778254|ref|YP_003369009.1| Rhodanese domain protein [Pirellula staleyi DSM 6068]
    MTATISAEELKRQLTSGKSLTLVDVRTPVEFREIHVQGAKNFPLDRLDTAAIAAERKVESEPLYVICRSGSRGRQACEKL
    TAAGVANVVNVEGGTVACDAAGVAVVKGKKAISLERQVRIVAGSLVVVGAALTLVHPYFAALPAFIGAGLVFAGITDTCG
    MAMMLARMPWNQVAGGACKVALLLSLITLASTAQAVDHTKDSLDTVKQNLAQKKAVIIDVRELREWKSGHLAEASLLPLS
    ELEDRLAREPEKVLAQLPQDKVIYLH
    CLMGGRCLQAAELLQGKGLDIRPLKPGINDLLRAGFPAAK

    >gi|283778255|ref|YP_003369010.1| beta-lactamase domain protein [Pirellula staleyi DSM 6068]
    MLLKYFYDTGLAHASYMIGCQRSGEAIIIDPSRSVDQYLEAAKAEGLKIVGAAETHIHADFVSGARELAHRVGAKLYLSD
    EGTADWKYQNLEGLSAQLVKHHDKFYVGRVKLEVLHTPGHTPESISFLLTDEGGGASQPIGIFTGDFVFVGSIGRPDLLE
    TAAGMMGTAEVGARQLYHSMLAFLELPDHLQVWPAHGAGSACGKGLGAIPSSTVGYEKLINPALQFRDEQKFVDYILADQ
    PETPFYFAVMKRVNKVGPAPLSSLPPVAPIDPSQLATLATRELVVDTAAAKEFGEHHVAGTINIPTAMLQQWAGFLVNYE
    KPVYFITTAEALPAQLRALRSIGIDNVAGYFESSQTTDYRQASYSTIPPAELQAAIESGKLRLIDVRAKTEFDDYRIAGA
    EHHFLGRLFRELTTIARDKPLVTQ
    CLGGGRSAIAASILEREGFSVINMQGGIRAWQQAGLPTVQS

    >gi|283778260|ref|YP_003369015.1| protein of unknown function DUF255 [Pirellula staleyi DSM 6068]
    MQPLEHCETTMPNRLASESSPYLLQHQNNPVDWYPWSSEALERSRAEDKPIFLSIGYSACHWCHVMEHESFESQEIADYL
    NEHFVCIKVDREERPDLDQIYMDAVQLMTGRGGWPMSVFLTPEGKPFFGGTYWPPTDRQGMPGFSRVIRAVIDAWKNRRE
    QALSQATELTDHLGSLATSNTPAQLPLSVSRSMVDGWMETAAARLSRAFDSRYGGFGSAPKFPHSMDLELLLLEWQRSAR
    VDVAEMTLVTLEKMSAGGIYDHLGGGFARYSVDERWLVPHFEKMLYDNSLLLRALVRAYQATGDAKFAATMRETCNYLLR
    DMTDELGGIYSTEDADSEGEEGKFYVWKPAEIYEVLGPERGSRFCQVYDVAPGGNFEHGFSILNLSRSIADWSRLWEMPL
    EVLSNELAEDRAILFDVREKRVHPGKDDKILTSWNALAIDALAEVAGVLDEPRYLLAAQRAADFVLQHLRDSDGRLLHTW
    RHGRAKLAAYLDDYAYLVHALVSLYEADFHTRWLSAAVELADQMIAHFSDHERGGFFFTADDHEALITRAKDMHDGSVPS
    GSSMAALALARLGKITGKQAYLLASERAILAASGSVTANPTASAVMIQAADLLVGPTSEIVLAGPEAEVRETARALRKIY
    APRKVVAALMTGLPVDASSPVAPLVQGKESSQLSLYICQNFSCQAPVTGASSIAAALRGLGSKLTTTRS

    >gi|283778461|ref|YP_003369216.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MPCWKRLVASVMLVLVVALATCSLRGEEVGDSLAGAARRLAEAERQIKSQEDYWSARERLAEQAMRLAEQDLESQEAEAV
    LQWVLASPRSSAVSLRASEYLAEHHGTSERTIEWLFNQQPRQWTPSLYDRLLRAKQPQELRVLLELSKALHDRELLVLSD
    QMKASTGGLGVYEERLGKSLVEQLRQLDDRKWMGEVIAAFKELAARHGERVVGGASIRDLADGAIFSMQHLRLGGTATGL
    AGKLLSDKEVDLSHYRGKVVLVDFWATW
    CAPCVSSVPQLKQLQAKYKESKFQLLGVSADEDQKALKMFIADQSIDWPTMV
    DGDGKLQKRWMALSLPTYFVLDEAHVVRYRGTNLAQAVQVIEAILGKDEVAQLVRLTLEALDKNGDQKIEQSELPADKQG
    IFATTDLDKDGFWSVDELTKFTKANMTASQVDASPRP

    >gi|283778628|ref|YP_003369383.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MRIVTWVVAASLMLALGWPQLMAQQQPAGKAAPQAAAERTGPKLQIGDAAPALQVGKWLQGEPVKAFQKDSVYVVEFWAT
    W
    CGPCIASMPHLDKLAQKFQKQGLVVVALTTEDEANSSEAVTEFVQGDGAKYHFRYAFCDDNKMMTQYMEAAEQQGIPCS
    FVVGKDGKVAFIGHPSELDQVLPQVLDGTWSVEKAQQMAAAQQKFNSVITTMETDPVAALATLEEIAQANPAKAQADDFQ
    SVRMICLALAKKYDELIPVAEAQLAKMNKAEDGMGLISLAGILMSVNAEAPHPKLAEMGKKALDKALALESKSPEVLMMA
    AQFYALSGNREKALEYGKKAVELAPDDLQELLKAELKQLEALSLEKLQRGKESDQEQEATTDRAQDDAK

    >gi|283778664|ref|YP_003369419.1| Glutathione peroxidase [Pirellula staleyi DSM 6068]
    MNRLSTLLLTGIVAACISASFADAEEKNVSDNGALGFTVKSIAGKEVDLAKYKGKVLVVVNVASACGLTPQYEELQALHT
    KYADKGLAVLGFPCNQFGKQEPGSDAEIAEFCKSEYNVSFDMFSKIDVNGETANPLYKYLTSADSAPAAKGKISWNFEKF
    IIGKDGKVAARFSPRTAPDDAEFIKAIEAELAK

    >gi|283778676|ref|YP_003369431.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MSVSTYNSITAVLGLGVVIALVVMVVSLIAMIVRWRSPKRRTHVVRLLGSLAAIVGLIGTQQALLWLVFIPSLGREQMAK
    FQAAREASLAESSLVRVGDAAPSFTLTTDEGRPFSLPDDKRVTLINFFATW
    CGPCQLELPHLERIWKANQSQAHFQMLII
    GREETTETVQTYRAKYGYTFPMAADPDRSVFARFARESIPRTLVVSPDGQIVYSQAGFNEADLEELEKVLREQLAQLP

    >gi|283778697|ref|YP_003369452.1| protein of unknown function DUF255 [Pirellula staleyi DSM 6068]
    MPSSRIHLLVFCLLGLVVLAGAMAEEPAPKQPTKTNRLAQETSPYLLLHAHNPVDWYPWGNEALERAKKENKPIFLSVGY
    SS
    CHWCHVMERESFLDPEIAKLLNENFICIKVDREERPDIDTIYMTAVQTYLQLTTGRRGGGWPMTVFLTPEGNPFFGGT
    YFPARDGDREGMTGFLTLSSKVSEMWKKEPVKLGDDATTLARFIKDQLEGPKLLLAVVLDTKLTTSVEKGLAAQFDERYG
    GFGFDEIEWQRPKFPEPSNLQFLLEIVKKTPASESRAMLVHTLDRMAMGGIYDHVGGGFHRYSVDRMWRIPHFEKMLYDN
    GQLLTVYSEAYALTGDENYQRIARETAEFMLREMRDTSGGFYAALDAETEGVEGKFYRWDKAEVEKLLTKEEFELYSAVY
    GLSRAPNFEETFYVIQLRDTLVDIAKTREITVEKLVNDLRPIHAKLLAARNARKRPLTDTKILAGENGLAITGLATAGKL
    LKEPRYTEAAATAATLVLSKMTAPEGRLFRTYSGEKAKLNAYLSDYSMLVEGLLALHEATGEQRWLDEAIKLTDQQVELF
    HDVPRGGFYFTSKDHESLLARVKETVDSAMPAGNSVAAVNLVKLVKITGKNEYLKLAEGAIQSAAGQMQENPTVSPRLAT
    ALLAWQSMAASGDPSAPGAVPKKAETK

    >gi|283778825|ref|YP_003369580.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MPATSPRPGQISRRLLAVAALAGTAYWWGCSQSGDSMFELTDGVKHPSVGTAIDVVQLEPLTGTDQPLVPADYAGKVSLV
    NFWGPW
    CGPCVVEFPHLVELQQHFGKRDDFRLVSVSCSGGDGDDRMMEESTSLFLREQRATFPTYRDPDYAFRSSLAKAA
    SLQGFGYPTTVLIGKDGKIKALWTGYIDGLELDMRAAIEAALSEEPPKTASL

    >gi|283779046|ref|YP_003369801.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MQRRTFLEAAAATVAIGVAACMHPADALAGDVPLARAYRAPELAEIEKFFHTKASSLREFRGQVVALHFWTYSCSNCLAN
    LPHYARWHHDFAAAGLVVLGVHTPEFSEEAKIENVAEQLQALKIEYPVAIDNQFATWKQWKNRYWPTVHLIDRRGDVRAT
    WIGELNWKASRGEVTMRSRIEALLKEQRDS

    >gi|283779088|ref|YP_003369843.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Pirellula staleyi DSM 6068]
    MPQHQYDVVVIGTGPGGEGAAMQAVKQGLSVAVVERFKKIGGGCTHWGTIPSKALRYSIFQLTEVRQNRLFREAGLSIDL
    TFPQLRKTAAAVIQQQEEMRRSFYDRNRIPIIAGEAKLLDPHTVMVCEEKGACEKLTADNIVLAVGSRPYRPKDVDFTHP
    RIFDSDTILDLTYTPKSITVYGAGVVGCEYGSMFRNLGVKLNLVNTRERLLEFLDDEISDALSYHLRDHGTVIRHGEVYE
    KIEPTDDGVVLHLRSGKKLKTDVLLWANGRTGNTENLGLEAVGLTPDSRGQLKVDGRYCTSVPSIWAVGDVIGFPSLASA
    AYVQGRAAALHMTQSDAAQLLANDIPTGIYTSPEISSIGKTENELTAAGIPYEIGQAQFKSLARAQITGQRVGMLKLLFH
    RETMAILGVHCFGQNASEIIHIGQAIMNQPGSGNSLMYFINTTFNYPTMAEAYRVAALNGYNRLF

    >gi|283779120|ref|YP_003369875.1| protein of unknown function DUF1573 [Pirellula staleyi DSM 6068]
    MNRTVAIVATILLALATLIVYASSQSTFLYKHRDSPELRVVIGENGAAIVEAATVEGRKKTKLPEAIAPSKEYDFGVMDP
    LTDGFHEFVIRNDGDAPLKLDVGSTT
    CKCTVGGLSDREIPPGGEGKVKLEWNTGRYNLFYSHYAEIKTNDPFRKSIDFNV
    KGKVRQELNANVPEIIVPKMQPGTETTASVLLYSQLYDNFTLSNLKSNLPGLAWKIEPATIDDLPDYDAKMVQKLVVTLP
    PDLPQGNFSDTLYMQVSPGTPGAQPIDFQLELKGQVGLRLTMYGAAVSSLDGEGQIDLGKTKQGKAKATKVLVKIRDDEP
    TLTAPKITLIPDFLQAELKPHESDDQVAGLYDLVITIPEDAPACQMLGNPYGTIRIATGHPRIGEVSLNLLMVVSE

    >gi|283779181|ref|YP_003369936.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MSEWLEEGAKAPAFTLVADDGKKVKLADFKGKPVVLYFYPKDDTPGCTKEACAFRDKAADLKKLGAVVLGVSPDDAASHG
    KFRDKFNLNFPLLADPDHAVAEKFGAWREKNMYGKKSMGIARSTFIIGGDGVIKKVWKAVKVDGHDEQVLAALQELA

    >gi|283779261|ref|YP_003370016.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MRVFHWFLAAALIFGGHVAAVNAQQIVAEEGDEAANALAELEKKFEVPETKDVAQLLEFIGSIEKIRPTTREELMVIRKK
    GPLAISTAAKTILEVEKDTKSPAYRKASGIVLTTDAQKALSPDADVAVRDAFIAKVDEFLAGGELGRQELMVAQQIVSGL
    EYSGNDASVAKAGELYSKWGAKFAESSDEQIARYGKMFVGAGRRLTLVGKPLELKGTQMDGAAFDITSLKGKVVLVDFWA
    TW
    CGPCRAEHPNIVANYKGYKDKGFEVVAVSLDADRGALEEYVKEHNTGWVNLHEKEAEGKNPATEYYGILGIPCVMLID
    KEGKVVSTNARGEKLGALLKDLLGPADPVKAEEPKTE

    >gi|283779262|ref|YP_003370017.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MSRRAIQTPANGQRITLWAIVGCVAMLSLVSCAKQNETKSSGPKYRPEGEPGEVASSSPGSEEPASETPVADPAAEPTIP
    TAAGPKLKYPVPAGSNAELLGYIDSMSKRQPQGASREETVADYIDIQASRLSAAEQVIASKPSAEERIRAFQAIHDVYRT
    RSTLQLPGARQELQDFATKLSKDADKEVARFGRIITFDMNVSALAQEGPDNAPQIVDQVKQLIAVDKQELDTLILCSQVC
    EVLAQMGAREETISALKMVSEAFKDHPDERARNQAAMMADRAVVVEFDLGNKAADMVTGAPNAEENLLKGVDGLLKHPNL
    TPAIYEAVREVAQMMEYSSNIEVAAKLYDKIDTAFAAHPDEKLQAAVKEASGNAKKRVSLIGQPFEIEGNTLDGKPFDMS
    TLAGKVVLIDFWATW
    CGPCLEEIPNIEQNFQAFKDSGFAVVGINLNEKLEEVTEFFGVQELPWPTVISASDDSRGFDHPT
    ARKCGVDAIPFIVLIGKDGKVDSIHVRGPKLKTKLTQLLGAPAAPASEPLAEPPAETPAAETPAATPAEKPATETPAETS
    PPVAPAPEEKPAEPTAPAAEEKQVSHSGARGRTSMFSWLESRLLLTSLLADEASEAKSPEAVDPAADFNPYAAKPGLASD
    ALVDYLFRMLDKPKTIQLRSGFSEALLDACDRILAADPAAKPTEQLVALETKFQTLHAMACRGDVAADEKLAVMVEKYAA
    DERPRVVKQVKFFQLEKKILAAAEIDIAELEASLETIAQELADEKMTASHLRLASATVAAINRIENGETREKYFQSFGNL
    FVKSSDKELSRYGKKLAKKPAAKESDLVGKPLELVGTTAGGEAFAWDAYRGKVVLVDFWATW
    CGPCRKEMPNVKQLHERL
    GKDGFDVVGISLDKDLEALAGYLETETIPWTTLAGDETQGLAEKYGVRGIPTMMVVDKQGNVAGVAHNVAALAPIIEKLL
    AEK

    >gi|283779363|ref|YP_003370118.1| thioredoxin [Pirellula staleyi DSM 6068]
    MAAEGVLELTDSNFQTEVISSSQPVLVDFWAPWCGPCRKIAPMIDELASENAGTAKIGKVNIDNNQEAAMQYGIEAIPTI
    IIFRDGQPVQRFQGIPAKSRVQEALDAAKA

    >gi|283779386|ref|YP_003370141.1| Thioredoxin domain protein [Pirellula staleyi DSM 6068]
    MSDEPKNENLLPMVSAEAAAENAAQEPVEKPWFIQETTAEFFERDVIEASHKHPVVVDFWATWCQPCRLLSPVLDKVVSE
    FDGQIVLVKADTDQVPRFAQAFRIDSIPAVFGLKRGKVVAQFKGLLPEERLREFFKSLLPTEAEEFLRKAQELEATDLAA
    SEQAYREALMKSPNDLEALGSLARVLLAQNKLEDCKVLLAEAEKAGVVEGGLAKIAAQVRLASTAVPSDKLADLQSKLAA
    DPKAHDIRLQWAEGLLAAGESRAALEAFLYVVENDRAKFRSQAREKMVDAFRVLGEENPLVAEFRRNLSLALY

    >gi|283779399|ref|YP_003370154.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pirellula staleyi DSM 6068]
    MKLVIVGGVAGGASAAARARRLDESAEIILLERGPDVSFANCGMPYYIGQQIVDRKRLLVVTPERLRERLNLDVRPQTEA
    IAIDRAKKQLRVRNLANDEEYDLTYDKLILAPGASPFRPAVPGFDLLRVMTLRNLSDMDRIAAASSAAKHVVVMGAGFIG
    LEMIENLVHRGISCTLVQNQSQVLSPLDAEMTTPLAEELVKRGVDLALSDSATSIETVESTGRMRVQLQSGREVETDLVV
    VGIGVRPENQLAIAAGLALGDRGGIAVNEAMQTSDPDIYAVGDVVETRDVVSGVKQLMPLAGPANRQGRIAADHLFGRPA
    KFRGTQATAIVGLWKLTAAMTGLSEKVCRLRNIPFCAVYIHPAHHATYYPGAEPMSLKVLFDPTSGRILGAQGVGGAGVD
    KRIDILSIAIQSKMTVFDLEEAELCYAPQFGSAKDPINMVGFVAAGMLRGDHPQIDVRELLAMDPSVRPLVLDVRTSEEF
    AAGHLPGAISISVDQLRGRLSELDPTRKIAAY
    CQVGQRGYFATRILLQHGFDVVNVSGGYKTYLLHFPAGYSANAS

    >gi|283779424|ref|YP_003370179.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MIRRMFLSLALIAAVVAPSFAAEIAPGEKAPEFKGLVGTDGKEYGLADMKDAKAVVVVFTCNRCPVAIDYEDRFIEFTKK
    YKEKGVSFVAINCNRRTEDLEAMKARAEEKGFNFPYVFDKTGATATEYGARVTPHIFVLDGNRAVQYVGAFDNSANEPTK
    HYVVDAVEAILAGKAPEVTQTKAVGCGIAK

    >gi|283779425|ref|YP_003370180.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MSRSLSLLTLATLMISALLLGCEQSAPVMTQPTPTKVAPPVLSAEAAPAKSPNAISPEAVVLTMGNEELLAESLKKHRGK
    LVFVDYWATW
    CGPCVEFFPHTVQLHEKFGDKGLEVISVSFDNLAEEGKVRLFLADQGAKFENILSSYNGASVEAAEGFQF
    EGVLPHFRLYGRDGSLLAKWDGAPENIDAEIERLISGVDPVSPAAEAPSTETPTETAAPVASEQ

    >gi|283779487|ref|YP_003370242.1| transcriptional regulator, AraC family [Pirellula staleyi DSM 6068]
    MPISDARTSSHISTLSDDKRWQAVLAREASCDGQFVFAVRTTGIYCRPSCSSRLARRENVRFFATPLLAERAGFRACKKC
    HPRSAVRPIHPAVVATCQRIEHSSTPLTLDELAAEVGLTGPHLQRIFRRTLGVSPKQYALAERQQRLHQQLEAGASILDA
    MHASGARSTSQIYGPKSARSGLSPAERRRQAATTTLATIVAPTWLGSLAIAATERGIVAMELADSAAAAEQLLRKRFPRA
    AFVPASEQLTRWALLAVASIERPTQSVELPLDVQGTAFQRRVWQELQNIPAGATRTYQQIARAIGQPTAARAVGTACGKN
    PIAVAVP
    CHRAVTQSGRITGYRWGKDRKAKLLERESQP

    >gi|283779555|ref|YP_003370310.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MFENLMRRSLQWLDAVPPTTTVFLRFDRSLPTRARKFESRFMSHFAFRLLSRTSALLALALLTLVASAQEAPSAADVKPE
    EAKPAEATAPAEATPEPAKPEEAKPANAKPEEVKPEEKKPDEAKQEDEKKDDAAHPMADDVKAGHSFHAEVFNEGPRQKA
    YLMPGMPEIVFPITTTNPEAHKFFLQGLGQVHGFWYFEAERSFRQAAALDPKCAMAYWGMAMANVDNNSRAKKFMEQCVK
    HKEGLTERELMYIDALDAYFKADNGKKKERAEAYTRALEKILYKFPEDVEARALLALQLWKNRDSGLPIQSHLAIDALLD
    QVFKAQPMHPAHHYRIHLWDYERAENALASAALCGQSSAGVAHMWHMPGHIYSRLKRYDDAVFQQEASARVDHAHMMRDR
    VLPDQIHNFAHNNEWLIRNLIFIGRTSDALDLAKNMSELPRHPKYNSVSRGSSFFGRQRLFEVLTKYEMWDELLALSETQ
    YLEPTKNDGEQLKRLRHVGQAAFRSGKTEKGLQILSDLRAQLDKEKKSKDEAIAAAEKKAVDEKKNEGDTKKAKEQAGKA
    FDTKINNLTKAVDEVEGYERWAAGDATKAHELLKKSGHVDPLVLAVVEFESGKRDEAIKAAQSQIDSRTNEVLPYMTSIQ
    LLYKSDRKEDAKKQLEKLQTIAANIDLASPVAKRLEPIAQEFGFQADWRVPAVAKNDTGNRPALDSLGPFRWQPSAALSF
    NLKDVEGKPIALSDYTGKPVVLLFFLGHG
    CLHCAEQLHAFAALKQQYNDAGFELLAISSDDAEGLKISIENYKDGPLPVK
    LVSDPTNETFKAYRCFDDFENQPLHGTFVIDATGNVRWQDIGFEPFMDGKFVLEEACRLLGKTVPEKPSTPEPAAATTST
    EKPAETTAATPMETTATSVPAAN

    >gi|283779795|ref|YP_003370550.1| Thioredoxin domain protein [Pirellula staleyi DSM 6068]
    MVASVATVLLVLAAGGDAVLLQFSSQNCAPCQAMQSTVERLAGSGYSVRRVDVDNYPQVARQYDVREIPCFVMLHGGRET
    DRVVGRASFDRLAAMYTPPEQNSQPSTTFVSHPGAAQGPSAAQPAAQYVPTPYKPEPYQPQHLAAAPMAQAPVAQAPAAS
    QPQVPAAYEQADFSTPRAVAVTPTQYREEAANPTDVRRRAMAATVRLKVEDETGFGFGTGTIIDTHDDEALVVTCGHLFR
    ESQGKGTISVDLFAAAGAPSIAGQLIAYDLTRDIALVSIRPGMKVTPMTVASGLTPVVPRESVFSIGCDKGGEPSVRDSQ
    VTGVNKFRGPPNVTVAGQPVDGRSGGGLFSEQGELIGICNAANPADDEGLYAALGSIHWQLDQIGQTQLYKREAEVSQQS
    PAAMPQEVPPAQSQQFASNAFAANEAVAPAAAVQPAGNFALPEEQLPTEFPQRQQEVAPAVMSASIPSGRQQFAKTVEDA
    FAGAGADEEMILIVRSRSNPAAPSQVYVLDRPGSKLVSEMAAVARPLAPAANAPPAQQLAREHQQPSNDPRSDRFARRDE
    YSNEPIIRGQSQP

    >gi|283779822|ref|YP_003370577.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MKWMIGCLSLALVSLFVSLNYAAEEIKVGDDAPDFEMVGSDGKTYKLSDFKGKQAVVVAWYPRAFTGGCTKECESFKKEG
    ASIREYNVAYFTASCDPADKNKAFAESLSVDYPILSDPDGSVATKYGIFNAERKAAARWTFYVGENGKILHIDKTVKTTS
    HGSDVAAKLGELGVAKKK

    >gi|283779828|ref|YP_003370583.1| UBA/THIF-type NAD/FAD binding protein [Pirellula staleyi DSM 6068]
    MSDDRFARYSRQVRFASIGKAGQERLAASRALVVGCGALGSMIASHLVRAGVGFTRIVDRDFLELSNLQRQTLYTEADVA
    SGFPKAICAEKHLREINSEVEIEAVVADIVPSNIEQLARNCDVVVDGTDNFETRMLINDVCVKLGIAWVYGGCLGAEGQS
    MTILPGESP
    CLRCVMPEPPDAGSSPTCDAAGILGTIIGVIASLQASEAIKILSGNRSAVSKKWTIIDLWDSDVRQLRLDA
    FGDRSQCPCCGKREFPWLSGERASYSAVLCGRNSVQLSFPGSAGINLAAMAERLRSVGEVSQNKFLVRLKVGDYQITLFA
    DGRAVVSGTEEIAEARSVYAQYIGS

    >gi|283779835|ref|YP_003370590.1| Rhodanese domain protein [Pirellula staleyi DSM 6068]
    MTPLEVDVETVAAMQKDGQPLLLIDCREENEFAHCRIAGSTLIPMQQIPARLAEIAPHQGGRIVVHCHHGGRSMRVTQWL
    RQQGYETVQNMAGGIDAWSQVVDPTVPRY

    >gi|283780000|ref|YP_003370755.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MISTNFLRQKVLIGACLGWMLLGPAGAIYAGKYNPKLSIGDAAPALEGLEATDGKKYSLADFQEKRFVVLAFTCNTCPYA
    VDYEDRIAALAKKLTDAGDGVVLAINANQVEDDLLPAMKQRAEEKKFPFLYLHDATQQVAKSYGATYTPEFVVLDEHRKV
    VYLGAMDDSPDGKKIEKPYIDNVIAALRAGKSAEIAETPAVGCAVRYVRERRTKK

    >gi|283780152|ref|YP_003370907.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MVKTASTMVQLGSPAPDFSLLNVDGQMVSLSDLAPAEAVLVVFMCNHCPFVKHVAEELTRLAMDYLPRGLAMVGINSNDT
    NKHPEDSPEQMVHEAEQRGYPFPYLFDETQEVAKAYRAACTPDFFLYDKNRKLLYRGQLDSSRPSNGQPVTGKDLRAAID
    AVLGGSEAPQPQVPSIGCNIKWKEGLAPEYFDPAGVKL

    >gi|283780161|ref|YP_003370916.1| periplasmic binding protein [Pirellula staleyi DSM 6068]
    MAERIVSLLSSATEFVCALGLGDKLLAVSHECDFPAQVRSLPQATRSRIDSAKPSSEIDLEVRELLRRCEPLYEVDEQLL
    ATLAPDLVITQAQCDV
    CAVRYEDVVDAVARTPNLVATKIVALQPLSLTDILDDAERVATAAGVPDRGQQLRFQLASRIEH
    VQSITNSLLPHQRPRVVCLEWFAPLMTASNWTPELLQIAGGTSLLTKAGAHSEYATWQQVVDADPDLLLLAACGFDLERT
    KLEARQVTSLPGYRDLKAVREGRVYVIDGNALLNRSGPRIIDTLELLAHLFHPQHFPRDPLAHYAVRAWQPLEA

    >gi|283780263|ref|YP_003371018.1| alkylhydroperoxidase like protein, AhpD family [Pirellula staleyi DSM 6068]
    MNDERQATVRLVDELGASGKVRQIFDDIKATKGIDRVPALWRALATAPDELELVWTSLKARMHPEAVGRESNLDAKTREI
    IALAVSATNGCSY
    CVNSHTAALRKQGVDQETLGEIMGIVSLFNSTNALAEGYQVEPDVFPPLD

    >gi|283780348|ref|YP_003371103.1| Redoxin domain protein [Pirellula staleyi DSM 6068]
    MRKFWRTTVLAALGLIAPLAAFGAKPSAGDALQLLPVQSTVDFDRPTAEEAAKCTVEIESVGGITGWVVKGESGQVLRRF
    LDSNGDGKVDQWCYFKHGIEVYRDIDANFNNKADQYRWLGTSGIRWGLDADEDSRIDSWKQISAEEVTAEVVAALAEQDS
    RRFARLVLSEKELVSLGLGEARTEQLRTKVQDASTQFSDLMKKQRVVTPKSAWIHFGASQPGIVPAGVDGATQDLVVYDN
    VTAVVETAGKHSTLVIGTLVKVGDAWRLIDVPQNLAADATAQASVGYFFQASMSRRPETEGPADASTVSAEMQRLITDLE
    KLDKQLVESRSRTEVAKLNSDRADILDKLVTSAKSEEDRGLWIRQYAETVAAAVQSAAFPEGVARLTSLRQMVAKMPEST
    DLVAYVKFREMSALYNLELSKKDVDFEKVNATWMTSLEEFVKEYSKSPDAAEAMLQLAIGSEFSGKEEKAIEWFGKIVSE
    FPSTDLAKKAAGAKRRLESVGKTITLSGKTVDGRAVDISSLSGKVVLVHYWATW
    CEPCKQDLDLIKDLQAKFGKQGFTPV
    GVNLDSDARDLGAYLRTKTLPWPQLFEPGGLEGRLANEMGILTLPTMILVDREGKVVNRNINAGELDTELRKLLR

    >gi|283780632|ref|YP_003371387.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MAMVNGMTIRVARVLAMHRTLLNLLLTLALVGGSFGTANAVEAVKSSQPGDKMPEFSLGDYQGKVWPAPELHGEKGTIVV
    FIGTE
    CPLMLQYASTLESLHKKYSDKGLKLVAVASNQQDSLTELSAFARQHKLTFPILKDPGNKVADEFKAERTPEVFLL
    NASRTLVYRGRIDDQYTYGRARPEVKENYLVNAIEAMLVGQPPKVGTTDVVGCHIGRVLRGTGDQSVTYSKQISRILQDK
    CVNCHRPGEIGPFALTSYSETVGWAAMIDEVVSENRMPPWHANPKHGSFRNDTRLSDAEKSQIHQWVEAGAPEGDPADLP
    PPKQYETGWQIGKPDLVIEMATKPYAVPAKGEVKYQYFIVDPKFTEDKWISAAECRPGNRAVVHHIIVGLVLGDGSRLSG
    GQHSEWLTATAPGARPLMLPEGLAKKIPAGAKLVFQMHYTPNGTATEDLSSVGLKFADPKTVRKEVATDKAATRRLQIPP
    HDDNYHTVAEQTIARDIQMLAMFPHMHLRGKAFRYTARYPDGEEEILLDVPNYDFAWQNSYEFTEPKLLPKGTKLVCDAW
    YNNSESNLANPDPSATVGWGDQTWEEMMIGYYDAVWADQDLLQENGRAEGARTSLFIARTLAGETKLPAELLIACESALD
    QPEALQALGAELRKVLPQLDRVCVTSVDGKKVVVKHCVQDPLYEGAVGGVGKGIDAAWSKLGSLIEAKKPTVYSSLVDES
    GFDLKHMAKAYRSSVHVPVKIGETPSTINFWSAESDAFPEEAVALIEKIAAALAK

    >gi|283780692|ref|YP_003371447.1| electron transport protein SCO1/SenC [Pirellula staleyi DSM 6068]
    MNRAALGWLALLLVFMGSTVIYLGWKMSRTPDTGASALEVDTSYRNVPMSSNEPMLTQFELTERSGKKVSSTDLDGRVYV
    TNFFFSS
    CPGTCLLQNQKVQEIQREFGKQGVQFVSITCDPEIDTPARLREYAHKLSADEKEWWFATGDLTYIRRIAGEIY
    KAPLDKQTHVDMYFVTDKWGNVRGHFEWNQLAKITEMKSLLAKLLTESEEPAEFKQDDSKTSESSESATNAPSAETSAKS
    NEEPSVTAEVDSKPESASSLEVATP

    >gi|283780739|ref|YP_003371494.1| iron-sulfur cluster assembly accessory protein [Pirellula staleyi DSM 6068]
    MTIQMTESAAKEVLKYKENVQAEGETFLRVKIVAGGCSGHTPSLTLDKNFDEMKDSKYNYFGVDLVVDKKSELYLDDATV
    NFINGLEHSGFHIDIPSAKKSCGCGSSYQF

    >gi|283780887|ref|YP_003371642.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MSLAISKTQMLAGFAAVTLATVATLWADADSPPAKGDVAKDFTLQTLDGTEVQLSKLNAKGPVVVVVLRGYPGYQCPACN
    AQTGEFIGAAKKFAAAKANVVLVYPGEGKGLEKFAKDFVTGKTFPDNVMLVTDPDYKFTVAYNLRWDAQNETAFPSTFVI
    DAEGKIIYSKISETHGGRAPVAEVLKALE

    >gi|283780922|ref|YP_003371677.1| thioredoxin reductase [Pirellula staleyi DSM 6068]
    MAEHVVIIGSGPAGWAAAIYASRANLHPLVFEGAETEENRVAGTLPLGQLNLTTEVENYPGFPSGKLDGYISSALPKDRI
    DTYLAPLEEHPHAVTGPELMNLMRQQAVNFGARIITDDVVDIDFSSRPFKLTSLEGQKVEAETLIIATGARANYLGLPSE
    DKFKNRGVSA
    CAVCDGALPRFRNKPMVVVGGGDSAVEEATYLTKYASTVHMILRRDQFRASKIMAQRALTNPKIQTHYFR
    EVVEVLGNDKEGVTGVKLASTQGDGVTEELDARGLFLAIGHTPNTAFLKGALELTDKGYIRWTQMYRTITSVEGVFAAGD
    VADDYYRQAITSAGTGCMAALDAERYLAAKGL

    >gi|283780949|ref|YP_003371704.1| hypothetical protein Psta_3180 [Pirellula staleyi DSM 6068]
    MSKHAPIIALALLLVASLASGQDQIRWTADFRQACEMAAEQRRLVLLHFYSDDCPPCVKLDRNVFSQADVATAIDRNYVA
    VKVHVKQNPQLAMRYQIRQWPTDVIVSPSGLEVFRTVSPQSPRDYIALMEQVAQQAGSTTGQQTPSPGPATDVAREPVYA
    NQQTAASSPYAQAPIENTSVRSSYQPVADAATTANNSVYGNPAASPYIANGGQFGGYGMTPPAATPGQPAAAAPVENSQP
    MANRYSGGYQPAASQTPVAPARESYTQQPSAPQYTQQGVMTNPYASAPAPAGSESAYQQQPAPSAATPSYSAQGSYAPPA
    SSQAGYGNSGYGQQSYGQQSYGQQAYNDPGYGASGYGQTAEASQNPVVPASANPPLSSAQNQFIAAVDAPQLAMDGYCVI
    TLLDRRAWKKGDPQWGAVHRGRTYLFASEAEQKKFLVDPDRYSPILSGCDPVVFARSGKLVEGKRAFAIAYGERLFLFSD
    ASALDEFGRAPENYAVPARQAMMQADTQLR

    >gi|283781090|ref|YP_003371845.1| protein of unknown function DUF1573 [Pirellula staleyi DSM 6068]
    MIRSLSFTLLVLLASASPCFAKEWAQKMFKITSHEFGHVARGAKTEFAFEIQNLYEEDVHIVDVRTSCGCTSASIAGGKS
    TLKTWEKGAIIAIFNTKSFTGQRQATLTVVIDKPYYAEVQLNVNGYIHSDVDFTPGSVAFGDVEQGTVLSREVAINFHGR
    SNVQIADVRSANSHFEVELGDAMRTQTGVTCKMLVRLKNTCPPGYLNETLTIVPADKSMQPIPLSVEGRIVSPLTVSPAN
    LFVGVVAPGESVTKQLVIRAKSAFRILNIKANHEGFTFKPSDQSKTVHLVPVTFTAGADGGDFVAELAIETDLGMGASTT
    CEVRGTVKLSEATEPVSVRVE

    >gi|283781091|ref|YP_003371846.1| NHL repeat containing protein [Pirellula staleyi DSM 6068]
    MMAREFWLRFSALSVAGLMALTGCAGQPASTTPIPTAALATEAPAEKPSESTDVNSAESAPASENSEPDSPAPAESPASS
    PAEPASESQPTEAPAEEAKEPAPEVAAEDAPKAEEPEIAHPFPRRFDLPDFPKDMEWINTGALSKRDIKGKFVLLDFWTY
    C
    CINCMHVLPELKKLEKKYPNELVVIGVHSAKFDTEKDAANIRSAVLRYEVEHPVVNDAEHEIWNMCGVSSWPTVLLVDP
    EGFAVWGRAGEFKFEEVQAVIERAKPYYIAKKLLDEKPIKFPLESEKEAPTPLRFPGKILADAAGQRLFISDSNHNRIVI
    TSLDGKLIETIGSGVIGKADGSFAEASFDHPQGCALDGETLYVADTENHLLRKIDLTKKTVTTIAGTGKQAESAWPGIEE
    VRLTAEVPERWVGPPKTTGINSPWALWVHEKNLYIAMAGPHQIWKMPLDESEIGPYAGNGREDIVDGPLIPKVPYTEGFS
    SFAQPSGLSSDGEWLFVADSEGSSIRAVPFDPTKEVRTIVGTSELPGGRLFDFGDVDGPRERAKLQHALEVVYSEGKIYV
    ADTYNNKIKLVDAKTGEVKTIAGSGSPGTSDDPATFDEPAGLALVGETLYVADTNNHLIRKVDVATGKTSTLTIEGLTPP
    QKPVAAKTPDFSSAKVEKLETVTLKPVDGKVTLQVKLVLPEGWKTNPLAPMSYYVDLAGESGPVSRAAAGKKKLAAPTST
    FAVELPVTSDGTDEVTISLNYYYCEKSDEGVCKIGSVVFKVPLKLDAAAESASAELSHAAAE

    >gi|283781294|ref|YP_003372049.1| heavy metal translocating P-type ATPase [Pirellula staleyi DSM 6068]
    MANLTFGVDGLTCGHCVKQVTAALSVLPGVEHVDVELETGTVRLDTRGDAPPREQLRSAIEQAGFAMLDAPQLSTSQKSA
    PAQQPQLLQLGLAPSNPPTPTLQTTPVEERPASGETSVRLSVSGMH
    CSSCVARVEQSLARVPGVEKVEVDFASNQARITS
    HRPLLGETLTAAVTAAGYQASIVDETSNHAATGQSRAHEETLQWRRQMIISIVLTAAVLVLENYGQSIARSWFSPSVAPT
    AATAITAILVLLASLLQVVIGWPFYQSAWRSLAARSLNMDTHIVLGGTAAFGLGLYETLAHGHGMGLGDAATILALVTVG
    RYLEAKFREQASESVTGLSSLLPQVTLVLRAGQLVEVPSSQVQVGETIVIQPGASVPLDATVIEGQSSTSEAWLTGESMP
    VEKRPGDLLLAGSVNLDQSLTAEVRSARGDSRVAKLTQLVEEMQFSKSKLQRLADQVVAWFTPALLAAGLLTFIVWFFIP
    GSTWQNSLIRATSVLVVACPCALGLAAPLAMMVAAGRGAREGVLLKNAAAIEQAGKITTVVFDKTGTLSLALPEVCAIKA
    APGSSTTELLAVASAIERLSSHPLARAIVAKATADKVSCDIAQQVRAVAGEGVEGMVRGERVLVGKRSLLSAHGIDVEPV
    VDDNLQSSESTSFTAKLRCHVAIGNRYLGSIEAVEQLQPGCKEAIAALKASGLRVALLSGDTQSAAEELAARVGIDDVRG
    GVRPEEKLAEIAARRSRGEVVAMVGDGINDAPALAAADLGIAVSTAVDVARQSADLVLFRGELGQVARAIKLARLARRIV
    KENVLWAFSYNLILVPMAAGVFIPIFGIALPPAFAAAAMGLSSVSVVLSSLRLRWQSLD

    >gi|283781364|ref|YP_003372119.1| hypothetical protein Psta_3598 [Pirellula staleyi DSM 6068]
    MTGLAAGILLQMALLTTSAQPYDQALTSAKADGQPLLVLIGADWCPGCRTMKHSVLAGMEQGGRLKDVNYAVIDADRDAA
    LARQMMRGNSIPQVIVFSKTADGWHREQVTGAVSEGHVQGMLARATAAAKKSTEPAAQPATEVASKTDSQ

    >gi|283781505|ref|YP_003372260.1| methylated-DNA/protein-cysteinemethyltransferase [Pirellula staleyi DSM 6068]
    MSTITKRRRLTSAQQTSRESLPGELPQWSYVLETELGYTAIVWSESKLTSLVFGRRSAAIALQDSAAVAVTNPPKWIAKI
    AKRLAAFTAGKRDDFADLPLALDHLAPFTRTVIDACRAIPLGETRSYADLAAMAGSPRASRAVGSVMRTNRFPVVVP
    CHR
    VVASGGKIGGYSAPDGLDMKRRLLALEQQIVAKSRGPH

    >gi|283781558|ref|YP_003372313.1| Methyltransferase type 11 [Pirellula staleyi DSM 6068]
    MSAESTSLNLLSVEQVVRERYSQASQKVEPALCCAVTPSQPELLKVLPPEIIERDYGCGDPAKYVTAGETVLDLGSGVGK
    ACYVAAQIVGAAGRVIGVDMNDDMLSVARKYQPEIAQKIGYSNVEFRRGRIQDLATDLDVLDAMLASTSVANAADWMAFE
    ERRKLLAKSEPMIASESIDVTLSNCVLNLVAEAERVQLIAELYRVLRPGGRAVISDIVSSKPVPEHLKNNAELWSG
    CISG
    AFEQRAFVKAFETAGFTAVELLERQAQPWQVVEGIEFRSVTIRAYRPKLTVATGEVAYVTYRGPWRSVMTDDMVLLSRGE
    PMLVHAEVADRWMIGPLKQQLIVERAFFGGPASQQSSATEEHGCCGEATKCC

    >gi|283781654|ref|YP_003372409.1| dihydrolipoamide dehydrogenase [Pirellula staleyi DSM 6068]
    MHTPLVVLGGGPGGYAAAFLAADEGLDVVLIESEPRLGGSCLLRGCIPSKALLHVARVISETRELTAEWGVEFTDPKISV
    DKVRARKDKVISNLSTGLKGLAKKRNVKVITGKGVFENSTTIRIEGTDPSIPEDRTVTFDYCIVATGSFPTMPPNFNIGS
    DRVMDSTGALALADIPETMLVIGGGYIGLEMGTVYANLGTKVSVVELTDGLLMGADRDLVKPLARHLDKLFGGRIFLNTK
    VGSIGLRGDKVEVAFEGPAKYGTEQYDRVLVSVGRRPNSRGFGLENTQVEVNQKGFIVCDRSQRTADPHILAIGDIAGEP
    MLAHKASHEAKVAVEVILGKNVVFDKQAIPAVVFTDPEIAWAGLTEDQAKREGRKVEIAIYPWAASGRAQAIGRLEGLTK
    WLIDPETERVLGCGIVGPGAGEMISEAALAIEMGCVVRDLTETIHPHPTLSETMMNAGETFFGTATEIYKPKRHAAEA

    >gi|283781694|ref|YP_003372449.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MAVLVTQPAPEFKAQAVMPDKSFKQVSLADYKGKYVLLFFYPLDFTFVCPTEIIAFSDRGDEFSALDTQILGVSVDSHYT
    HLAWRNTPRTEGGLGEISYPLVADLNKDIARNYGILLPGGVALRGLFLIDKTGVVRHEVVNDLPLGRSVDEALRMVKALQ
    YFETNGEVCPANWKEGSRSIKPTVSDSKKFFSAEYAAKS

    >gi|283781882|ref|YP_003372637.1| methionine-R-sulfoxide reductase [Pirellula staleyi DSM 6068]
    MPKVHLFDRSGTLVGPVETNKVVKSDEAWRAQLSPDQFRVLRCQGTERPFCGVLLDNKKSGVYCCAGCRLPLFSSQSKFN
    SGTGWPSFFAPIAPGNVVEHADHSHGMTRIEIVCGRCDGHLGHVFPDGPPPTRLRY
    CLNSESLDFVDDSELTSLADPLVE
    SAQQ

    >gi|283781883|ref|YP_003372638.1| peptide methionine sulfoxide reductase [Pirellula staleyi DSM 6068]
    MPIPVPEVIDTLILDRKKTTMPEPDESSSSPVSATKQAVFAGGCFWCTEMAFEQLAGVSDVASGYIGGSPETANYEAVCT
    GRTGHAEAIRITYDPAVMTYQTLLDVFFTAHDPTTLNRQGNDIGTQYRSAIFTSDEAELAAARATIARLDASGALPSRIV
    TTLEPLTEFYPAEDYHQDYARAHPNQSYIMHVSTPKACKVRNYFPKLIRREYLP

    >gi|283781901|ref|YP_003372656.1| UBA/THIF-type NAD/FAD binding protein [Pirellula staleyi DSM 6068]
    MAEPLIVDQDDRYSRLRLIGWWDQAKLQRSRVLVVGAGALGNEVIKNLVMVGVGHLIVIDLDTIENSNLTRSVLFRARHE
    GQSKAHVAAEMASEINPDVVITPIRGNVMTELGLGLFRDIDVAIGCLDNREARLWVNRCCWKTSTPWIDAGIQEISGVVK
    VFTPPESPCYECGMTENDYKLINLRYS
    CPLLPREDLLAGKVPTAPTSASIMAAIEVQEALKVMHGLPVKGGEAYVYSGLT
    NQFYTTRYQRKEDCLSHDTYPTAIDLPLSSETATAKDLFTAAAAHLPGEGPLTLHLDRDLVTGMKCAQCGAVREIVRASP
    LVTFRDAVCECREVMSVDRTHAIDESSPWSDRPLKTLGIPLYDIVRITREATGEEGFFLLAADRDRVLVKLPADAASREK
    KEPAQ

    >gi|283782076|ref|YP_003372831.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pirellula staleyi DSM 6068]
    MFWMLRAAGIYNLVWGTLVILFPNQWFTLAGMEVPNYPQLWQCIGMIVGVYGIGYWVAASDPARHWPIVLVGFLGKVLGP
    IGFLQGAIAGTWPWIAGTVNITNDLIWLPGFAIALYYAAKINSGEKYASPAYSWDEALHDVRFASGKTLEELSAKQDLLL
    LFVRHAG
    CTFCREMLADLGQQRQAIEDRGVGTAVVHVSTEKSIAAMLARYGLAHTDQLSDPDRRMFRTFELKRGAFWQLL
    GPRIWWRGFKAAILSGHGFGTMEGDGFQMPGVFLIRDGRIIASFRHELASDRPDYMKIVLSAQRM

    >gi|283782368|ref|YP_003373123.1| pseudouridine synthase, RluA family [Pirellula staleyi DSM 6068]
    MSTVVNIAAYKFAPLEGLKELREELLAHCKRANLKGTILLSTEGINLFVAGSREAIEVLVTRLRLIPGLAELTVKYSESE
    HQPFTRMLVRIKKEIIAFGVEGIDPARRPSPKLSPQELKSWLDEGRPVTLLDTRNDYEVKLGTFRGAKDVGITHFRDFPQ
    AILQLPEELKEQPIVMF
    CTGGIRCEKAGPLMQREGYQQVYQLDGGILKYFEECGGAHYDGECFVFDQRVGVDPSLEETET
    NLCYACQAPLTHEETLDERYVPCKSCPYCYVSTEQQRERACQAREAAIARLVSPLPGSMPYDNDRPLRVPQEYDGKPVIE
    FLAGILPHVPRDEWAQIAGEGRLRTSDHQPMVLESLVKAGDRVLHHQPATIEPDVNVDIRVVYEDEAIAVVHKPAPLPLH
    ASGRFHRNTLEWILREIYDPQKPRPVHRLDANTSGLVLFARTRHFAKLLQQQFTQGKVEKFYLALVSGHPVEDRFVSTAP
    ISAEAGVFGSRSVDEEAGLPAETRFEVLARTTTADGKPVALVRCQPITGRTNQIRVHLWQLGHPIMGEQSYLADQKHGTT
    QTHTVDDPPLCLLAHQLSFQHPVSRERMTFTSQLPAWTNLAEK

    >gi|283782407|ref|YP_003373162.1| 5'-nucleotidase/2' 3'-cyclic phosphodiesterase esterase-like protein [Pirellula staleyi DSM 6068]
    MRFRRCDGYVWANLAILAILSICLIALAIVVGCGSDPQETPAQEPASELAPPEVVLPTTDPLPGPEVEPPPRVQPAPEVP
    AAEPPTEPAAETPSPIPTAENPLRAPAATAAVDGETEKPSKAPPEPYAWPKWPKPQFAFFVTGQQMGYIEPCG
    CTGLENQ
    KGGLARRHSLLTQLKQTSGWEVVPIDVGSQVRRYGRQSEIKFTQTANALRLLGYQAVTLGKDDLRLNAGELLAATNPDTD
    RESIFTSANVALLARELQPRFRIIEAGGRKIGVIGALADDYEQQLQSDEIVHEGAVEALKAGAAEMKQAGCDLLVLLAHA
    SMDATKKLATAVPEFDLVVTSGGVGEPTRELVPIEGTKSRMAQVGTKGMYVGIIGVYDDAKEPLRYERVPLDSRLSDSKA
    MLDLLAEYQNQLQQLGLGELGLRPQPHPSGRTFVGTSTCVDCHTKAGEVWANSKHAHATDSLVTPPNSRGDIARHFDPEC
    LSCHVTGWEPQKFFPFASGYESLEKTPVMAHSGCENCHGPGSAHVAAENGDGSPSMADILQRREEMKLPLAGGVAERRCM
    ECHDIDNSPDFHVKGAFEKYWKQVEHIGKD

    >gi|283782408|ref|YP_003373163.1| protein of unknown function DUF1573 [Pirellula staleyi DSM 6068]
    MKLVLASLVALAVGVGLGILSTSFELGDDYLPVPLAERVTQGRPIAIVVNGDHHNFGKMQRNGKSSHEFIVRNDGTEPLS
    LTTGDTT
    CKCTLFKAGSGTLAPGESTKVKLEWTAKTGDEEFSQSAELRTNDPDRQVIRLVIEGKIFEPLKADRREVNFGT
    IVGSEPVSGVFRLLAFENKTLELATHEFSQERAKEKFKLESRPLTAEELTESDGATAGLEIRISLDSGLPLGALSQTIKM
    KTTAENLPMIELPIMATVVSDLSLSGPKVNQEKGLVSLGVLPRGKELKHTVFVLVKGPYRDDVQLTIDSVDPSTSLQAKL
    GEPSRDNPKIVRYPLEIIVPADATPVQRVSGGGFGQIKFKTTHPETKEFKVFVNFAVSE