Photobacterium profundum SS9

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|54307329|ref|YP_128349.1| putative molybdopterin biosynthesis MoeB protein [Photobacterium profundum SS9]
    MMLTDQEFLRYNRQVMLPEIGEVGQQALSQAHVLLVGAGGLGSAAALYLAGAGVGNIVIADDDEVDSSNLQRQVIYRDAD
    QGKSKAKMAAAHLQALNPYIKVRAVQARLADQRLAIEVALADIVLDCSDNLPTRHAVNQACVKAKKPLISGAAIRWQGQL
    MAFDNRSGAGPCYHCLFPNQLDAAQEPQN
    CSNSGIAGPVVGMMGTMQALETIKCITGAGSVAFAALQQFDGLTMAWQRFN
    IAADPQCPVCRQHNDNGE

    >gi|54307377|ref|YP_128397.1| thiosulfate sulfurtransferase [Photobacterium profundum SS9]
    MEQFEHISVDQAYSLLQQEDSLAVLVDIRDPQSFGLAHPENAYHLTNDTMVELMNQVDFEQPVIVMCYHGISSQGAAQYL
    INQGFEAVYSLDGGFEAWRRQALPIIQQIG

    >gi|54307446|ref|YP_128466.1| hypothetical protein PBPRA0225 [Photobacterium profundum SS9]
    MQQYIEFVTGNPILALVWVGLVVAIIASIVKQKTAGYTTVNPNEATILVNRENGVFLDIRTRDEYRQGHISNALHTLPSQ
    IKEQNITELEKYKTTPIIVV
    CKTGQTAQDSANLLKKAGFENVNVLKDGLISWNEAKLPLVRSKSKK

    >gi|161936337|ref|YP_128512.2| dihydrolipoamide dehydrogenase [Photobacterium profundum SS9]
    MKTLNVDVAVIGGGTAGLGAYRAAKAHTDSVVMIEGGKYGTTCARVGCMPSKLLIAAAESVHQIEKAPGFGIHPQGEIVI
    NGQEVMARVKSERDRFVGFVLEGVDEIPAEDKIIGYAKFADDHTLMIDDHTKVIAKRIVVATGSRPAYPGVWNELGDRLI
    INDDVFEWNDLPNSVAVFGPGVIGLELGQALKRLGVEVIMFGLGGQVGPLTDPDVMAYAYKSFNEEFYLDADVQVESMKR
    EGDVVEIQYIGKEGELKKITVDYVLATTGRRPNVDQLDIDNTSLELDARGVPVADYYTMQTSVSSIFIAGDASNQLPLLH
    EAADQARIAGDNAGRYPEIRAGLRRSKISAVFSDPQIAMVGETYKELTTRLGTCGCFETGFVSFEGQGRSRVMLRNKGML
    HVYGEHGTGRFLGAEMIGPNAEHLAHLLAWAHQSKMTVAEMLDMPFYHPVIEEGVRTALRDLNAKLHLGPDMIKHCLDCG
    PGC

    >gi|54307493|ref|YP_128513.1| putative peroxiredoxin/glutaredoxin family protein [Photobacterium profundum SS9]
    MFASKEGQAVPQVTFHTRQGDAWVDVTTEELFANKTVVLFSLPGAFTPTCSSSHLPRYNELASVFAEHGVDEIVCVSVND
    TFVMNAWKADQEAENITFIPDGNGEFSKGMDMLVDKEDLGFGPRSWRYSMLVKNGVVEKMFVEQEEPGDPFKVSDADTML
    NYIAPNHKLQESITVFSKPG
    CPFCAKAKQNLIDKGLQYEEVVLGKDATTVSLRAITGRSTVPQVFIGGKHIGGSEELETY
    LA

    >gi|54307592|ref|YP_128612.1| putative peptide methionine sulfoxide reductase [Photobacterium profundum SS9]
    MSPNKHNLIAPETALIGRATSITPSLPHAVNGTILNDEKPSNYSEIIIGMGCFWGAERLFWNLPGIYSTAVGYSGGFTPN
    PTYEEVCSGKTGHSEVVRIIYDPLIISLEQILTLFWESHNPTQGMQQGNDIGTQYRSVIYTTTPNQLTYAQHSKQCYQQS
    LEQQQLESPITTEIEPAGTFYFAEDYHQQYLVKNPNGYCGLGGTGVCFIPL

    >gi|54307596|ref|YP_128616.1| phage shock protein E [Photobacterium profundum SS9]
    MRIYSSLISALLLLTSLTITSVQAEVVTAEEFWQHYNTGNPILIDVRSNDEFMAGHLPQSINIPFDKIESITSFSDEKSQ
    IILLY
    CRSGQRAEIAEQTLKELGYNNIYNGENYQKLLVAMPESISNGKK

    >gi|54307736|ref|YP_128756.1| iron-sulfur cluster insertion protein ErpA [Photobacterium profundum SS9]
    MSDANVPLSFSDVAANKVKTLIAEEENPELKLRVYITGGGCSGFQYGFTFDEKVNDGDMTIENSGVTLVVDPMSLQYLVG
    GIVDYTEGLEGSRFFVNNPNATTTCGCGASFSV

    >gi|54307772|ref|YP_128792.1| hypothetical protein PBPRA0567 [Photobacterium profundum SS9]
    MHFFGRTLLATVVALTAFSAAAKPDEAAIKTKLGALGLAPSSISPSPISGMNEAVTERGVVYVSDDGNYFIAGHLYQNTG
    AEPVNLTEQKMAKINKDKLQGMEDEMIIYPAKDEKYVVTVFTDTT
    CGYCRKLHGEMQAYNDAGITIRYLAFPRGGERSGN
    FGQMSAIWGAKDKAKAMNDAKSGMFDDSGIKLREDLVRKHYELGVAMGVSGTPALILEDGTMLPGYQPAPMLRKMLDSRS


    >gi|54307930|ref|YP_128950.1| Ahp/CTSA family anti-oxidant protein [Photobacterium profundum SS9]
    MRSTKMVLVGRQAPDFTAAAVLGNGEIVDSFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDKRFEDFQAKGVEVIGVS
    IDSQFSHNAWRNTAIEDGGIGQVKYPLIADIKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEML
    RMVDALNFHQKNGEVCPAQWEEGKAGMDASPKGVADYLSEHTADL

    >gi|54307947|ref|YP_128967.1| putative hesB family protein [Photobacterium profundum SS9]
    MAITITEAAASRVATFLKNRGKGFGLRLGVRTSGCSGMAYVLEFVDDINEEDEVFEEKGVRIVIDAKSLVYLDGTELDFA
    KEGLNEGFQFNNPNVSSECGCGESFNV

    >gi|54308021|ref|YP_129041.1| Na(+)-translocating NADH-quinone reductase subunit D [Photobacterium profundum SS9]
    MADTKEMKKILFAPFLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTAFSNLFVSLIRNHIPNSVRIIVQMAIIA
    SLVIVVDQVLKAFVYDISKQLSVFVGLIITN
    CIVMGRAEAYAMKSAPLPSFIDGVGNGLGYGFVLITVAFFRELLGSGKL
    FGVEVLPLVSDGGWYQPNGLMLLAPSAFFLIGFMIWAIRIIRPAQVEAKE

    >gi|54308022|ref|YP_129042.1| Na(+)-translocating NADH-quinone reductase subunit E [Photobacterium profundum SS9]
    MEHYLSLLVRSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVIVVLTIAIPVNNLVYNLLLKDGAIVDGVDLTFLNF
    ITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFVESIVYGFGSGVGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|54308040|ref|YP_129060.1| arsenate reductase [Photobacterium profundum SS9]
    MNTIAYGIKNCDTIKKMKKWLEAESIDYTFHDYRVDGLDQAMLEKFESQLGWEAMVNKRGTTFRQLTDEQKANLNQETAI
    CLMLESPAMIKRPLLVHNDSYHLGFKPAQYQEIFQQPLSK

    >gi|54308146|ref|YP_129166.1| putative thiol:disulfide interchange protein DsbE [Photobacterium profundum SS9]
    MALFLALAVIFMIQLTRNAGGDDPTKLESVLVGKPVPNFKLEDLVEAGKLYEQDIFKGEPLLLNVWATWCPTCYAEHKYL
    NELAGQGVKIIGLNYKDERLKAVQWLNELGNPYIHSLFDGNGMLGMDLGVYGAPETFLIDAKGIVRYRHVGDVNPRNWAE
    TLEPMFKALQEEAKG

    >gi|54308352|ref|YP_129372.1| putative thioredoxin reductase [Photobacterium profundum SS9]
    MSNVRHCNLLILGSGPAGYTAAVYAARANLNPVMITGMQQGGQLTTTTEVENWPGDAEGLTGPALMDRMKEHAEKFETEI
    IFDHINETDFSQSPFRLKGDNAEYTCDALIISTGASAKYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIASEVHIIHRRDTFRSEKILIKRLMDKVENGNIVLHTDRTLEEVLGDEMGVTGVRIKDTQSNATEDLEVMGAF
    IAIGHQPNTAIFEGQLEMANGYISVQSGTQGNATQTSVEGVFAAGDVMDHTYRQAITSAGTGCMAALDAERYLDALEQQK


    >gi|54308413|ref|YP_129433.1| zinc/cadmium/mercury/lead-transporting ATPase [Photobacterium profundum SS9]
    MCAQCNNKKPYIHSIKPTAVQSNSVQVEACTSTDCCSATNTATVVSTETESNGDGDSNAEGPASSSPHQHDHQCDPVSES
    SCSTSCCSTSNVSLDQLTQSNLGHSQSWKVLGMD
    CPSCASKLEKSLMTLDGVERAKVMFATEKLVVNCQSADMVEAIEAK
    AKKTGFQLVTGRKSQQKQEKPHSIKQNFAVIAIASMMAVSFLVSQVSEQMGLIAFTLTSILGLFPIAKKAVVLAKSGTPF
    SIETLMSIAAIGALYLGETAEAAMVLLLFLIGEQLEGYASARARSGVKALMDLVPEEATVIRADGTRVKIAAEDLQKGDV
    IEVAPGSRLPADAQLLDIIASFDESALTGESVPVEHIPGEKVMAGSLVVDKVARLTIISEQGENAIDRILHLIEDAESRK
    APLERFLDRFSRWYTPAMIVFAALVIVIPPLLFAQSWDEWIYRGLTLLLIACPCALVISTPAAITSGLAAAARRGALIKG
    GAALEQLGHIETIAFDKTGTLTQGKPVMTDLVSWDGNDDKLLAQSAAVEMGSLHPLAMAVVKAAQDRGLTVIEAAEREAL
    PGRGIQGIINGETVLLCAADRLTESVILTNEQVAQVLALEAQGKTLVVVVRDGIAVGMIAWRDNLRDDAAQAVSALKKMG
    IKAVMLTGDNPRAAAAIAGEIGIEYRAGLLPADKVKEVQLANEKSHVAMVGDGINDAPAMKTASIGIAMGGGTDVALETA
    DAALTHNRLSELPVMIELSKATLNNIRQNIGLALGLKAIFLVTTLFGLTGLWVAVLADSGATALVTLNALRLLRFEPKNK
    V

    >gi|54308433|ref|YP_129453.1| putative thiosulfate sulfur transferase [Photobacterium profundum SS9]
    MMSFIPKAVFPAIVFASFSAQATTISFNDLLVKPTSDIQIIDCRSSNHYNGWAEDGATQGGHIPGAINIDANWINDLSPE
    SLQALLTEKQIDASKPTYLY
    CNETGSQLLSSALKTQGIKNVSIIKESLQNYTGELEALPKFQYLVSPQWVKDVVEGKQPE
    FAPKKGYKLVEVAWGPPSKYLASHIPTALYLNTNRIESEPWWNRVSDEKLTEIIREFGIRYDTTVILYGRDNTAAARAAS
    MMMYAGVDDVRLLNGGWTSWVNAGFTTEPLLNTNKTNVDFGKAIPANPELIIDIPEAKAMLTKPEDEQSLVSIRTWDEYI
    GVTSGYRYIKPKGRIEGSKWGHAGSDANHLEDFRNPDLTMKSAKDITRIWQKWNITPAQDVSFY
    CGTGWRASSTFFYAYV
    MGWKNISVFDGGWYEWSGDKSNPTNTGDIKPPHTVTF

    >gi|54308434|ref|YP_129454.1| hypothetical protein PBPRA1241 [Photobacterium profundum SS9]
    MAQYVVCALYKFVALEDFEAIRQPLTDVMEKNKIRGTLLLASEGINGTVASTREGIDALLAWFKQDQRLTDVVYKESFDE
    NQPFNRTKVKLKKEIVTMGVEGIDPRHVVGTYVKPKDWNALIADPDVFVVDTRNDYEIEIGTFKHAVNPETESFREFPEY
    VEKNLDPEKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVPEKESLWEGECYVFDGRVAVDHQLEKGQ
    YSVCNACRLPITDAA

    >gi|54308446|ref|YP_129466.1| hypothetical protein PBPRA1253 [Photobacterium profundum SS9]
    MSTMTIEQLSEYKNLVITQPHCPFCVKAKALLDDRDTEYTTLVLGTDLEKTEMVAFIEQVANTTVRTVPQIMLDGKFIGG
    HDDLVAFLERQVNTEELGDFEL

    >gi|54308456|ref|YP_129476.1| putative thiol:disulfide interchange protein DsbE [Photobacterium profundum SS9]
    MMKKTRFIPLVLALLAGILLVMGINSKSVPTVSPLADRPVPEFTLPSLQQELDSITQASLKGDVQLLNVWASWCSICKSE
    HAYLQQLAAEQSLSIIGLNYRDERKAALNELAQTGNPYKKVIYDPKGSLALDLGVYGTPETYLIDKSGIIRHRYVGALTP
    TVWEQQFAPLVAQLKE

    >gi|54308614|ref|YP_129634.1| putative NADH oxidase [Photobacterium profundum SS9]
    MTKILIVGGVAGGASAAARARRLSEDAEIIMFERGEFVSFANCGLPYHIGGDIQDRSKLLLQTPESFLARFNVDVRVMNE
    VVNINRNEKTVTVKNLLDGNEYTERYDFLLLSPGAGPIVPPIPGVKNPLTYSLRNIPDMDRILQTIETNNVEHATVVGGG
    FIGLEMMEAFHQRGIKTTLLELADQVMTPVDKEMAGFAHAEIRDHGIDLRLGIALSGVEYVPETHIASFESGESTEHQHI
    SGHLNLSLSNSESLETDLLIMAIGVRPETTLASEAGLKIGELGGIWTTPSMQTSDPAIYAVGDAIEEADFVTGNQTIVPL
    AGPANRQGRMAADNMLGRNESYQGTQGTAICKIFDLAIAATGKNEKQLKRDGVDYEKVYVHTASHASYYPGAEIVSFKML
    FDPKSGKIFGAQAAGKDGVDKRIDIMAVAQRAGMTVEQLQHLELTYAPPYGSAKDVINQAAFVANNIIKGDATPIHFDEI
    DNLTDDQVLLDVRNPGELENGGYIEGTLNIPVDELRQRMHELPKDKEIVIY
    CQVGLRGNVAYRQLVNNGFKARNLIGGYR
    TYKFAKM

    >gi|54308615|ref|YP_129635.1| hypothetical protein PBPRA1422 [Photobacterium profundum SS9]
    MTFEIPWDALRGGMLLGLAAALLLIMNGRIAGISGIVSGLLKPVKGEVSWRFLFVLGMVMSGALAPLLGFNVPESLPVTS
    VFWVALAGLLVGIGTKLGNG
    CTSGHGICGMGRLSKRSIVATCVFMAVAFVTVFVRLHLL

    >gi|54308849|ref|YP_129869.1| putative glutathione S-transferase [Photobacterium profundum SS9]
    MTLPILYSLRRCPYAMRARIGILLAKQPVMLRDIVMKNIPAEMIAVSPKATVPVLVLADSTIIDESLDIMLWALQQSDPS
    NLLFKEDSRAFPSMLNLIHHNDNEFVESLEKYKVAARYHDIAEVFYRNQCEIFITDLEGRLTSSEYLMGDKPCLADYALL
    PFVRQFSRVDRKWYLHSPYTNIQRWLNTHYQNPLFSKAMKKYPQWLDNHESVLIGTD

    >gi|54308931|ref|YP_129951.1| hypothetical protein PBPRA1742 [Photobacterium profundum SS9]
    MKIVRWVLGRIILLLNFIFSPRAQKRDNLEQNLVNQDVGKLKLYQFDACPFCVKVRRSAKRLNLPLETRNAKVAPWEQEL
    INDGGARKVPCLRIEKENGSIEWLYESNDIIGYLEQRFA

    >gi|54309022|ref|YP_130042.1| cation transport ATPase E1-E2 family [Photobacterium profundum SS9]
    MCCPGCEAVATTIVESGLTSYYEYRTASAEKADLVPQQLKSLLLYDHEEVQQEFVRNLDDCKEVSLSLDGVSCAACAWLI
    EKQLSREAGLVSIQVNTTTHRALLKWNPEQTKLSTLLSAIHRLGYKAAPFEADAQEQQYHNTMKQYLYRLGIAGIATMQV
    MMIAVALYFEVFSDLDTEFRNYLRWVSLIFATPVLLYSALPFYMNAWRNLRARTLGMDVPVSIALLFAYVASLYATVAEK
    GEVFFESISMFTFFLLLGRFLEMRARRHAAAASANLLKLVPAMATLEDGTQVAAKTLNVGDVVTVLPGESLPADGDIIQG
    ETAIDESMLTGEPMPIARSAGEPVFAGTINGDGNITIKVTKDRQNSLISNIVRLQDEAQMSKPKVAVLADIVARYFVAGI
    LIIAAGTWLYWHQQQPEDALWITLAVLVATCPCALSLATPTALTCSTSSLGRLGILLRRGHVLETLCKVNQLVIDKTGTL
    TEGNIRLINTQLFTHVAENDALSYSAELERFANHPIARAFTPHRDQAFAFDHVDNVIGCGLKGVKNGQEWRIGQIKFVLE
    DNTNAESLVNQADNSYQVWLSCDTQLVAAFKLDDPIREDSAELVRQFQRAGIQVTMLTGDNSVNAQLVADKLNVDKLVSG
    VTPEGKLDYLRSLDDKDVALMIGDGVNDAPVLAGAHLSVAMGGGTDIAKSSADMVLLGDQLTRILQARRLALKTKKIIRE
    NLAWSLGYNLIILPLAVAGMVAPYIAVVGMSASSIIVVSNSLRLLKENG

    >gi|54309196|ref|YP_130216.1| molybdopterin biosynthesis protein MoeB [Photobacterium profundum SS9]
    MAELSDAEMLRYNRQIILRQFDFDGQEALKDASMLILGAGGLGCASTQYLAAAGVGKLTLIDDDKVEVSNLQRQVLHTDN
    TVGQLKVESAKQALTTINPYTSIDTIAQRLSDDELLPLIKQHTIVLDCSDNVETRNQLNRLCHQTKTPLISGAAIRMEGQ
    ISVYTYQDNEPCYQCLSALFGQQTLS
    CVEAGIMSPVVGIVGAVQAMEAIKVVANMGTTLTGKILMLDAMSMSWREMKLGK
    QANCSVCG

    >gi|54309205|ref|YP_130225.1| hypothetical protein PBPRA2020 [Photobacterium profundum SS9]
    MLLISEQSMKTLSQLVFNNTYSELPTTFGTAVIPQPLSDPFLVSVNPQVAEMLELDPLEAKTRLFINSFTGNKELAGTAP
    LAMKYTGHQFGHYNPDLGDGRGLLLGEVLTSTNAKWDIHLKGSGKTPYSRQGDGRAVLRSSIREYLGSAALNGLGIKTTH
    ALALLGSTTLVSREKMERGATLIRVAESHLRFGHFEYLFYTHQHSELKLLADYLIKHHFPDLLTTESEQEDKQTASPNQH
    HNIYASMLTRIVELTAQLIAGWQSVGFAHGVMNTDNMSVLGLTFDYGPFGFLDDYNPDYICNHSDYSGRYAFNQQPSIAL
    WNLSALGYALTPLIDKEDVDAILNRYHLTLQRDYSARMRNKLGLIEKREEDTVLFSSLFELLQSQMVDYTLFFRTLSSIS
    ATDLSVTSLPNSIERFDDLFTCTQPLEKWLKAYAVRLSFENDTSEKNGDTLRLTQMKLHNPKYILRNYLAQQAIDKAEDG
    DFTMIDELLQVLSSPFDEHLEFNQFADKPPYWGKKLEIS
    CSS

    >gi|54309292|ref|YP_130312.1| hypothetical protein PBPRA2112 [Photobacterium profundum SS9]
    MRISTKKNYSFLIKPLLWLQKRHYGEVLNPALLWGRKPALFWLVAGFFGVLDRKSSPITPVIRSLVCVRVSQLNDCAFCV
    DANGMKLAERCDSVDKIKALAQWRHSDQFSEQERIVLTYVEAMTITGQKVTEEMLNDLKQSFDEDTIVELTALVAFQNLS
    AKFNTALDVPAQGFCSLPIQMDDNNTPSTSTQTERDSNS

    >gi|54309293|ref|YP_130313.1| hypothetical protein PBPRA2113 [Photobacterium profundum SS9]
    MDRKKVVLLVTLITLIGLWFAFDLSQYFTLEQAKAQQLALQDTIAEKPFLSSLVYFAVYILVTALSLPGAAIMTLLGAAL
    FGFWWSLLLISFASTIGATLAFLFSRFILRDWVQAKFGNRIAPINAGIEKDGPFYLFTLRLIPVFPFFLVNLLMGLTPIS
    TRMFYLVSQLGMLAGTAVYINAGTQLGEIESLSGIISAPVLMSLALLGLFPLIAKFIMNIITQRRVYANWKRPEKFDQNM
    VVIGAGAGGLVSSYIAAAVKAEVTLIERHKMGGD
    CLNTGCVPSKAIIRAAHTMAEISRAHEFGITTDKPQVNFEKVMSRI
    HNVIDKIEPHDSVERYSSLGVNCISGEAQILSPWEVEVNGQRITTRNIVIATGARPLVPGISGLQDVNYLTSDSIWSLKV
    QPKKLLVLGGGPIGCELAQSFSRLGSDVTLVEMAEQLLIREDTDASLLVKESMHKDGVDIKLNHKATRFESITAEDGTRI
    QRAYLEYNGKEVIVEFDAVMLALGRVANVQGFGLEELGITTTQRGTVDVNDYLQTKYPNIYAVGDVAGPFQLTHAAAHQA
    WYAAVNGLFGQFKKFKADYSVLPAATYTAPEVARVGINEKEAENLNIEFDVTRYGIDDLDRAITDGEDYGFVKVITPKGK
    DKILGVTIVGNNASELLAEFTLAMRHGLGLNKILGTIHPYPTMSEANKYTAGVWKQANAPQALLAWVKKYHAGMRNDKSQ
    KITQPTAPNTQAKLEEEQR

    >gi|54309318|ref|YP_130338.1| disulfide oxidoreductase [Photobacterium profundum SS9]
    MTEYLYEIMLKFDLKSVIFCMNRHNIPFINNQTDRLTMKQYLKPALALLFTMVALVGCNDTNSPKEGDKYTQISTPISDM
    PMVVEVFSLS
    CGHCRSMETMLPEIKKMAGVNIDKVHVTFNESAQLAAYIFYTASIQTDGKPSDKLMEQLFAYTQDTPEAA
    TEAEKKVILEEIFTSNNLLSPYGLSEEQHKQVYKKMTEAESIVANSQLSSVPAFIVNGKYMVQSDAHQSLDDMANTIKYL
    TTLN

    >gi|54309329|ref|YP_130349.1| outer membrane protein [Photobacterium profundum SS9]
    MKKLSLIAAAVSAVLFVAAIPAKAAPLTSEQQDNLVKIQTILEQKPELIDGLLTSLNMYIDQENKTAVTLKKYHDWLYNN
    PDLAAFGSENPKLTIINFTDFN
    CPYCKRLDPVLQRLTEENQEVRVVNVFVPLQQREVAGIDTNSAQYALNVWKNDPDGYM
    KVHDYLIRKNGRHDKSSLERVAQVTNTKMLLDASNTLKPTVDKSYQVFSELGLNGTPAMLIGDQILPGYLPYDQLKPIVE
    EALKKLS

    >gi|54309416|ref|YP_130436.1| hypothetical protein PBPRA2248 [Photobacterium profundum SS9]
    MTAKRRIEIFSAGCAVCNEVVEQVKSMACPSCDITVLDMHEQSIAARAKVLGIKSLPAVVIDGKLADCCANRGIDESVLR
    AAGVGSPI

    >gi|161936302|ref|YP_130605.2| glutaredoxin 1 [Photobacterium profundum SS9]
    MFVVIFGRPGCPFCVRAKDLAEKLKEERDDFNFRYVDIHAEGISKSDLEKTVGKPVETVPQIFVDQDHVGGYTEFEAYAK
    ENLSLFQ

    >gi|54309598|ref|YP_130618.1| 6-O-methylguanine-DNA methyltransferase [Photobacterium profundum SS9]
    MAVMMYYDVIDTVLGKIYLLADSKGLRQLTVGSAGFCPDSSWEHDPDAMKPYTNQLTEYLSGKRQKFTIPLAPQGTPFQQ
    QVWQTLTEIPFGETFNYQQIADKLGTSNAAPAIGITRNVNPIPIIIP
    CHRVLNSNNSLCNYRYGQEVVSQLLALESGQLS
    LIPTIIK

    >gi|54309721|ref|YP_130741.1| Na(+)-translocating NADH-quinone reductase subunit E [Photobacterium profundum SS9]
    MTEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVSAYLVENYILAPLGIEYLRTLSFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINEHHNFIESVIYGFGAAVGFSLVLILFASMRERIAA
    ADVPGPFKGASIAMITAGLMSLAFMGFTGLVKL

    >gi|54309726|ref|YP_130746.1| electron transport complex RsxE subunit [Photobacterium profundum SS9]
    MSTNKELMKNGMWVNNPAIVQLLGLCPLLAVSSTVTNALGLGLATTAVLVGSNLIVSLVRQWIPSEVRIPVFVMIIAALV
    TCVQLLMNAYTYGLYQSLGIFIPLIVTN
    CIIIGRAEAFASKNDPIPATLDGLWMGLGMTAALVVLGAMREILGNGTLFDG
    ADRLLGDWALSLRIEVFNFDSSFLLAMLPPGAFLGVGFMIALKNVIDKKREEKKALTADKKPEIERVRITSAD

    >gi|54309736|ref|YP_130756.1| Ahp/CTSA family anti-oxidant protein [Photobacterium profundum SS9]
    MELTMSVLVGRPAPDFTAAAVLGNGEIVDSYNLFENIKGKAAVIFFYPLDFTFVCPSELIAFDKRYADFQSKGVEVIGIS
    IDSQFSHNAWRNTLVEDGGIGEVQYPLIADTKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNIDEML
    RMVDALQFHEEHGEVCPAQWEKGKEGMDASPAGVAAYLSEHTDDL

    >gi|54309738|ref|YP_130758.1| putative glutaredoxin-related protein [Photobacterium profundum SS9]
    METIDKIKQQISENPILLYMKGSPKLPSCGFSSQTSQALMSCGEKFAYVDILQNPDIRAELPVYAQWPTFPQLWIEGELI
    GGCDIVLEMFQKGELQPLIKEAAVRRDGEAAAE

    >gi|54309753|ref|YP_130773.1| putative selenophosphate synthase [Photobacterium profundum SS9]
    MENVRLTQYSHGAGCGCKISPQVLDTILRTQLAPFSDPNLLVGNESKDDAAVYDLGNGTAAISTTDFFMPIVDDPFDFGR
    IAATNAISDIYAMGGKPIMAIAILGWPVNVLAPEIAQQVIEGGRSVCREAGISLAGGHSIDAPEPIFGLAVTGIVDTDRV
    KRNNRAENGCKLYLTKPLGIGVLTTAEKQSKLADEHKGLARDWMCKLNIPGQDFANVEGVKAMTDVTGFGLMGHLSEICE
    GSQLKARVDFDSVPYLPGVFDYIAQGCVPGGTTRNFDSYGQKLGAMTEQQKALLCDPQTSGGLLIAVTPDAETEQQLQAI
    AARHNIELQAIGEMMPLDGDTLIEIC

    >gi|54309762|ref|YP_130782.1| methionine sulfoxide reductase B [Photobacterium profundum SS9]
    MSVSAKMDKIGFKMTDKTDAYWRKKLTEDQYHICREKGTEASFSGTLLHNRETGLYSCTCCEAPLFVSDNKYDSGCGWPS
    FDAPVNKEAVRYIEDNSHGMLRTEIRCANCDSHLGHVFPDGPNTTGERY
    CVNSVSLVFNTEE

    >gi|54309771|ref|YP_130791.1| disulfide bond formation protein B [Photobacterium profundum SS9]
    MQFLNTFSKSRISWLLLLLCIVFFEGSALFFQHGMKLGPCVMCIYERVAMMGIAFAALLGAIAPQYAIIRWAGLIAWGYS
    AVRGLQLSIEHVGYQFNPSPFAT
    CDLFVQFPNWAPLNKWVPWMFEAYGNCAEVVWTFLGQSMPQWLVIIFAGNLVALALI
    VIAQFFSKKTNTILDM

    >gi|54309892|ref|YP_130912.1| glutaredoxin 2 [Photobacterium profundum SS9]
    MKLFTFDHCPFCIKAMMVAGYKKADIEFVTLQNHDIEARIEKVGANLVPILQKPDGSYMAESLDIAAYIDQLDGKPALGQ
    SVEADKIAQWSEKTRPYSSLLLYPRWLKIDLPEFQCQEAKEWFHKKKSATIDESFDDAFAHSAQYITALNAVLTEIDWLI
    LPSERDNNLTYDDVNLFPSLRNLTVVKGLVFPTQVRQYIDEVAALTNINLYDNIAL

    >gi|54309978|ref|YP_130998.1| cation-transporting ATPase [Photobacterium profundum SS9]
    MTEFILPLGKVRCMNCANKIHTALTTLPNIEHVEVDTQRAIITGNVELAPIMSTITALGYEAGYQHVLPLQGLSCGKCVA
    KVEAALADNDQITDFSVTKTQASVTGAITEPNLITLIETLGYSVPTEHTFHFALSGLN
    CGKCVKKIENTLAEQSNISAFT
    ISKTQATITAKTEADTLVSLIESLGFMAKKVDGTETVINHDDIEISHTQDTPNIAPIQEDASSSTLQFLLSGMT
    CASCVS
    SVEKAILAVSGVKQANINLAERTALVTGTASEQHIITAIINAGYGAELSGDEQTRRARQQKQNDTAYRLHMRNAFISLGL
    GIPLMAWGLLGGNMTINSSSSQIAWGGIGIITFVLLITAGRHFFINAWKAFVHHRATMDTLVALGTGSAWLFSMLVVIAP
    DIFPEPARHVYFEASAMILGLITVGHALEAKARSRTSKALERLIDLQPQTAIVIINGNEQEVPLADVQAGMLVRLHPGSK
    IPVDGIVEEGQSYIDESMLTGEPIPANKQAGDKVHAGTMNQNGSLIFKAEQIGSNTMLARIIQLVRQAQSSKPALARLAD
    TISAIFVPSVMIIAILTAMVWYYFGPEPSSIYMLITATTILIIACPCALGLATPMSVTVGVGRAAEYGILIRDAEAMQLA
    ADIDTVVLDKTGTLTEGKPQVVNIHTYNNVQSDHLLNLAASLEQGSEHPLARAIIAAANTEALVLLKQQSFEAKPGFGVI
    GKVSEHQLLLGNARLLQQHHVDIQAAEEDVHDIASKGATPIYMAINNQLAGVFGVSDPLRQDSISAVKRMKAMNLNVVML
    TGDTLITANAIAHEAGIDTVIAGVLPDGKAAKIAELQQQGHKVAMVGDGINDAPALALAEVGIAMGSGSDIAIESAQFAL
    MRHSLHGVIDAIQLSKATLKNMKQNLFGAFIYNSLGIPIAAGVLFPLTGTLLSPVIAGAAMALSSITVVSNANRLRLFKP
    NQQEK

    >gi|54310025|ref|YP_131045.1| thioredoxin-dependent thiol peroxidase [Photobacterium profundum SS9]
    MKTLTAGTPAPAFSLLNQDNELTNLADFKGKKVLAYFYPKAMTPGCTVQACGLRDSKTELDALNVVVLGISIDAVKRLPR
    FIERDNLNFTLLSDEDHAVAEQFGVWGEKKFMGKVYDGLHRISFLIDENGTIEHVFNKFKTKTHHEVVLDYFNNAE

    >gi|54310028|ref|YP_131048.1| putative arsenate reductase ArsC [Photobacterium profundum SS9]
    MSVTIYHNPRCSKSRQTLALIEEKGITPTIVKYLDETPSENELKGLFAKLGYASVRDMMRTKEDAYKTLALGEGTVTDEQ
    LFTAMSQNPKLIERPIVVNGEKAAMGRPPESVLDIL

    >gi|54310282|ref|YP_131302.1| dihydrolipoamide dehydrogenase [Photobacterium profundum SS9]
    MSKEIKAQVVVLGAGPAGYSAAFRCADLGLETVLIERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALADHGIVFGEPQ
    TDISKIRLWKEKVVNQLTGGLGGMAKMRKVTVVNGFGKFTGPNSIAVTNNSGEGEETTTINFDNAIIAAGSRPIKLPFIP
    HEDPRIWDSTDALELNEVPEKLLVMGGGIIGLEMGTVYHALGSKIDVVEMFDQVIPAADKDIVKVYTKRIKSKFNLMLET
    KVTAVEAREDGIYVSMEGKKAPAEPIRYDAVLVAIGRVPNGQLFDAGVAGIEVDERGFIHVDKQMRTNVPHIHAIGDIVG
    QPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEREAKAEGINFETASFPWAASGRAIASDCADGL
    TKLIFDKDTNRVIGGAIVGTNAGELLGEIGLAIEMGCDAEDIALTVHAHPTLHESIGMAAEIYEGSITDLPNAKAKKKKK


    >gi|54310521|ref|YP_131541.1| soluble pyridine nucleotide transhydrogenase [Photobacterium profundum SS9]
    MTKNKKPTHFDAIIIGSGPGGEGAAMGLTKAGLNVAVIERENSVGGGCTHWGTIPSKALRHAVSRIIEYNQNPLYCKNNS
    SLHSTFSQILGHAQDVVNKQTRMRQGFYDRNKCSLIFGEASFIDAHTVRVKNADNSTDLYSADKFVIATGSRPYHPEGVD
    FDHSRVYDSDSILQLEHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLINTRHRLLEFLDNEISDSLSYHLWNSGAMIRNG
    ETFEKIEGTDDSIILHLESGKKMRADCLLYANGRTGNTDKLNLNKVGLTPDSRGQLAVNQNYCTDVDHVYAVGDVIGYPS
    LASAAYDQGRFVAQAITTGEAQGSLIDHIPTGIYTIPEISSVGKTEQQLTADKVPYEVGRSQFKHLARAQIAGTEVGSLK
    ILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGDGNTIDYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|54310594|ref|YP_131614.1| putative thioredoxin [Photobacterium profundum SS9]
    MEWKMNDKIVQLTDATFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKVTIGKLNIDQNAATPPKFGIRGI
    PTLLLFKDGSVAATKVGALSKTQLKEFLDANL

    >gi|54310598|ref|YP_131618.1| glutathione reductase [Photobacterium profundum SS9]
    MAKHFDYICIGGGSGGIASANRAAMHGAKVALIEAKALGGTCVNVGCVPKKVMWHGAQIAEAIHLYSKDYGFDVDVKSFN
    WSTLVKNREAYIGRIHQAYDNVLGKNKIEVINGFAKFVNDKTIEVNGEQLTADHILIAVGGEPTIPNIPGAEHGIDSNGF
    FGLNEQPKRTAVIGAGYIAVEIAGVLSALGTDTHLFVRKESPLRSFDPLIVETLVEVMNAEGPTLHTHSVPKEIIKEADG
    STTLHFENGESHNTDLLIWAIGRNPTTDKINLASTGVETNSRGYIKVDEYQQTNVAGIYCVGDIMEGGVELTPVAVKAGR
    QLSERLFNGKTEAKMDYKLIPTVVFSHPPIGTIGLTEPEAIAQYGEDNVKVYTSGFTAMYTAVTSHRQPCKMKLVCAGPE
    ETVVGLHGIGFTVDEMIQGFGIAIKMGATKADFDSVVAIHPTGSEEFVTMR

    >gi|54310628|ref|YP_131648.1| putative thiol:disulfide interchange protein [Photobacterium profundum SS9]
    MMKKLLALASVALLSFSVQAAKFSEGDYYKVLELPKSSSPIVTEFFSFYCPHCNSFEPMIQKLKKQLPDNAKFQKNHVSF
    MGGSMGKSMSKAFATSIVLGIDDKMTPVLFNRVHGMKKPPRNDAELRQIFVDEGVKAEDFDGAYNSFAVNSMVNRFDKGF
    QDSGLTGVPALIVNNKYLVQTGKIQSSDEYFELVNFLLKK

    >gi|54301686|ref|YP_131679.1| putative tetrathionate reductase, subunit B [Photobacterium profundum SS9]
    MLSGIGAITAGAALIPVVQASNASTGNIVVGNKYKNNNQPDRKGMVGKRYAMVVDLRKCVGCQACTVGCSIENQAPIGQF
    RTTVKQYEVTLDDGSTGTKQVKSFMLPRLCNHCDNPPCVKVCPVQATYQREDGIVMVDNKRCVACAYCVQACPYDARFIN
    EETLTADKCTFCAHRLEQGLLPACVETCVGGARIIGDLNNPSSEINRLLVEHKDELNNHLLK

    >gi|54301890|ref|YP_131883.1| methylated DNA-protein cysteinemethyltransferase [Photobacterium profundum SS9]
    MFNQLIHTPIGWLNIKASDKGVVAIEFNADQAASQKMNTVTQQCFEQLSEYFTGVRKVFSVSLDMQGTDFQQQVWRALEQ
    VEFGQTCSYTDIAVGVSSPKAVRAVGAANGRNPVPIIVP
    CHRVIGRSGKLTGYAGGIDTKAWLLTHEGTNFLSK

    >gi|54301932|ref|YP_131925.1| hypothetical protein PBPRB0252 [Photobacterium profundum SS9]
    MLKVVSYVICPFVQRITGLLEAKGVPYDIEYISLKDKPKWFLDIAPNAQVPLLITEDSIPLSESDAIAEYLDDEFPLLRP
    EINKSACRARQRAWVYQGTKLYLKQCSHMQSGNQQIFEERQEFMRKQFAKVESFLKGHTNTQYFCADILGNIDMAWLPLF
    HRAALVQKYSGTKLFEGFPLLQIWADNIMATGIAEKTVHDSFEDSFVNFYLSEKTYLGSGNTTKDCDCCGSSSSCCG

    >gi|54302017|ref|YP_132010.1| 2-hydroxychromene-2-carboxylateisomerase family protein [Photobacterium profundum SS9]
    MSKLRNIRIDIVSDVVCPWCIIGYRRLEEALGAFEGKINVELYWQPFQINPDMPSEGENLGEHLTKKYGLTSEQSQANRE
    NLIQIGESLDFTFNFTPEXKIYNTFKAHQLLHWAAKQGRQHALKLALFDAYFTEQKDPSDIELLVTAAMQVGLDGEEARA
    VLTDERFADDVKMNQQTWTNSGIQSVPSIVLDQKYLISGAQDPETFIQSIQQVLDDAR

    >gi|54302168|ref|YP_132161.1| hypothetical protein PBPRB0488 [Photobacterium profundum SS9]
    MIQNKASLHSLSFLRTGRSSSLNILILASALLTLPFSANAGLFGGKFKAEVETEQVAIKLHNETLAGDYLLIDTNGLKTL
    IEQDTDVMIVDAMPFKDSYKKEHIPSAKQFEFPIPNMPEWDSALTDQQSVEDFTQLLGENKSKTLVFY
    CGFVKCSRSHNA
    AAWAVKLGYTNVYRYPGGIFAWKGAGFKTSSL

    >gi|54302332|ref|YP_132325.1| hypothetical protein PBPRB0652 [Photobacterium profundum SS9]
    MFKLHYQVLLLIFLCPVVYCKGLENTLELDLEQARLSRQGQYQVRTQYLSKIGTPVYTNRLILENSPYLLQHAHNPVNWY
    AWGKEAFDAARRENKPIFLSIGYST
    CHWCHVMEAESFDNEEVARILNKYFISIKVDRDLRPDIDDFYIKAALVFSGKAGW
    PVSSFLTHDSKPFFVASYFSRPDFVDLLEQVQDKWTNNHQFLLKSAIEIYQEIQEQQKVASVADTISPSLIDQTIIKILS
    SEDKRWGGIDQIPKFPRELILMLLLRKLKTVDDFALSREWEFISRELDALLQGGIYDQVAGGFHRYATDKAWRIPHFEKM
    LFNQALLADIYTNAWFYSGDNEYKRIVIETLNYVLNEMRSDKACFYSATDADSENEEGKFYLWHDREIASLFTPGETDFV
    RKLYGIRQEGNFNHKNIPYLPNGLESVAEANDVDYQILLTKIAGIRQKLYQKRAERIPPFKDKKQVVEWSALMISALANS
    GLVFNTPEYIRVADQCAEAIWQHAINDQGSSFRLIDSNKASASATLGDYGHYIQAMLTLYDVTDKDIWLTRSHLIYLQAV
    RMFQDKKSGGFFNTAFDQNEQLFLRSKNVTDNTVASGNSAMLMAMVMLHQRSGQFVKQSQIKEFISYNASVINQNPIAFP
    AMLAAVDESLQADIKPVKYAAKGNIKIRAEFRQNKKQLTLTLMISNGWHINSTQPLQSNLIPTTVELVYPTTADLTMQYP
    EGHLKSLSFSQQELSLYEDELKLTGNIIQPVASNYLLINIRLQACNDKMCLPPETVRIAPIYLD

    >gi|54302503|ref|YP_132496.1| thioredoxin 2 [Photobacterium profundum SS9]
    MSRHYKMNKHLYPAMASVMEVEMKLITVDCPHCNKANAISPKSLSNTVSCEYCRKPLLDGKPVEANTQNFDKLVLSPKPV
    VVAFWGPN
    CSPCNTFKPIFEKVASERQSQLRFLRVNSVQNKAIATKYRVRGVPTVMVFKKGRQQAVLNTGLRKKEFSQWL
    DDVLQS

    >gi|54302561|ref|YP_132554.1| rhodanese-like sulfurtransferase [Photobacterium profundum SS9]
    MPLVPSSLVTTDWLAEHLTDDNLVILDASWFMPSSTRKPQQEWSEKRIPSARYFDFDKKIAEPSTQFPHMLPSPELFEKA
    VSELGINNDDAVVVYDTHGLFSAPRVWWMFKAMGHKNIAVLDGGFPAWLAGNNPIEKGELAAAEITVYKAAFEPEWVIDA
    DTLESLLDDHSVAVLDARGAARFFGTEPEPRQGVRGGHMPNAKSLPFSQLIKDGFFIDKELLVNRFNAVSDIEQRLIFS
    C
    GSGVTACVLALGAELAGRKMLTVYDGSWTEWGSTYKYPVVK

    >gi|54302856|ref|YP_132849.1| putative organic hydroperoxide resistance protein [Photobacterium profundum SS9]
    MTTLYSTSATASAGRNGMVKTDDAKLELALSYPKEMGGTGEATNPEQLFAAGYSACFSNAILFVAQSKKLKLAEAPTTAT
    VGISPNETGGFSLSVELAVKLQLEQTEALELVRKAHQV
    CPYSNAVRNNIDVKVSVNGELI

    >gi|54302861|ref|YP_132854.1| putative glutathione peroxidase [Photobacterium profundum SS9]
    MALKSLAIVEAEWFFYPHIRVRMMMTTFYDISADNIRGESVSMNEFAGKLVLVVNTASECGFTPQYRGLQDLYAKYKDQG
    LVIIGFPCNQFGGQEPGENTDIAESCLINYGVDFPMFAKVDVNGADSHALFQYLVKALPGTFGSKVKWNFTKFMISRDGK
    PLKRFAPTKKPESMEADIVRALKA

    >gi|54302948|ref|YP_132941.1| hypothetical protein PBPRB1270 [Photobacterium profundum SS9]
    MPHPILYSFRRCPYAMRARMGLLLAKRSVMLREILLKNKPADMLAASKKGTVPVLILNDGSVIDESLDIMQWALQQNDPA
    NLLCIDNPSIQSDIDALIATCDGEFKGWLDKYKYADRHPDFPEEYYRQQGMHFLNVLEERLSTSNYLLGTAPTLADYAIF
    PFIRQFAHVDRQWFEQSSYPKIQDWLTKHLESDVFSKVMAKYPLWLDNHESFLFE

    >gi|54303164|ref|YP_133157.1| putative suppressor for copper-sensitivity B precursor [Photobacterium profundum SS9]
    MKKIFNSYVSLFILISPSFLALFSLTANASDESTGWLVNPMHPPLEVRLMLTGQKDLEAKTVEGFLEVKLDTDWKTYWRS
    PGEGGIAPKVDWELSNNLDTVDWQWPMPKRYEFLGVETLGYKEHVIFPMTFHIDDMNKPVFLSGKLTMSSCTSICVLTDY
    ELVLDFTPANLPLSTNAMHVFNQGMSQVPKTSQAVSLDMISWNQAKKELTVVATNTAGWNKPDVFIDGQSQNVKDTSFLA
    PKIAINDNQMIATMSASSWFGDPELLNEEMAVTISDENMAVELSATATNQIVPMAANTSLLKIIGIALLGGLILNIMPCV
    LPVLGMKLSSIISAEGLQKRQIRTQFLASAAGILTSFWLIAGFLVILKISGQALGWGIQFQNPYFIGTMILITGLFAANM
    LGLFEIRLSSNANTWLATRGGNSHTGHFVQGMFATLLATPCSAPFLGTAVAFALGANYITLFAIFTALAIGMAAPWLLIA
    LFPRLAQMMPKPGKWMDNVKTVFGLMMLATSIWLLTLMTSFISTSLVWLIGLSLIVLLLWRLGNVKGRKPVIVTLAFLIF
    GSAGGMLLGSVTADHWATPLPADHAWVPLQTDEIARAVSQGKTVFVDVTADW
    CITCKANKIGVLLQEPVYSTLGEDNMLL
    MRGDWTKPSDYVTGFLQSYGRFGVPFNIVYGPGAPQGISLSVILSSDDVLNAIRVASDSSNAMVSAQANNG

    >gi|54303165|ref|YP_133158.1| thioredoxin [Photobacterium profundum SS9]
    MPFVLRVIHLMPWFQLRRITVKGEYMSELNGNASPKRPQKKTEDKDKKKKAKGIRHWLKEAVIFIAILTIFSTGLDIWRS
    GDMPSNEVPELITQTINDETIDLKAMSYEKPVLLYFWATW
    CPACKFVSPTVNWMSDHFTVVSVAITSGENRRINAFMDNS
    GYTFPVINDDKGNISRSWGVSATPSIVIIKDGEISFITTGVSTPPGLWLRMLFA

    >gi|54303219|ref|YP_133212.1| putative thioredoxin [Photobacterium profundum SS9]
    MIELTKENFDSEVNVDGIVMVDFWSESCVRCKELMPDVVEMEAKYSEQMKFCKLNIQGNRRLAMAQKVMGLPSFVFYKNG
    EKQTHLSGEELEVEDIVKAIESFVCEQA

    >gi|54303220|ref|YP_133213.1| putative thioredoxin reductase [Photobacterium profundum SS9]
    MSELYDVIIIGGGAGGMSAGVYAARGKMKTLIIEEKRKAGGQAATTDEMENYPGILSATGPELMDAFRAHCDKFGVEFTK
    GIVNKIDVADDGYLKTLTTTKGEVFQAKSIIIGTGASPLILGVPGENEFRGKGVSY
    CATCDADFFEELDIVVVGSGNTAV
    EESLFLTKFVNKITMIVRRDHGILAADRTAQEQAFANDKINFVWNSVLDEITGDELVNGVNVKNIKTGEISHIESDGVFM
    FVGTVPKTDFIKGLIDLNSHGYIVTNDKQETNIPGIYAVGDVTEKFLRQVVTAAGDGAVAAVAADRYIEEEDNWRKSVVD
    FDGTALVAFWAPQNQDSIDVINQLEAQNKGQAGKNVVTIDIFKNQKIAKQFNVSEIPVVIRFDAGQEAKRVNVKDLNELE
    TLY

    >gi|54303222|ref|YP_133215.1| hypothetical protein PBPRB1553 [Photobacterium profundum SS9]
    MQNILFILNEAPYGSERSFNALRLAINLNEQEHEATQLQIFLMSDSVSCALVRQKPSEGYNIQQMLDILLAQGAQVKLCK
    TCTDARGMTDLPLLEGAEIGTLDDLSLWTLKADKVVSF

    >gi|54303325|ref|YP_133318.1| hypothetical protein PBPRB1658 [Photobacterium profundum SS9]
    MLPNLHAVLAEAPATYEAYNTTFDLFMNSTTFSPLEQQVVFMTANFENNCHYCVPGHTWMMKAGKMPEEVIEALREGTVI
    PDAKLQALHDFSKELLDKRGHIGDDRLQAFFDAGYTKRQALEVLTGLSAKLISNFTNAIAHTQPDAAFQKYAWTHPSQR

    >gi|54303437|ref|YP_133430.1| thioredoxin 2 [Photobacterium profundum SS9]
    MNTMTTRCPHCKAMNRIPTERIEDTATCGSCKEKLLDGKPIEGTTSNFLSLIQSDTPVVVDFWAPWCNPCVGFAPIFEDV
    AAERSGDARFVKIDTEAQQELAAQYRIRSIPTIMVFKNGQLLNNLNGALPKSQFNQWLNETLEQAK

    >gi|54303634|ref|YP_133627.1| thiol-disulfide isomerase [Photobacterium profundum SS9]
    MKTVKKKCISIAFAILSLLSAGCNSDTIAKQGIHYTILPPISYELPEVVEIFSLSCTHCRMMEEIMHSLEIKSESDIQKM
    HCVFNKRTSTEAYLYYSAAIQTEDQPSRLLMDQLFAFIQHDAEGLSGLQVESKIRDIFHTYNLQAPEDLTAEQFEKISEL
    VERDRQIMKELNLGSVPAIVVNGKYLINMNEHVNLDAVALTIKELKTI

    >gi|54307531|ref|YP_128551.1| sulfur transfer complex subunit TusD [Photobacterium profundum SS9]
    MTLNYVLVVNGPVYGTQAARSAYQFALALLAQGHQLSRIFFYQEGVQNGSALTVPASDEFDLVAAWQQLSITHSIELQTC
    VAAALRRGVVGKQEATQNMLSADNLATGFEQAGLGGLAEAMLTADRVIQF

    >gi|54303245|ref|YP_133238.1| hypothetical protein PBPRB1576 [Photobacterium profundum SS9]
    MQKRIDISGLQTKAIEAMMGLENYVSGSELPATLKELIKLRASMINNCAYCIQMHTPVAQQSGITVQRLMALAAWQESPL
    FSDVECAVLAMTDEMTLIADQGLPEATYNRCIELLGETATAQCMMQIVTINAWNRIAISTKMEHAS