Photorhabdus luminescens

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|37524218|ref|NP_927562.1| thiosulfate sulfurtransferase GlpE [Photorhabdus luminescens subsp. laumondii TTO1]
    MEHFQTISPEQAYQHWQNKSAIMVDIRDPQSFRTGHACGAFHLTNDTLNELMLQANFEQPVMVMCYHGHSSQSAAQYLLN
    IGFETVYSINGGFEAWRRDYPHAVDSLHNPA

    >gi|37524386|ref|NP_927730.1| glutathione reductase [Photorhabdus luminescens subsp. laumondii TTO1]
    METIRMSKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKALGGTCVNVGCVPKKVMWHAAQIAESIHQYGPDYGFDAT
    INRFNWKTLIASRTAYIDRIHQSYGRGLGNNKVDVIQGFARFVDAHTVEVNGEKITADHILIATGGRPVWPDIPGAEYGI
    DSDGFFALEEMPKRVAVVGAGYIAVEIAGVLHALGSETHLFVRQHAPLRSFDPMIVETLLEVINTEGPTLHTESVPKSVS
    KNADGSLTLQLQNGKEQTVDTLIWAIGREPVTDNLNLSVAGVELNEKGYIRVDEYQNTNVKGIYAVGDNTGAVELTPVAV
    AAGRRLSERLFNNKPEEHLDYTNIPTVVFSHPPIGTVGLTEPQAKAQFGEEQVKTYQSSFTAMYTAVTQHRQPCRMKLVC
    VGPEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMRG

    >gi|37524392|ref|NP_927736.1| periplasmic protein disulfide isomerase I [Photorhabdus luminescens subsp. laumondii TTO1]
    MKKLWLALVGMVMAFSVSAANFTEGKQYVELKSPVADQPPVLEFFSFYCPHCYQFEEIFKVPQTVKQHLPEGTKLVRYHV
    DFLGPLGKELTTAWAAAMAMGVEDKVTPVLFEGIQKTLAIKTPNDIRNAFIKAGVTAEDYDAAMSSFVVKSLVVKQQKAA
    QDLQLRGVPAMFVNGKYMVKNDGIDATSADNYAKPYSDVVNFLLSQK

    >gi|37524493|ref|NP_927837.1| thiamine biosynthesis protein ThiF [Photorhabdus luminescens subsp. laumondii TTO1]
    MLNDQEFMRYSRQLLLEDIGPEGQEKLKSSHVLIVGLGGLGAPASLYLAGAGVGTIYLADDDHLHISNLQRQILYRTEDI
    PSAKAELAANQLNALNPLIKTMVLNQRQNLESLTTIVKQVDLVLDCCDNMTTRHAINAACVATRKPLISGSAVGFSGQLM
    VFEPPYLHGCYNCLYPEQQEPLRN
    CRTAGVLGPIVGIIGTLQALEAIKMLTGLPSPLSGKLRLFDGKQQSWSTLQLNRSQ
    QCPICGDMA

    >gi|37524896|ref|NP_928240.1| hypothetical protein plu0904 [Photorhabdus luminescens subsp. laumondii TTO1]
    MMSDDIVLPLQFTDAAANKVKILVSDEENPNLRLRVYITGGGCSGFQYGFTFDDQINEGDMTIEKQGVELVVDPMSLQYL
    VGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI

    >gi|37525167|ref|NP_928511.1| Na(+)-translocating NADH-quinone reductase subunit D [Photorhabdus luminescens subsp. laumondii TTO1]
    MADSKEIKRVLLGPLLDNNPIALQVLGICSALAVTTKLETALVMTIAVTLVTAFSSFFISLIRHYIPGSVRIIVQMAIIA
    SLVIVVDQILQAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFLRELFGSGKL
    FGITVMESVQNGGWYQPNGLFLLAPSAFFIIGMLIWGLRTLKPAQVEKE

    >gi|37525168|ref|NP_928512.1| Na(+)-translocating NADH-quinone reductase subunit E [Photorhabdus luminescens subsp. laumondii TTO1]
    MEHFISLFVRAVFIENMALAFFLGMCTFLAVSKNVTTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMILDRYFPSLYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFSESIVYGFGSGIGWMLAIVLLASI
    REKMKYADVPAGLKGLGITFVTTGLMALGFMSFSGVQL

    >gi|37525254|ref|NP_928598.1| glutaredoxin-like protein NrdH [Photorhabdus luminescens subsp. laumondii TTO1]
    MSITIYSKPDCVQCSATYQVLSRRNIPYQIIDLTENPQALATIRAMGYQQIPVVVAGTQHWSGFRPDKINALIENV

    >gi|37525255|ref|NP_928599.1| methylated-DNA-protein-cysteine S-methyltransferase [Photorhabdus luminescens subsp. laumondii TTO1]
    MYHHYFDTPKGFPKPYIHITADDKGVTSLYFVDEKTAPEVKNDITKQCVKELRGYFAGKRTEFSVPLNPAGTEFQQRVWL
    QLCKIPFGEVWSYKQLSLALGSVNYCRAVGMANSRNPISLIVP
    CHRVIGHDGKLVGYTGGLNIKSWLLEHEKT

    >gi|37525438|ref|NP_928782.1| biotin synthesis protein [Photorhabdus luminescens subsp. laumondii TTO1]
    MGSVAEFANKQAIAGAFGRAAANYDVVAKLQQQTGEFLMQQVGEHSGKLVLDAGCGTGFFSHRWRQQGKQVIGLDLASGM
    LAHARKQLAADYYLQADIEHLGLADNSVDICFSNLVVQWCDDLSSALRELYRVTRPGGLILFSTLAKGSLYELKQAWSVV
    DNYQHINQFLPQQTIKDACQGFRH
    CLISQVYRQQYSHILPLLGSLKGIGATHLHDGRQQGLMTRGRLIALEQAYPRENEQ
    LPLSYQVVFGVIHRD

    >gi|37525471|ref|NP_928815.1| 3-mercaptopyruvate sulfurtransferase [Photorhabdus luminescens subsp. laumondii TTO1]
    MNNAYFVTPQWLKDHLDDKNLVILDATAPPPPQQIDCHKLWLNTHIPGAQFLDLDKIANHQSGLPHMLPDPQTFSQAVGA
    MGISENHLVVIYDQGNMFSAPRAWWTFKIFGSHNVRILDGGLQGWQQAGFPTASGEVKRNPQIFNTDFNADKVKSLEQIL
    GALNDQQIQIVDARATDRFQAKAPEPRPGLRMGHIPGSKNIPWTMLVENGHFKSETEITDIFHKQGVDLNKPVITS
    CGSG
    MTAAVLVLGLDIIGKKDVYLYDGSWAEWGADEALPLEK

    >gi|37525486|ref|NP_928830.1| molybdopterin biosynthesis protein MoeB [Photorhabdus luminescens subsp. laumondii TTO1]
    MTIELTDAETLRYNRQIVLRGFDFDGQEKLKSSAILIVGAGGLGCAASQYLTAAGVGTITLLDFDTVSLSNLQRQILHRD
    ERIGMAKVHSAQLTLRAINPHVTIKTVNGLLEDQALDELISQNDVVLDCTDNVTIREQLNRLCLARKTPLVSGAAIRMEG
    QLTTFTYQPNAPCYRCLSRLFGENNLT
    CVETGVMAPLVGTIGTLQAMETIKLLTGYGKVSSGKVLLFDAMTMQFRDIKLL
    KDPNCEVCNS

    >gi|37525528|ref|NP_928872.1| glutaredoxin 1 [Photorhabdus luminescens subsp. laumondii TTO1]
    MFTVIFGRPGCPYCVRAKELAERLKEQRDDFDFRYVDIHAEGITKADLEKTVGKPVETVPQIFVDEKHIGGCTDFEAYVK
    EHQLLQ

    >gi|37525546|ref|NP_928890.1| thioredoxin reductase (NADPH) [Photorhabdus luminescens subsp. laumondii TTO1]
    MSAAKHHKLIILGSGPAGYTAAVYAARANLNPVLITGVERGGQLTTTTEVENWPGDPEGLTGPGLMERMHQHAEKFQTEI
    ISDHIQKVDLQSRPLRLYGDEQEYTCDALIIATGASARYLGLPSEEAFKGRGISA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILISRLMDKVKNGNIILHTDRILDEVLGDDMGVTGVRLRDTKSGATEELAVTGTF
    IAIGHTPNTAIFESQLELDNGYIKVQSGLQGNATQTSIPGVFAAGDVMDHTYRQAITSAGTGCMAALDAERFLDGLAAK

    >gi|37525750|ref|NP_929094.1| hypothetical protein plu1816 [Photorhabdus luminescens subsp. laumondii TTO1]
    MPVLHNRISNKELKARMLAETQPRTTISFYKYFNILNPLDFRNSLYQQFTDLSVFGRVYIAKEGINAQISLPTHNLEAFK
    ALLYSVDPALDNLRLNIALDDDGKSFWVLRMKVRDRVVADGIDDETFDPSKTGEYLKAEQVNQMLDNPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMVAEMLQDNKDKNIVMY
    CTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYARKAREQGL
    PVRFVGKNFVFDERMGERISDDVIAHCHQCGVSCDSHTNCKNEGCHLLFIQCPECATKFEGCCSEMCREEVRLPETEQRA
    RRAGRENGAKIFNKSRHRLQDGLNSTSLQSVE

    >gi|37526240|ref|NP_929584.1| hypothetical protein plu2338 [Photorhabdus luminescens subsp. laumondii TTO1]
    MAKELFTATVKSVAGLKVECTSRDFSFYLDEPRNLGGTNQGMNPVEALLCSLGACKCIVAKAFAKLHKINLIDIHVDLEG
    ELDTDGFTGRNKQAKLGFSKIVTKFHIKADNSEEEIHAFVDFINKTCPVHDTIENAPSFVTEIYCE

    >gi|37526278|ref|NP_929622.1| Na(+)-translocating NADH-quinone reductase subunit E [Photorhabdus luminescens subsp. laumondii TTO1]
    MTDYFLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGFATTFVMTLASVCSWLVNTFILLPLDLIYLRTLSFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINQSHDFLQSAIYGFGAAAGFSLVMVLFAAIRERLAV
    ADVPAPFKGSSIGLITAGLMSLAFMGFSGLVKF

    >gi|37526283|ref|NP_929627.1| SoxR-reducing system protein RsxE [Photorhabdus luminescens subsp. laumondii TTO1]
    MSETKNLFIQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNIAVSSLRRWVPNEIRIPIYVMIIASVV
    STVQMLINAYAFGLYESLGIFIPLIVTN
    CIVIGRAEAYAAKNPIMPSAIDGLAMGLGATFALFVLGAIREILGNGTLFDG
    ADLLLGNWAKVLRIEIVHMDSPFLLAILPPGAFIGLGLMLAVKYLIDEKMKTRAIKEKSRAITMSPESESSI

    >gi|37526443|ref|NP_929787.1| selenophosphate synthetase [Photorhabdus luminescens subsp. laumondii TTO1]
    MSTEVRLTQYSHGAGCGCKISPKVLETILHSEQEKFLDPHLLVGNETRDDAAVYDIGNGTGIISTTDFFMPIVDDPFDFG
    RIAATNAISDIYAMGGKPIMAIAILGWPIDKLAPEIARKVIEGGRAACKEAGIVLAGGHSIDAPEPIFGLAVTGIVNIDR
    VKQNSAAKVGSQLFLTKPLGIGVLTTAEKKGLLLPEHQGIAIETMCRLNKLGMDFAEVAGITAMTDVTGFGLLGHLSEIC
    AGSGVQATLHFAKVPKLPEVESYIAKGCVPGGTGRNFDSYGHLIGEMTELQRKLLCDPQTSGGLLLAVLPEAMDEVKAIA
    RCHGIELTAIGELSEQQSGRVLIEVNE

    >gi|37526449|ref|NP_929793.1| methionine sulfoxide reductase B [Photorhabdus luminescens subsp. laumondii TTO1]
    MAKHPEVSLYKELTDIQRHVTQNAGTEPPFSGKLLHNKKSGVYHCLCCEQPLFMSGTKFDSGCGWPSFYQPATHDAVQYL
    DDDSHNMHRIEVRCGHCNAHLGHVFPDGPQPTGERF
    CINSAALSFTDENTGEKTVG

    >gi|37526456|ref|NP_929800.1| disulfide bond formation protein B [Photorhabdus luminescens subsp. laumondii TTO1]
    MMRFLNHCSQGRSAWLLMILTALILESSALYFQHVMKLQPCVMCIYERVALFGVLSAGILGVIAPKTPLRWLAIILWIYS
    AWGGLQLAWQHTMMQLHPSPFNT
    CDFFVNFPSWLALNQWLPSVFEATGDCSVRQWQFLTLEMPQWLVGIFAAYLVVAALV
    LISQFFSRK

    >gi|37526470|ref|NP_929814.1| thiol peroxidase [Photorhabdus luminescens subsp. laumondii TTO1]
    MTQTVKFQGNDISVSGQFPKSGEKAQDFTLTAKDLSDVSLSHYAGKRKVLNIFPSIDTGVCAASVRKFNQVASDLENTVV
    LCISADLPFAQSRFCGAEGLSNVVTLSTLRGGTFSEDYGVAISGSPLSGLTARAVIVLDESDNVIYSQLVDEITNEPDYD
    SALAALK

    >gi|37526495|ref|NP_929839.1| hypothetical protein plu2604 [Photorhabdus luminescens subsp. laumondii TTO1]
    MTTTIEKIERQIKENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVEGEL
    IGGCDIIIEMYQRGELQTLIKETADKCRSQGENATE

    >gi|37526513|ref|NP_929857.1| iron-sulfur cluster assembly scaffold protein [Photorhabdus luminescens subsp. laumondii TTO1]
    MTNSVETFSLNETAWQGITITARAAAQILKLMQQNPQSKGLYLGVKQSGCAGFGYVFEMVNDPAPDDLRYENEGACLYVP
    LKAMPFIDGTEVDFVREGLNQIFKFNNPKAQHACGCGESFGI

    >gi|37526611|ref|NP_929955.1| hypothetical protein plu2721 [Photorhabdus luminescens subsp. laumondii TTO1]
    MILDKSSQPAFTLYGIKNCDTIKKARRWLEEQEITYLFHDYRVDGLNATLLQSFIDKLGWESLINTRGTTWRKLTDQQRA
    TINNADAAKALMLEQPAIIKRPLLISAKGDYLLGYKVDEYQQFFAEAR

    >gi|37526638|ref|NP_929982.1| thioredoxin-dependent thiol peroxidase [Photorhabdus luminescens subsp. laumondii TTO1]
    MNPLKAGDKAPQFSLPDQDGETINLSDFEGQRVLVYFYPKAMTPGCTVQACGLRDEMDTLKDSGVEVLGISTDSPSKLSR
    FVEKEMLNFTLLSDEDHQVAEQFGVWGKKQFMGKTYDGIHRISFLIDTNGNIEHVFDKFKTSDHHQIVVDYLKLHP

    >gi|37526641|ref|NP_929985.1| hypothetical protein plu2751 [Photorhabdus luminescens subsp. laumondii TTO1]
    MQQVTIYHNPRCSKSRETLALIEERGIKPQIILYLEAPLAVEQLSVLLEQLGFHDARQLMRTKEDLYKELNLADEKLTQH
    DLLKAMIVNPKLIERPIVVCGDKARLGRPPEKVKEILD

    >gi|37527161|ref|NP_930505.1| iron-sulfur cluster assembly protein [Photorhabdus luminescens subsp. laumondii TTO1]
    MSISLTESAAQRVSSFLSHRGKGVGLRLGVRTSGCSGMAYLLEFADMINEDDTVFEDKGVKVIVDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|37527424|ref|NP_930768.1| thiol:disulfide interchange protein DsbC [Photorhabdus luminescens subsp. laumondii TTO1]
    MKKSVLCFPLLLAWFSGNALADDGAVHRIMQKLGIKAESIQPSPIVGLNTVVTEQGIIYLSDDGKYLLQGPIYDVSGSAP
    VNVSNQLLMKKLEAMRDQMIIYKAPEEKHVVTVFTDIT
    CGYCHKLHENMKEYNKLGITVRYLAFPRQGMQHQSAKDMQSI
    WCSATPQKSLDAAFKNEDVSPIKSCKVDIANQYKLGLQFGVQGTPAIVLKDGSLLGGYMPPEALAAALAQRGKSV

    >gi|37527489|ref|NP_930833.1| dihydrolipoamide dehydrogenase [Photorhabdus luminescens subsp. laumondii TTO1]
    MMSTEIKAQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALADHGIVFGEP
    KTDIEKVRVWKEKVINQLTGGLAGMAKGRKVKVVNGFGKFTGANTLVVEGEGGATTINFDNAIIAAGSRPIQLPFIPHDD
    PRVWDSTDALALTTVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    VVEAKEDGIYVTMEGKNAPAEPQRYDAVLVAIGRVPNGKMLDAGKAGVDVDDRGFIHVDKQMRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESNRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKKK

    >gi|37527680|ref|NP_931024.1| hypothetical protein plu3820 [Photorhabdus luminescens subsp. laumondii TTO1]
    MLPTSIGINVNESNLHQIVEQSMTVPVLFYFWSERSPHCQELSVTLDKLAAEYADQFILAKVDCDKEQMVAAQFGLRAIP
    TVYIMQQGQPVDGFQGPQPENVIREMLTRVLPKPEELKAAQAEELIAEGKHQEALPLLKEAWQLAPKNSAIALMLTKVQI
    MLNNIEEAQEILNLIPLQDQDTNYHSLLAQIELQKQAADTPEIQQLQQEFAIQPENAELAVKLALKLHEVSRNEEALELL
    LSFLKKDLSAANGAVRKTMMDIMSAMGTGNTLASKYRRQVYSLLY

    >gi|37527684|ref|NP_931028.1| copper exporting ATPase [Photorhabdus luminescens subsp. laumondii TTO1]
    MSYTTILTLQGLSCMHCVNSVKKALANRTDVEQADITIDYAKIIGKASTESLIETIQAAGYDAMIASQPDVELTLSGLSC
    MHCAGTTRKALEAVDGVIAAEVNTEKAKVYGKADADTLIAAVERAGYHAKLASGQNSPKSEPLTLPASNRPEPLAAATSS
    VPVEKADVSVVSDSNESIQLLLDGMT
    CASCVNKVQKALQGVDGVENARVNLAERSALITGSASPEALIKAVEKAGYGAEL
    IQDETKRRERQQQVSDANMRRFRWQSALALVVGIPVMVWGMMGDNMMLTPENHHIWLTIGVITLAVMIFAGGHFYRNAWQ
    SLKNGSATMDTLVALGTGAAWLYSISVNLWPDIFPPQARHLYYEASAMIIGLINLGHALEQRARQRSSKALERLLDLTPP
    TARVVTEDGEKEIPLADVKPGMTLRLTTGDRVPVDGEIIQGEVWIDEAMLTGEPIPQQKTKGDNIHAGTTVQDGTVLFTA
    AAVGSQTTLARIIKLVRQAQSSKPEIGQLADKISAVFVPVVVAIALIAGAIWYFVGPAPQIMYSLVIITTVLIIACPCAL
    GLATPMSIISGVGRAAEFGVLVRDADALQQASTLDTLVFDKTGTLTEGMPQVTDIHTFNGYSEQEVLRWAGALEQGSNHP
    LAKAILAKAKGLTLPQVEQFRTLAGLGISGEVNGTTLLLGNQAWLEQNQIDTQELKSLIAQQAEQGITPVLLAAGGQAAA
    VLSIRDPLREDTMTALQRLHHQGYRLVMLTGDNPVTANAIAKEAGIDQVIAGVLPDGKAEVIQKLQAAGRKVAMVGDGIN
    DAPALAQADVGIAMGGGSDIAIETAAITLMRHSLHGVADAVELSKGTLRNMKQNLLGAFIYNTLGIPIAAGVLYPFTGTL
    LDPVVAGAAMALSSITVVSNANRLLRFKPKF

    >gi|37527763|ref|NP_931108.1| alkyl hydroperoxide reductase, small subunit (antioxidant) [Photorhabdus luminescens subsp. laumondii TTO1]
    MVLVTRQAPDFTAAAVLGNGEIVGNFNLKKHLNGKPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVIGVSFDSEF
    VHNAWRKTPVDQGGIGEVKYAMVADTKREIQKSYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMSASPDGVAKYLSQNAAKL

    >gi|37527955|ref|NP_931300.1| zinc/cadmium/mercury/lead-transporting ATPase [Photorhabdus luminescens subsp. laumondii TTO1]
    MYSNSNKNSAHQHNHQHGSCCATTTCSDQAKQVSEHLHHHEHEHGKACSHKHHPSHDTQETQAPELLANQRFSWVVNGMD
    CPSCARKIETAVSKIAEVKQAKVLFATEKLVVDADTDIRSAVIQAVNQAGFTLRNSDSSQKAEKSSRWKEFAPIITLSLM
    MLISWGISHINPSFGRIAFIITTVIGLVPIVTKAWQLIRSGTPFAIETLMSVAAIGALFIDATAEAAMVLLLFMLGEMLE
    SYAAGRARRGVSALMALVPEEALLVKNGEKKIVPVSDLRPGDIIEIAPGGRLPTDAELLNSFASFDESALTGESIPVERM
    QGEKVPAGCLSVDRAIQMKVLSEQGNNAIDRILQLIEEAEERRAPIERFIDRFSRIYTPLIMLFSALVIIIPPTVFSQPW
    ETWIYRGLTLLLIGCPCALVISTPAAITSALATATRRGALIKGGAALEQLGLITTIAFDKTGTLTAGKPQVTDIQPAENI
    SESQLLALASAVESGSHHPLAKAILQCAESKNVNITEAEHRKALAGVGVEGQLNDKRILVSAPGKLPANTLSDRWKQKIV
    QLEDCGKTVVAVMHDEQFAGLIAMQDTLRQDAIDAIRLLKDQGIKSVMLTGDNPRAATAIAGQLGIDFRAGLMPEDKVKA
    VIALNKDHSTMMVGDGINDAPAMKASSIGVAMGSGTDVALETADAALTHNRLTGLSEIITLSRATHNNIRQNIAIALGLK
    GIFLVTSLLGITGLWMAVLADSGATALVTANAVRLLRIKLK

    >gi|37527984|ref|NP_931329.1| thiol:disulfide interchange protein precursor [Photorhabdus luminescens subsp. laumondii TTO1]
    MIKRTLMLFLLLCSPLLTPAAANALFEQPGQNPYLPVDQAFMFDFQQKGDKLTLDWQIKPGYYLYHKQLHIEPQQATLGK
    ITLPQGTAHRDEFFGETEVYFQQLIVNVPVTKANNNSNIVVTYQGCAAAGYCYPPETRLVPLSAVIPSKTTDAISAEPVH
    KTPESASNDQQHLPFSPLWAILIGIGIAFTPCVLPMYPLISSIILGSQRPKSLKQIFWLALSYVQGMAVTYTLLGLIVAA
    AGLQFQAALQHPYVLIGLSVLFILLALSMFGLYSLQLPSAVQTRLVNWSNQQKNGSLFGVFAMGALAGLICSPCTTAPLS
    AILLYIAQSGNTVAGGLTLYLYALGMGLPLIAVTLFGHKLLPRSGPWMQYVKEAFGFIILALPVFLLERVIGDAWGIRLW
    SLLAVSFLGWGFVLTIRSQNGWVRVIQLILLILMLIATRPLQDWFWGTTVTQQSQHSLNFRQINNWQELEQIMTQNSHKT
    VMLDFYADW
    CTACKEFEKYTFSDPQVQSQLGDTLLLQANVTNNSPQQKQLLEKLSVRGLPTILFFDSQGKEIPDSRVNGF
    MDATRFNEHLQHLPK

    >gi|37528374|ref|NP_931719.1| methionine sulfoxide reductase A [Photorhabdus luminescens subsp. laumondii TTO1]
    MPTSANKSLSIDPHSALPGRTEPLKVSPNHAVTDHTIEPVPENMEVAYFGMGCFWGVERLFWQQPDIYTTSAGYSGGTTA
    NPTYEEICSGLTGHAEVVRIVYDPAKNSYENLLKLFWENHDPAQGMRQGGDIGSQYRSAIYTVSPQQHELALASREHFQK
    AMQQQSDNRPITTEITEAGPFYFAEDYHQQYLFKNPEGYCGLGGIGVCLPKMNEN

    >gi|37528481|ref|NP_931826.1| thioredoxin 1 (TRX1) (TRX) [Photorhabdus luminescens subsp. laumondii TTO1]
    MSDKIIHLSDASFDTDVLNAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTITKLNIDDNPATAPKYGIRGIPTLL
    LFKDGQVAATKVGALSKTQLKEFLDANL

    >gi|37528556|ref|NP_931901.1| soluble pyridine nucleotide transhydrogenase [Photorhabdus luminescens subsp. laumondii TTO1]
    MQHIHFDAIVIGSGPGGEGAAMGLVKQGKSVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRVLRS
    SFAEILRRAEMVINQQTRMRQGFYERNGCRMFSGEATFIDDHRVSVRYADDNHDILSADKIIIATGSRPYCPPDVDFTHS
    RIYNSDSILKLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRNHLLAFLDQEMSDALSYHFWNSGIVIRHNEEYS
    KIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDTLGLKNVGLEADSRGLLKVNKIYQTSNENIYAVGDVIGYPSLASA
    AYDQGRIAAQAMTKGNAEVHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIAGMNVGSLKILFH
    RETKEILGIHCFGERAAEIIHIGQAIMEQKGESNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF