Photorhabdus asymbiotica uid59243

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|253987619|ref|YP_003038975.1| thiosulfate sulfurtransferase GlpE [Photorhabdus asymbiotica]
    MEHFQTISPEQAYQHWQDKSAIMVDIRDPQSFQAGHVCGAFHLTNETLNEFMLQANFEQPVMVMCYHGHSSQSAAQYLLN
    LGFEAVYSINGGFEAWLKNYPHAVDSLRNPA

    >gi|253987774|ref|YP_003039130.1| glutathione reductase [Photorhabdus asymbiotica]
    METIQMSKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKALGGTCVNVGCVPKKVMWHAAQIAESIHQYGPDYGFDTT
    VNRFNWKALIASRTAYIDRIHQSYERGLDKNKVDVIQGFARFVDAHTVEVNGEEITADHILIATGGRPIRPDVPGAEYGI
    DSDGFFELKEMPKRVAVVGAGYIAVEIAGVLHALGSETHLFVRQHAPLRSFDPMVVETLLEVINTEGPTLHTESVPKAVI
    KNADGSLTLQLQNGKEQTVDTLIWAIGREPATDNLNLPVTGVELNGKGYIKVDKYQNTNVTGIYAVGDNTGVVELTPVAV
    AAGRRLSERLFNNKPEEHLDYTNIPTVVFSHPPVGTVGLTEPQAKEQFGEDQVKTYQSSFTAMYTAVTQHRQPCRMKLVC
    VGPEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|253987781|ref|YP_003039137.1| periplasmic protein disulfide isomerase I [Photorhabdus asymbiotica]
    MEIVMKKFWLVLVGMVMAFSASAANFTEGTEFVELKSPVADQPQVLEFFSFYCPHCYQFEETFKVPQTVKQNLPAGTKLV
    RYHVDFLGPLGKELTTAWAVAIAMGVEDKVTPVLFEGLQKTQTIKTSDDIRNAFIKAGVTAEDYDAAMSSFVVKSLVVKQ
    QKAAQDLQLRGVPAMFVNGKYMVRNNGIDATSDDNYAKSYSDVVNFLLNQK

    >gi|253987818|ref|YP_003039174.1| sulfur transfer complex subunit TusD [Photorhabdus asymbiotica]
    MPSLSYCLLVTGPAYGTQQASSAYQFAQTLIAMGHKLNTVFFYREGVYNGNQLTAPASDEFNLVSAWQMMATEHQFGMHI
    CVAAALRRGVLDTQQANELNLPVANLAEGFELSGLGTLAEAMLTCDRVVQF

    >gi|253987874|ref|YP_003039230.1| 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate synthesis protein [Photorhabdus asymbiotica]
    MLNDQEFMRYSRQLLLEDIGPEGQEKLKSSSVLIVGLGGLGAPASLYLAAAGVGTIYLADNDQLHISNLQRQILYRTEDI
    PSAKVELAANQLNALNPLIKTTVFNQRQDVESLTKIVKQVDLVLDCCDNMATRHAINAACVAARKPLISGSAVGFSGQLM
    VFEPPYPHGCYTCLYPEQEEPQRN
    CRTAGVLGPVVGVIGTLQALEAIKMLTGLPSPLSGKLRLFDGKQQSWSTLQLSQSR
    QCPICGDIA

    >gi|253988306|ref|YP_003039662.1| hypothetical protein PAU_00825 [Photorhabdus asymbiotica]
    MMSDDMALPLQFTDAAANKVKILVSDEENPNLRLRVYITGGGCSGFQYGFTFDDQINEGDMTIEKQGVELVVDPMSLQYL
    VGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI

    >gi|253988465|ref|YP_003039821.1| hypothetical protein PAU_00984 [Photorhabdus asymbiotica]
    MLPTTTGIDINESNLHQTIEQSMTVPVLFYFWSERSSHCQELGVTLDKLATEYAGQLVLAKVDCDKEQMIAAQFGLRAIP
    TVYVLQQGQPVDGFQGPQPEKAIREMLTRVLPKPEELKAAQAEELIAEGKHQEALPLLKEAWQLAPKNSEIALKLTEVQI
    MLNNIQEAQEILNLIPLQDQDSHYHSLLAQIELQKQAADTPEIQQLQQEFSAQPENADLAVKLALKLHEVSRNEEALELL
    LGFLKKDLSAANGAIRKTMMDIMSAMGTGNALASKYRRQVYSLLY

    >gi|253988469|ref|YP_003039825.1| copper exporting ATPase [Photorhabdus asymbiotica]
    MSHTTILTLQGLSCMHCVNSVKKALGNRADVEQAEITIDYAKVIGEASPESLIGTIKEAGYDAEIASRPDIELALSGLSC
    MHCAGTTRKALEVVAGVIAADVNTKTAKIYGKVDADALIAAVEQAGYHAELASGQHFPKSEPLTIPASNRPEPLSAATSS
    VPVEKIDESVVRDSDDSIQLLLDGMT
    CASCVNKVQKALQSVEGVENARVNLAERSALITGSASPDVLIQAVEKAGYGAEL
    IQNEAERRERQQQVSEANMRRFRWQSAFALVVGIPVMVWGMMGDNMMLTPENQTIWLTIGTITLAVMIFAGGHFYRNAWQ
    SLKNGSATMDTLVALGTGAAWLYSISVNLWPNIFPPQARHLYYEASAMIIGLINLGHALEQRARQRSSKALERLLDLTPP
    TARVVTEDGEKELPLANVKPGMTLRLTTGDRIPVDGEIIQGEVWIDEAMLTGEPIPQQKSKGDNVHAGTTVQDGTVLFTA
    AAVGSQTTLARIIKLVRQAQSSKPEIGQLADKISSVFVPAVVAIALISGAIWYFIGPAPQIMYSLVIITTVLIIACPCAL
    GLATPMSIISGVGRAAEFGVLVRDADALQQASELDTIVFDKTGTLTEGMPQVTDIHTFNGYSEQDVLCWAGALENGSNHP
    LAKAILAKTEGLALPQVEQFRTLAGLGISGEVNGTTLLLGNQALLEQNQIDTEELKPLIAQQAEKGITPVILAVGGKAAA
    VLSIRDPLREDTVTALKRLHHQGYRLVMLTGDNPVTANAIAQEAGIDEVIAGVLPDGKAEAIQKLQAAGRKVAMVGDGIN
    DAPALARADVGIAMGGGSDIAIETAAMTLMRHSVHSVADAVELSKGTLRNMKQNLLGAFIYNTLGIPIAAGVLYPFTATL
    LDPVIAGAAMALSSITVVSNANRLLRFKPKS

    >gi|253988621|ref|YP_003039977.1| dihydrolipoamide dehydrogenase [Photorhabdus asymbiotica]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALANHGIVFGEP
    KTDIEKVRVWKEKVINQLTGGLAGMAKGRKVKVVNGVGKFTGANTLVVEGEGGATTINFDNAIIAAGSRPIQLPFIPHDD
    PRVWDSTDALALTTVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    VVEAKEDGIYVTMEGKNAPAEPQRYDAVLVAIGRVPNGKMLDAGKAGVEVDDRGFIHVDKQMRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESNRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNAKAKKKK

    >gi|253988693|ref|YP_003040049.1| thiol:disulfide interchange protein DsbC [Photorhabdus asymbiotica]
    MKKSVLCFSLLLTLISGNALADDGAIHGTMQKLGIKVESIKPSPIVGLNTIVTEQGIIYLSDDGKYLLQGPIYDVSGSSP
    VNVSNQLLMKKLEAMKDQMIVYKAPEEKHVVTVFTDIT
    CGYCHKLHENMKEYNKLGITVRYLAFPRQGMKHKSAEEMQSI
    WCSATPQKSLDAAFKGNDISPIKGCKVNIANHYKLGLQFGVQGTPAIILKDGNLLGGYMPPEALAKTLDQSGK

    >gi|253988845|ref|YP_003040201.1| iron-sulfur cluster assembly protein [Photorhabdus asymbiotica]
    MSISLTESAAQRVSSFLSNRGKGVGLRLGVRTSGCSGMAYLLEFADVINEDDTVFEDKGVKVIIDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|253989270|ref|YP_003040626.1| arsenate reductase [Photorhabdus asymbiotica]
    MQQVTIYHNPRCSKSRETLALIEEQGIKPQIIFYLETPPTVEQLSALLEQLGFNDARQLMRTKEDLYQELNLADEQLTQN
    DLLKIMVANPKLIERPIVVCGNKARLGRPPEQVKEILG

    >gi|253989273|ref|YP_003040629.1| thioredoxin-dependent thiol peroxidase [Photorhabdus asymbiotica]
    MMNPLKAGDKAPQFSLPDQDGETINLSDFEGQRVLVYFYPKAMTPGCTVQACGLRDEMNTLKGSGVEVLGISTDNPSKLS
    RFVEKEMLNFTLLSDEDHQVAEQFGVWGKKQFMGKTYDGIHRISFLIDATGNIEHVFDKFKTSDHHQIVVDYLKQHS

    >gi|253989298|ref|YP_003040654.1| hypothetical protein PAU_01818 [Photorhabdus asymbiotica]
    MSDKPSHSAFTLYGIKNCDTIKKARHWLEEQKIAYLFHDYRVDGLNEALLQSFIDKLGWESLINTRGTTWRKLTDQQRAA
    INNADVAKALMLEQPAIIKRPLLISAKGNCLLGYNADKYQQFFAEAL

    >gi|253989387|ref|YP_003040743.1| iron-sulfur cluster assembly scaffold protein [Photorhabdus asymbiotica]
    MTNSVETFSLNETAWQGITITERAAAQILKLMQQNPQSKGLYLGVKQSGCAGFGYVFEMVNDPAPDFLMYESEGACLYVP
    LKAMPFIDGTEVDFVREGLNQIFKFNNPKAQHACGCGESFGI

    >gi|253989410|ref|YP_003040766.1| hypothetical protein PAU_01930 [Photorhabdus asymbiotica]
    MTTIEKIERQINENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVEGELV
    GGCDIIIEMFQRGELQTLIKEAADKYRSQDENIVE

    >gi|253989437|ref|YP_003040793.1| thiol peroxidase [Photorhabdus asymbiotica]
    MTQTVKFQGNDISVSGQFPKSGEKAKDFTLTAKDLSDISLGHYAGKRKVLNIFPSIDTGVCAASVRKFNQVANDLENTVV
    LCISADLPFAQSRFCGAEGLSNVVTLSTLRGDTFSKDYGVAISDSPLRGLTARAVVVLDESDKVIYSQLVDEITNEPDYD
    SALAVLK

    >gi|253989447|ref|YP_003040803.1| disulfide bond formation protein B [Photorhabdus asymbiotica]
    MIRFLTHCSQGRNAWLLMTLTALILEGLALYFQHVTKLQPCVMCIYERVALFGVLGAGLLGAIAPKTPLRWLAIILWIYS
    AWSGLKLAWEHTMIQLYPSPFNT
    CDFLVNFPSWLALNQWLPSVFEAYGDCSVKQWQFLSLEMPQWLVGIFATYLVVAVLV
    LISQFFDRK

    >gi|253989455|ref|YP_003040811.1| methionine sulfoxide reductase B [Photorhabdus asymbiotica]
    MAKNPDVSLYTELTDIQRHVTQNAGTEPPFSGKLLHNKKSGVYHCLCCEQPLFVSDTKFDSGCGWPSFYQPINDEAVLYV
    DDNSHNMHRIEVRCNHCNAHLGHVFPDGPKPTGERF
    CINSAALSFTDENTGEKTAG

    >gi|253989461|ref|YP_003040817.1| selenophosphate synthetase [Photorhabdus asymbiotica]
    MSAEIRLTQYSHGAGCGCKISPKVLETILHSEREKFLDPHLLVGNETRDDAAVYDIGNGTGIISTTDFFMPIVDDPFDFG
    RIAATNAISDIYAMGGKPIMAIAILGWPIEKLSPEIARKVIEGGRAACEDAGIVLAGGHSIDAPEPIFGLAVTGIVNIDR
    VKQNSAAKAGSQLFLTKPLGLGVLTTAEKKSLLLPEHQGLATEIMCRLNKPGIDFAEIAGVTAMTDVTGFGLLGHLSEIC
    EGSGVQATLYFSKIPKLPEVESYIEKGCVPGGTGRNFDSYGHLIGEMTELQRKLLCDPQTSGGLLLAVLPAAVNEVKSIA
    RCHGIELTAIGELSERQSGRVLIEVNE

    >gi|253989595|ref|YP_003040951.1| electron transport complex RsxE subunit [Photorhabdus asymbiotica]
    MSETKNLFIQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLTCTNIAVSCLRRWVPNEIRIPIYVMIIASVV
    STVQMLINAYAFGLYESLGIFIPLIVTN
    CIVIGRAEAYAAKNPVILSAIDGLAMGLGATFALFVLGAMREILGNGTLFDG
    ADLLLGNWAKVLRIEIIHMDSPFLLAILPPGAFIGLGLMLAAKYLIDEKMKTRAIKEKSNAVAMSQGSESTS

    >gi|253989600|ref|YP_003040956.1| Na(+)-translocating NADH-quinone reductase subunit E [Photorhabdus asymbiotica]
    MTDYFLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGFATTFVMTLASVCSWLVNTFILLPLDLIYLRTLSFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINQSHDFLQSAIYGFGAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRGSSIGLITAGLMSLAFMGFSGLVKF

    >gi|253989809|ref|YP_003041165.1| hypothetical protein PAU_02329 [Photorhabdus asymbiotica]
    MAKELFTAKVKSVAGLKVECTSRDFSFYLDEPRNLGGTDHGMNPVEALLCSLGACKCIVAKAFAKLHKINLIDIHVDLEG
    ELDTDGFTGRNKQAKLGFSKIVTKFYIKADNSEEEIHAFVDFINKTCPVHDTIENAPSFATEIYCE

    >gi|253990179|ref|YP_003041535.1| hypothetical protein PAU_02701 [Photorhabdus asymbiotica]
    MPVLHNRISNKELKARMLAETQPRTTISFYKYFNILEPLAFRNNLYQQFTELSVFGRVYIAKEGINAQISVPTHNLEALK
    GLLYSIDPALDNLRLNIALDDDGKSFWVLRMKVRDRVVADGIEDETFDPSKTGEYLKAEQVNQMLDDPDTLFVDMRNHYE
    YEVGHFENAIEIPSDTFREQLPMAVEMLQDNKDKNIVMY
    CTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYSRKAREQEL
    PVRFIGKNFVFDERMGERISDDVIAHCHQCGTSCDSHTNCKNDGCHLLFIQCSECADKFEGCCSEACREEVSLPEVEQRV
    RRAGRENGAKIFNKSRHRLQDGMNIISLQLTK

    >gi|253990321|ref|YP_003041677.1| thioredoxin reductase [Photorhabdus asymbiotica]
    MSTAHHKLIILGSGPAGYTAAVYAARANLNPALITGVEKGGQLTTTTEVENWPGDPEGLTGPGLMDRMHQHAEKFQTDII
    FDHIQKVDLQNRPFRLYGDEQEYTCDALIIATGASARYLGLPSEDAFKGRGISA
    CATCDGFFYRNQKVAVVGGGNTAVEE
    ALYLANIASEVHLIHRRDTFRSEKILISRLMDKVKNGNIILHTDRTLDEVLGDDMGVTGVRLRDTKSDTTEELAVTGAFI
    AIGHTPNTAIFAGQLELDNGYIKVQSGLQGNATQTSIPGVFAAGDVMDHTYRQAITSAGTGCMAALDAERFLDKLATEPK


    >gi|253990339|ref|YP_003041695.1| glutaredoxin 1 [Photorhabdus asymbiotica]
    MFTVIFGRPGCPYCVRAKELAERLKEQRDDFDFNYVDIHAEGITKADLEKTVGKPVETVPQIFVDEQHIGGCTDFEAYVK
    EHHLLQ

    >gi|253990378|ref|YP_003041734.1| molybdopterin biosynthesis protein MoeB [Photorhabdus asymbiotica]
    MTIELTDEETLRYNRQIILRGFDFDGQEKLKSSKILIVGAGGLGCAASQYLTAAGVGTITLLDFDTVSLSNLQRQILHRD
    ERIGMAKVQSAQITLQAINPHATIKTVNALLEDQALAELIGQNDVVLDCSDNVTIREQLNRLCLVKKIPLVSGAAIRMEG
    QLTTFTYQPDSPCYRCLSRLFGENNLT
    CVETGVMAPLVGTIGTLQAMETIKLLTGYGKIGSGKVLLFDAMTMQFRDIKLL
    KDPNCEICSC

    >gi|253990391|ref|YP_003041747.1| 3-mercaptopyruvate:cyanide sulfurtransferase [Photorhabdus asymbiotica]
    MNNSHFVSAQWLKDHLDDENLVIIDATAPPPPQQIDCRQLWLDTHIPGAQFFDLDKIADHQNGLPHMLPDPQTFSQSVGA
    MGISENHLVVIYDQGNMFSAPRAWWTFKVLGSHNVRILDGGLQSWQQAGFPTESGEVTRSPQTFHTNFDASRVKSLEQIL
    ASLNDPRIQIVDARAADRFQAKAPEPRPGLRMGHIPGSKNVPWTMLVANGHFKSATEIADIFLQQHVDLNKPIITS
    CGSG
    MTAAVLVLGLDIIGKKDVYLYDGSWAEWGADDILPLEK

    >gi|253990624|ref|YP_003041980.1| hypothetical protein PAU_03150 [Photorhabdus asymbiotica]
    MQANRLRPAEISPELYSAVAKVDELTYQSTLGKALIELVKVRASQINGCAFCLNMHSKAARKAGNSEQKLYLLSAWKEAP
    IFTSRERAALGWTDALSRIAEIGAKDEHYSPLLAEFDEKEIVDLTLLIGLINLWNRLAIGMKYTLPNPAIDPT

    >gi|253990645|ref|YP_003042001.1| methylated-dna--protein-cysteine s-methyltransferase [Photorhabdus asymbiotica]
    MTYIFSREVVMYHQYFETPKGFPKPYVHITADDKGVTSLYFVDEKTAPEVKNDITKQCVKELRGYFAGKRTEFSVPLNPE
    GTEFQQRVWLQLCKIPFGEVWSYKQLSLALGSANYCRAVGMANSRNPISLIVP
    CHRVIGHDGKLVGYTGGLNIKSWLLEH
    EKA

    >gi|253990646|ref|YP_003042002.1| hypothetical protein PAU_03172 [Photorhabdus asymbiotica]
    MCITIYSKPDCVQCSATYQALNRRNIPYQIVDLTKNPQALAIVHALGYQQVPVVIAGTQHWVGFRLDKINTLAENL

    >gi|253990727|ref|YP_003042083.1| Na(+)-translocating NADH-quinone reductase subunit E [Photorhabdus asymbiotica]
    MEHYISLFVRAVFIENMALAFFLGMCTFLAVSKNVATAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMILDRYFPSLYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFSESIVYGFGSGIGWMLAIVLLASI
    REKMKYADVPAGLKGLGITFITTGLMALGFMSFSGVQL

    >gi|253990728|ref|YP_003042084.1| Na(+)-translocating NADH-quinone reductase subunit D [Photorhabdus asymbiotica]
    MADSKEIKRVLLGPLLDNNPIALQVLGICSALAVTTKLETALVMTMAVTLVTAFSSFFISLIRHYIPGSVRIIVQMAIIA
    SLVIVVDQILQAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFLRELFGSGKL
    FGITVLESVQNGGWYQPNGLFLLAPSAFFIIGMLIWGLRTLKPAQVEKE

    >gi|253990852|ref|YP_003042208.1| Transcriptional regulator [Photorhabdus asymbiotica]
    MSIFNDDAQRQLFDELAEVARILGNTHRLMLLEHITQGERPVERLAELTGLTIANSSQHLQHLKRAGFVQSRREGKNVYY
    RLGNGPVQNLLAALHQYVEYRNSEIAAFIADTFNRREHLESISREELFQRLNLGEVTLLDVRPSEEFASGHLPGAINIPA
    EELEGRLSELPKEQEIVAY
    CRGPYCVLSLNAMKILRSKGFLARRLEEGFPAWKAAGFEVQNDR

    >gi|253990967|ref|YP_003042323.1| hypothetical protein PAU_03493 [Photorhabdus asymbiotica]
    MVLVTRPAPDFTAAAVLGNGEIVENFNLKNHLNGKPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVVGISFDSEF
    VHNAWRNTSIEKGGIGAVKYAMVADTKREIQKSYGIEHPDAGVALRGSFLIDKNGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMSASPDGVAKYLSQNAAKL

    >gi|253991207|ref|YP_003042563.1| zinc/cadmium/mercury/lead-transporting ATPase [Photorhabdus asymbiotica]
    MYSNSNQNNTHQHNHQHGSCCTTTACAEQAQHVSKHSHKHNSACSHEHSHSHDPQETQIPELLASQRFSWVVNGMDCASC
    ARKIETAVKKIPEVKQVKVLFATEKLVVDADTDIRSTVIQAVNQAGFKLHTPNANQKAPKGNRWKELAPITLLSLMMLIS
    WGISHVNAPFGRIAFIITTLIGLVPIVSKAWKLIRSGTPFAIETLMSVAAIGALFIDATAEAAMVLLLFMLGEMLESYAA
    GRARRGVSALMALVPEEALLVKNGERKTVPVADLRPGDIIEIAPGGRLPTDAELLNSFASFDESALTGESIPVERIQGEK
    VPAGCLSVDRSVQMKVLSEQGNNAIDRILQLIEEAEERRAPIERFVDRFSRIYTPLIMLFSMLVIIIPPTVFSQPWETWI
    YRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRITTIAFDKTGTLTAGKPQVTDVQPAENIRESQ
    LLALASAVESGSHHPLANAILQHAESKNINVTEAEHRKALAGIGVEGQLEGKRILVSTPGKLPENTLSNDWKQKIIQLED
    GGKTVVAVMHSEQFIGLIAMQDTLRQDAIGAIHLLKSQGIKSVMLTGDNPRAATAIAGQLGMDFRAGLMPEDKVKVIMEL
    NKDHSTMMVGDGINDAPAMKASSIGVAMGSGTDVALETADAALTHNRLTGLSEIIALSRATHNNIRQNIAIALGLKGIFL
    ITSLLGITGLWMAVLADSGATALVTANAVRLLRIKVK

    >gi|253991236|ref|YP_003042592.1| thiol:disulfide interchange protein precursor [Photorhabdus asymbiotica]
    MIKHTLMLFLLFFSSLFTPLAANALFEPPGQNLYLPADQAFMFDFQQKGDQLTLNWQIKPGYYLYRKQFRIEPQQATLGK
    IALPQGTAHQDEFFGETEVYFQQLAINVPITEASDKSNIVVTYQGCAAAGYCYPPETRLVPLNAVIPSKTTNVIQTEPVR
    KTLESTSNDQQNLPFSPLWAILIGIGIAFTPCVLPMYPLISSIILGSQRPKNLKQIFWLALSYVQGMALTYTLLGLIVAA
    AGLQFQAALQHPYVLIGLSVLFMLLALSMFGFYSLQLPSSVQTRLVNWSNQQTSGSFFGVFAMGALAGLICSPCTTAPLS
    AILLYIAQSGNTVAGGITLYLYALGMGLPLIAVTMFGHKLLPRGGPWMQYVKEAFGFIILALPVFLLERIVGDTWGIRLW
    SLLAVSFLGWGFTLTLRSQNGWMRVMQLILLVLMLIATRPLQDGFWGTSITQQPQHSLNFRQINSWQELEQVIAQNSHKT
    VMLDFYADW
    CVACKEFEKYTFSDPLVQSQLRDTLLLQANVTHNSPQQKQLLETFSVRGLPTILFFDSQGKEIPDSRINGF
    MNATRFTEHLQHLQK

    >gi|253991467|ref|YP_003042823.1| hypothetical protein PAU_03994 [Photorhabdus asymbiotica]
    MRNHYPNIIIGGGPAGLNMALEFSKRGIEYLLLEANETVGGQWDRFPVCGELISLNKKYVPGDNHTYRMRYDWHTLSTID
    AEDVANDPKLRFTEWTSAHWPSARIYKEYLKYVAEKMGLVKCIRTNMRVRRITKENEHFIIEISDSLHISADRIFCATGV
    SKPIVPDIKGLNTET
    CTFYENFDPNTATERYRNKIVVVLGRGNSAFEIAHHLIDITAETRVVTRSLPLFARQTHNVHDLR
    AQVSDVFDLMQLKSNNNIVSDRIVEIRRIASGKHKGRLLVSYETPCPHWSPPRWMKRTGIVDDVIVCCGFNYTLSDIFDM
    DTVRPDVDEKGKYCLLTSSWESVNVPGLYFIGAPMRVNDPDAASGFVHGFRCNIQALGNIIAEKYHSIALKPIFECRIPL
    NNPSDALVSLSKFLVDLVSTSMPLFELFSYFGNIVTFEECDDENVVCARVWPPFSREYNNERWGDKQNRLEVVFEYGFYR
    YGNGQLPTHYFTLPADHFDTSQSAYIHPVFHVFREGVEVNSFHMQESLIGRWDLDDYVNAETNVDQYRNVAFNACACALG
    IEERRSMLPVLDEFVDKCYPLMSEKEIAEALRIQPNLALLAKQS

    >gi|253991529|ref|YP_003042885.1| methionine sulfoxide reductase A [Photorhabdus asymbiotica]
    MPTSTNKSQSIDSKHILTGRTEPLKISPDHVVTNHAIEPVPENMEVAYFGMGCFWGVERLFWQLPDIYTTSAGYSGGTTP
    NPTYEEVCSGLTGHAEVVRIVYDPVKNSYENLLKLFWENHDPAQGMRQGGDIGTQYRSAIYTVSPQQYEMAVASREHFQK
    AMQQQGDNRPVTTEITEAGPFYFAEDYHQQYLFKNPEGYCGLGGIGVCLP

    >gi|253991617|ref|YP_003042973.1| thioredoxin 1 (trx1) (trx) [Photorhabdus asymbiotica]
    MSDKIIHLSDDSFDADVLKAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTIAKLNIDDNPATAPKYGIRGIPTLL
    LFKDGQVAATKVGALSKTQLKEFLDANL

    >gi|253991704|ref|YP_003043060.1| soluble pyridine nucleotide transhydrogenase [Photorhabdus asymbiotica]
    MQHIHFDAIVIGSGPGGEGAAMGLVKQGKNVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRILRS
    SFAEILRRAEIVINQQTKMRQGFYERNGCRMFSGEATFIDEHRVSVCYADGNYDILSADKIIIATGSRPYCPPDVDFTHS
    RIYNSDSILKLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRDHLLAFLDQEMSDALSYHFWNSGIVIRHNEEYS
    KIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDTLGLKNVGLEPDNRGLLKVNKIYQTNNENIYAVGDVIGYPSLASA
    AYDQGRIAAQAMTKGSAEAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKIPYEVGRAQFKHLARAQIAGMNVGSLKILFH
    RETKEILGIHCFGERAAEIIHIGQAIMEQKGESNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF