Phenylobacterium zucineum HLK1 uid58959

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|197103174|ref|YP_002128552.1| thioredoxin [Phenylobacterium zucineum HLK1]
    MAERRRVVCPNCDSTNSVPADRPADAAKCGRCHAKLFPHAPIELSGDRARKHLQNSDVPVIVDFWAPWCGPCRAMAPIFE
    RAAQALEPRARFVKINVDENPDLAAQYGVQGIPALFAFQKGQVAARQSGVADLGVLRGWVERLAA

    >gi|197103211|ref|YP_002128589.1| thioredoxin [Phenylobacterium zucineum HLK1]
    MVEKLRVVCPDCDSTNNVPADRPADAAKCGRCHAKLFPHAPIALSGERARKHLQNSDVPVIVDFWAPWCGPCRAMAPIFE
    RAAQALEPRARFVKINVDENPELAAQYGVQGIPALFAFQKGQVAARQSGVADVNTLKSWVDRLAA

    >gi|197103212|ref|YP_002128590.1| peroxiredoxin [Phenylobacterium zucineum HLK1]
    MEGDAVSTPLKVGEPAPDFALPDANGQVVRLSDFRGRNVLLVFYPLDWSPGCSRQLDLYQQELDEFRNRNVEVVGVSVDS
    LYSHGAWAAVRGVTFPLLADFNPKGEVARRYQVWRDADGFSERALYLVDADGVIRYAHVSPKLQHVPDIYELFEVLDGLA
    APKAA

    >gi|197103351|ref|YP_002128729.1| copper-translocating P-type ATPase [Phenylobacterium zucineum HLK1]
    MPEATLTSIDIPVLGMSCASCVGRVEKAIKAVPGVAAASVNLAAERAHVAVTSPERAQAVVDAISSAGYEPLKRTFDLKI
    DGMT
    CASCVGRVERALQDVPGVLTVSVNLATETAAIVALEGAAEIPALIAAVERAGYGASPVGEASEQADRERLAREAEV
    TGLRRSVVLAAVATAPLFIIEMARHVIPGVHHWLVGVIGEQPWRIISFGLAAFVLFGPGLRFFAKGLPNLVRRTPDMNSL
    VALGTSAAFAYSAVATFAPRLLPESVDHVYYEAAAVIVTLILVGRLLEAQAKGRTSEAIKRLMTLQAKSARVLRNGEESE
    IPIAQVLAGDVVAVRPGERVPVDGQVVEGASFVDESMITGEPVPVAKGVGDDVVGGTVNKTGAFRFRATKVGAATLLSQI
    VRMVQAAQGAKLPIQALVDKVTGWFVPAVIGAAALTFAVWLAVGPAPALSFAMVNAVAVLIIACPCAMGLATPTSIMVGT
    GKAAELGILFRHGEALQTLNSVRAVIFDKTGTLTLGRPALTDLDPSPGFEEAELLRLVAAVETRSEHPIAQAIVEAAKAK
    GLKVPEAEAFEAVPGFGARAQVAGRRIEVGADRFMAHLGVPISPVAHAAEQMAAQAKTPLYAAIDGELAGLLAVADPIKP
    TTPEALTALHRTGLKVVMVTGDNRRTAGAVAAALGLDDVLAEVLPDGKAEAVKALQQRYGRVAFVGDGVNDAPALATADV
    GLAMGAGTDIAIESADVVLMRSDLRAVATAIALSRAVLNNIRENLLWAFGYNILLIPVAAGLLYPLFGVLLSPMVAAGAM
    ALSSVSVVGNALRLRRFRSTAAPEPRGEPEPVAIPGGAA

    >gi|197103412|ref|YP_002128790.1| Co/Zn/Cd efflux system component [Phenylobacterium zucineum HLK1]
    MSSTTAAAGTLRYRVTGMDCSSCAEKIQAAVTKLPGVEEARVSIASSMMTVKVDDAARRSPAVEATVTELGYHLDREGSP
    ATADPDELPKDLSHITPAYRRALWIVVLINVGYGLVEIVAGFVARSQALKADALDFMGDGLITFLGLLAIGWSLVWRARS
    ALIQGLFLAALGVGVLLNTAYRVLVLNQPEAELMGVFGVIALVANVAAALILIPHRAGDANVRAVWLFSRNDALGNLAVV
    IAAGLVFWTRTAWPDLVVAVIISGLFLQSAWSIIRDARTDLREARSLSAA

    >gi|197103424|ref|YP_002128802.1| glutathione S-transferase [Phenylobacterium zucineum HLK1]
    MKLYYAPGACSLAPHIVIREADLSADLERVDLAAKKTEHGDDFRSINPKGYVPALKLDDGPLLTENAAILQYLGDRAGEE
    AGLIPAAGTIERYRLIEWLTFVSTELHKGFSPLFNPAFPDEARKLTRAKLAERLGWLNEHFADHEFLHAERFSVADAYLF
    TVLSWTKRHAIDLQPYPNVKRFQNRIAERPAVQKALGEEGLLEQAAA

    >gi|197103485|ref|YP_002128862.1| thioredoxin [Phenylobacterium zucineum HLK1]
    MTLIGETGGAPTGDVNKAEIIKDGTDASFMADVVEASKTTPVIVDFWATWCGPCRQLGPALEKAVTAAKGAVKLVKVDID
    RNPAFAGQLRVQSIPAVFAFVDGRPVDGFMGALPESQVKQFVDRLAKQGGGDPIEQMLEMARESLELGDMGGAAQAYAQI
    LQADPQNVKALGGLARLYQQSGDLERAREVLEMAPEGAKDPDLDAVRAALALAEEAPSETAEFEQRLAADPDDHEARFEF
    AKALAGSGRMMEAVDELIEIVRRDRAWNDEAARKQLLTIFEAAGPTSEVAKQGRRKLSSLLFS

    >gi|197103498|ref|YP_002128875.1| molybdopterin biosynthesis protein [Phenylobacterium zucineum HLK1]
    MTFTDDEIERYARHLVLRELGGPGQQKLKAASVLIVGAGGLGAPASLYLAAAGVGTIILADPDEVDRSNLQRQVIFAEDD
    LGRPKVDAAADRLHALNPHVFVAGFNGAFEAATADELVEGVDLVLDGTDDFGVRFCVNEACVRHGKTLVSGAIGRWTGQV
    GVFGRQPCYRCLVPEIPPDAET
    CVAVGVVGALPGVIGSMMAMEAIKLITGAGEPLAGRLLIYDALAAETRTVKVAGDPGC
    PVCGGPPSP

    >gi|197103533|ref|YP_002128910.1| rhodanese-related sulfurtransferase [Phenylobacterium zucineum HLK1]
    MFGRQRIKDLTPNEVRAKMQHREIVLIDVREPPEFAAERIHGALNFPLSTFDPRALPAGGDRPLVFQCGSGKRSAMAVER
    CRQEGVAAEAHLAGGIAAWRSEGLPTIRFDPATGQVVDAG

    >gi|197103535|ref|YP_002128912.1| thioredoxin [Phenylobacterium zucineum HLK1]
    MRQLVCHACNAVNRMPLGKDPLEAKCGRCGDRLFAGRPIEVTGAELAVHRGSTKGAALLLDVWAPWCGPCRMMAPHFEKA
    AARLEPQVRLLKLNSEQDPQAAADLQVSGIPTLILFRDGGVVARQAGALSADQIVAWTQQALAKAPA

    >gi|197103585|ref|YP_002128962.1| putative methylated-DNA-protein-cystein methyltransferase [Phenylobacterium zucineum HLK1]
    MIRFALFETAIGWAGIAWNEADSQARLVACHLPERDAETARRGFRRRFPETAEAEPPASLSPTIAGIQALMRGEKADLSA
    APLDLSRTPPFHARVYEIARAIPPGETLTYGEIAEKLGDKLLARDVGQALGKNPWPIVVP
    CHRVTAAGGKPGGFSARGGV
    DTKLRLLAIEGAKAAIPKETPQGDLFA

    >gi|197103601|ref|YP_002128978.1| thiol:disulfide interchange protein CycY [Phenylobacterium zucineum HLK1]
    MSRWLAWIPLAALVALGLLFGLYALNRNPQIQPQALVGKPVPTVSLPTLAEGQPVSLREMASEGPMIVNFFASWCAPCEI
    EHPVLMGLKGQPVRVVGIAYKDAPQNSQAFLDRLGDPYAEVLVDRDGRAGVEFGVTGVPETYVVGRDGMILAKHTGPLTE
    ADARRLAAQAR

    >gi|197103665|ref|YP_002129042.1| thioredoxin [Phenylobacterium zucineum HLK1]
    MSTVKVTDESFETDVLQAERPVLVDFWAEWCGPCKQIAPALEQLSDELADKVTIAKLNIEESPTTPSRYGVRGIPTMMLF
    KGGQMASMKVGAMPKQKILEWLTEAGVAA

    >gi|197103730|ref|YP_002129107.1| organic hydroperoxide resistance protein [Phenylobacterium zucineum HLK1]
    MIRKANATWRGTGRDGAGTLDSASGVLSATPYSFKTRFEDQPGTNPEELIAAAHAGCFTMALAFGLQRAGLEAEELRTEA
    AVSLEQDGAGFKITRSALTLRARVSGIDEAKFLELAREAEQT
    CPVSRVLNAEISLDARLEG

    >gi|197103787|ref|YP_002129164.1| peptide methionine sulfoxide reductase MsrA [Phenylobacterium zucineum HLK1]
    MRPRILLLTGAAAFIAAAPAGAATKTAVFAGGCFWSVEKFFEAKPGVVSAVSGYSGGTLRQPTYRNHPGHLEAVRVTYDP
    AKVSYAQLVDHFFHNIDPTDPKGQICDKGPSYRTAVFVATPEERRIAQQAKAGVAKELRAKVATEIRAAAPFWPAEAYHQ
    DYAKKNPAAYERYRVGCGRDRWLGVVWGR

    >gi|197103795|ref|YP_002129172.1| thio:disulfide interchange protein [Phenylobacterium zucineum HLK1]
    MGVFAGAAFAQPVNTGHLVAELAPRAQGIAPGQTLHVALVQKIQDGWHTYWRNPGDSGEPTRIEWTLPPGWSAGEFVWPT
    PHRLPVGPLVNYGYEGQVILPVPVTAPADAAPGQTVTLKGRATFLVCEEICIPESADLTLSLPVVAAPAPAHPQWDGPIR
    KALAEAPKPAGLTAAFQKDAAGVKLAIVGAPLKGADVSDAYFFPFSGTAIDHAKPQPIERGAEGLTLTLTPGVDFQTGDP
    QDLSGVLSLGETAYEVTAAAGPLPAAAAGLGPPPARVSGGGAGALNLATAALFGLLGGLILNLMPCVFPVLAMKAASLAG
    HGGGAHAEARRQGLAFGAGVLVTFLALAGVLIALKAAGSAVGWGFQLQSPPVVAALALLMLAVALNLSGVFEVAGSLQNV
    GSGLARRGGTTGAFFTGTLAVVVAAPCTAPFMGPALGWALTQSAAAALTVFLALGIGFAAPFVAVAFVPALLDRLPTPGA
    WMETFRKALAFPMYAAAAWLVWVLAQQTGPEGLARLLAAAIVVALAAWLAGIAQRRALQGGRPLAYGLAAGVLAVLALAA
    VVGPRYAEAAQGPATASAGGVPYETYSPARLAELRAAGTPVFVNYTAAW
    CVSCQVNERVALSTRGVAEALERTGAVYLKA
    DWTKKDPQIAAELASFGRAGVPLYLVYGAGGGEPAILPALLTEGLVVRAIDAAAKPS

    >gi|197103832|ref|YP_002129209.1| stress-inducible protein, OsmC/Ohr family [Phenylobacterium zucineum HLK1]
    MQQYVVQARRIDAHGSEAEAKQARLVLDTDVKGRTDAFNPAELLLAAVAACMIKGIERISPMLEFDVRGVEVRLTAQRQD
    APPKIIRIDYELVVDTPEPDRRLELLHTNVRKYGTIFNTVSAAAPVEGTIRRREA

    >gi|197104020|ref|YP_002129397.1| peroxiredoxin [Phenylobacterium zucineum HLK1]
    MTIKVGDKLPNVTLTQATAEGPRPVSSEEFFKGKTVALFAVPGAFTPTCSAKHLPGFKQEAGALKGKGVDEIACLSVNDA
    FVMRAWAEDQAVGEDITMLADGNGDFTKAIGLEMDGSKFGMGPRSQRYSMIVEDGVVKQLNVEQGGEFKVSSADYLLAQL


    >gi|197104046|ref|YP_002129423.1| probable disulfide isomerase [Phenylobacterium zucineum HLK1]
    MTILSRRLLLVAAAGASLVLAGCGKGAGPTASAEDMTLGDANAPVKVVEYASVTCSHCAAFNETTFPQFKAKYIDTGKVH
    YTFKEFLTPPEQVAAAGFLVARCAGKDKYFTVIDALFRSQQEMFQSGDMRGGLLRVAQSAGMTEAQFNACIQDEAALKAL
    NDRVEKAIRQDGISATPTFVVNGKKVKEGDITLAELDAAIAEASK

    >gi|197104047|ref|YP_002129424.1| hypothetical protein PHZ_c0581 [Phenylobacterium zucineum HLK1]
    MNALSRRGALTVGLAAGLAGGLGLALAGPQALAAAEPAAGDISVGSPKAPVHVVEYLSVTCPHCAHFNADVFPTLKAKYI
    DTGQVRWTFREMLTAPGNVAAAGFLMARCAGPSKYVKVVDEVLRSQPRWQSGNIKPIFLEIAQANGLTEAQFEACLTDPK
    GQEALQQRLMLAQKDEVTGTPTFFVNGKRVGGPGVPDLADMEAAIAQAAKGGRR

    >gi|197104102|ref|YP_002129479.1| thiol:disulfide interchange protein [Phenylobacterium zucineum HLK1]
    MSEGPAASTKPRSVLTWALWGAALLGVAAVLYIIAQASTKPAATTAGAPAAKTLMSKWTPPEAPTAPPDYAFYDEAGKPV
    RIADFKGKVVVMNIWATW
    CAPCKVEMPTLAKLQAAYAGQPVEVVAVSIDSAGEAAAAKLFIASNDPLKFYHDREMKLPFR
    LQPPAQGAPTTVIYGKDGMEMGRVAGEADWAGAEARALVDKALAAD

    >gi|197104235|ref|YP_002129612.1| glutaredoxin 3 [Phenylobacterium zucineum HLK1]
    MAKVTIYTKPYCPYCIRAISLLEQKGVDFTEIEAAFDPEKKAEMVQRSGRMTFPQIFIGERHIGGCDDMIALEREGKLDP
    LLQAA

    >gi|197104315|ref|YP_002129692.1| arsenate reductase [Phenylobacterium zucineum HLK1]
    MVSTSLYRGAMSDVVIYHNPACGTSRNTLALLREKGIEPKVVEYLKEGWTKDQLKDLLKRMDASAHDILRVRGTNAEELG
    LTDPAASEDALIAAMIIEPILVNRPIVTTSKGAALCRPAELVLGLL

    >gi|197104465|ref|YP_002129842.1| glutaredoxin-related protein [Phenylobacterium zucineum HLK1]
    MTDAATANPVHEWIAQAVADHPVILFMKGVPEQPRCGFSAVVVQILDHLGVDFTGVDVLQNEQLRDGIKTYSDWPTIPQL
    YVKGEFVGGSDIVREMFQSGELKTFLSEQGVLEA

    >gi|197104589|ref|YP_002129966.1| glutathione S-transferase [Phenylobacterium zucineum HLK1]
    MIELWHCPDARSFRPLWALEELDLPYELHLLPFPPRVRAPEYLEVNPLGTIPAMRDGETFMSESAAIVQYLVTRYGPSDL
    AVPVEDPAYGAWLNWLHFGEATLTFPQTLVLRYRTFEPGKAEVVADDYAKWFLSRLRHVDRALSAGDWLCAGRFTAADIS
    VGYALLLANHLGLSESFSPQVKAYWERLKARPAFQAAKAAQKMELSEALSS

    >gi|197104649|ref|YP_002130026.1| selenophosphate synthetase [Phenylobacterium zucineum HLK1]
    MSGPVRLTSLAHGGGCGCKLAPAVLREIMSKMPAAAAFPDLMVGTETSDDAAVWRLNETQALVATTDFFMPVVDDPFDFG
    RIAATNALSDVYAMGGRPILALAIVGMPIASLEPDVIGAILAGGASVCAEAGVPVAGGHSIDSVEPIYGLVALGLVHPDR
    VLTNRGARAGDVLILTKALGVGVLSAAFKQERLDPAGYAALIASTTRLNSLGAELPDVAGVHAVTDVTGFGLLGHALEMC
    RGAGLSAEIEAGAPALLDGVEALVTSGVRTGASGRNWASYGEAVREPPGLPDWRRDLLTDPQTSGGLLIAVDPAAADRVL
    SLARERGFDSARVVGRIADGPPEVRIV

    >gi|197104743|ref|YP_002130120.1| peptide methionine sulfoxide reductase [Phenylobacterium zucineum HLK1]
    MSTPAVSPSGFDLSAPNAEERKRLEAGLSREQAEVLLRHGTEAPFCGGLLDQKDDGVYCCRLCALPLFRHQTKFESGTGW
    PSFWAPYDEAHVKGVRDTSYGMVRIETRCARCDSHQGHVFPDGPPPTRLRY
    CINSVSLEFVPTGQPLRDPLGRGDNAHFE
    SA

    >gi|197104901|ref|YP_002130278.1| arsenate reductase [Phenylobacterium zucineum HLK1]
    MSEFPITIFHNPACGTSRNTVAMVRAAGYEPEVVEYLQAGWTKPQLQELLAAMGATPRDILRGKGTPAAELGLLEPHVGD
    DAILDAMVAHPILVNRPIVVTPKGVKLSRPSEAVLDLLDRKPDSFTKEDGEVVRLA

    >gi|197104934|ref|YP_002130311.1| copper-translocating P-type ATPase [Phenylobacterium zucineum HLK1]
    MTQTTLTPIDIPVLGMTCASCVGRVEKAIRAAPGVASAAVNLAAERAHVQLTSDGRTADVVSAIRKAGYTPLERTVELKI
    EGMT
    CASCVGRVERALGATPGVLHASVNLATERAVVRVLDGIDLSALTAAVVRAGYRASTVAEGSDATDREAAARKREIE
    GLGRSVALAAAATAPLFLIEMARHFVPGAHHLLAERIGEQAWRVVSLALAAFVLFGPGLRFYRKGVPNLLRRAPDMNSLV
    VLGASAAFAYSAVATFAPGLLPAGANHVYFEAAAVIVTLILVGRLFEAQAKGRTSEAIKRLMTLQAKTARVQRAGAEVEV
    PIAEVAVGDLVLVRPGERIPVDGEVLDGASFVDESMISGEPVPVEKGPGAVVVGGTVNKTGAFRFRATAVGGATLLAQIV
    RMVESAQGAKLPIQALVDRVTGWFVPVVIGVAALTFATWLGFGPNPALSFALVNAVAVLIIACPCAMGLATPTSIMVGTG
    KAAELGVLFRRGEALQSLRDVRAIAFDKTGTLTLGRPTLTDLEVAGDFNGDEVLRLVAAVEAQSEHPIAAAIVEAARERG
    LHAARAEAFSALPGFGAEARVDGCRVQVGADRLMARIGLDVAVFGDAAGRLADEGKSPLYVAVDGALAAVLAVADPVKPT
    TPEALDALRASGVKLVMITGDNRRAAEAVARTLGLDDVVAEVLPDGKVAAVKALQDRYGRVAFVGDGVNDAPALATADVG
    VAMGAGTDIAIESADVVLMRSDLRAVATAVALSRAVLANIRQNLAWAFGYNVVLIPVAAGLLYPLFGLLLSPMIAAGAMA
    LSSVSVLANALRLRRFRPAARSGSAPRLSSEGAPA

    >gi|197104961|ref|YP_002130338.1| putative regulatory protein [Phenylobacterium zucineum HLK1]
    MAGYDLIVIGSGTAAQVAVGRVRAAGWSVAVIDHRPFGGTCALRGCDPKKMLVSGEEALDAAARMAGHGVEGALAIDWPG
    LMAFKRTFTDPIPAKQEARYAALGVDAFHGTARFVGPDRVAVDGHTLQARHILIASGARPVPLGIPGEDLVVTSDAFMEI
    EALPRRIVLIGGGYVAAEFSHLVARAGAEVTILQRAARLLPHFDPDAVGWLMPRFRELRIAVETGATVTRVEQSHDGLRV
    HASRRDGPHLSVAADLVVHAAGRGPDLDALDLAAGDVAARDGRLQLNDHLQSVSNPRVYAAGDAAGVGPPLTPVSSHDAK
    VVAANLLDGPSHRPDYRGVPSVAFTVPAIAAVGLSEDEAHRQGLRFRVNAASTPDWFTARRLAERVYGHKVLIEEATDRI
    LGAHLVGPHAEEVINLFGLAIRHGLTAADLRSTMFAYPTGASDVSSML

    >gi|197104990|ref|YP_002130367.1| hypothetical protein PHZ_c1527 [Phenylobacterium zucineum HLK1]
    MTANLYGIRNCDTMKKAWTWLDQHGVPYTFHDYKKEGVDRAALEGWVRQVGWETLLNRAGTTFRKLPEADRQGIDEAKAI
    SLMLAQPSMIKRPVLAAKGRLLVGFKPAEYEALFG

    >gi|197105011|ref|YP_002130388.1| peroxiredoxin [Phenylobacterium zucineum HLK1]
    MHRLVAAAALCAVIATPAAAALKPGDKAPDFTAQGYQAGKPLTFSLAEARKKGPVVLYFFPAADTKGCNIEAKMFADAIP
    QFQAAGATVIGVTAGNLDKLQQISSDTDKCSGKFPVAADPGAKIAKQYDAVLAMKPDWSDRTSYVIAPGGQVIHTYSKLD
    PSEHVSQTLSAVKGWKAAKK

    >gi|197105092|ref|YP_002130469.1| rhodanese family protein [Phenylobacterium zucineum HLK1]
    MDPLVSTDWLDERLHDPAVQVADATWYMPGEGRTGRQSFEEAHIPGAVFFDIDEVADKDTDLPHMLPSAEAFAQAVGALG
    LRRDAVVVVYDAQGLFSAPRVWWSLRTMGFPDVRVLDGGLKKWRAEGRVVTDEPGAPPPQALDAAFRPDLIRDLEAVRGH
    LAAGDAQVLDARAAARFRGEAPEPRPGLRSGAMPGALNLPWQGLVNSDGTLKSAAELREAFTAAGVDLGRPVVTT
    CGSGV
    SAALLAFALARLGREDVAVYDGSWTEWGGRADCEVVVAR

    >gi|197105099|ref|YP_002130476.1| hypothetical protein PHZ_c1636 [Phenylobacterium zucineum HLK1]
    MTRPAIAPDTDSVTVAETGVGRFQVEVLAAGSAFLADEPVEAGGLGSGPTPYDLLASALGACTAMTLRLYAERKGWPLTR
    ATVRVLHTRTPKGRDRFARELTVEGPLDDDQRRRLVEIAEK
    CPVHRTLEGRSEIITVLTAPPDLAARERSGEGHMHAMLE
    ACAD

    >gi|197105113|ref|YP_002130490.1| methionine sulfoxide reductase B [Phenylobacterium zucineum HLK1]
    MSANVDRRGFLLGASLVAIGVTPGSAGAADAWADSPFRRLTDAEWKRRLPGPAYRVLRHEDTERPGSSPLNREKRKGAYQ
    CAGCGLPLFKSDWKFESGTGWPSFYRAMPGAVATKTDYRIGIPRTEYHCARCLGHQGHVFDDGPRPTGLRY
    CNNGLALRF
    VPA

    >gi|197105178|ref|YP_002130555.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
    MANLEVTPQPRQRRPRPKVVTLTERAAERVREIMGKADKPYAGLRVGVKNGGCAGQEYVLEYAETADPMDEVVEDKGVTI
    LVEPKAVLFLIGSEIDYEVSKLSAKFVFHNPNETDACGCGESVTIQPAKLD

    >gi|197105202|ref|YP_002130579.1| pyruvate dehydrogenase complex, E3 component, lipoamide dehydrogenase [Phenylobacterium zucineum HLK1]
    MADAFDVVVIGSGPGGYVTAIRASQLGFKTAIVERAELGGICLNWGCIPTKALLKSGEVYEQLDHLKDYGLSVEKRGFDF
    EAVVQRSRKVAAQMNSGVTFLMKKHKIEVVQGTARLEKGSPAPTVVVGQRKLTAKHVILATGARARTVPAVGLEPDGERV
    WTYREALVPKAAPKSLVVVGSGAIGMEFASFYRALGSEVTVIEMMPRILPVEDEEISKTARKAFEKRGIRFRVPANVKKL
    TKGKGGVSLEIEADGKAETLQADVCIVAIGIVGNVEDLGLEALGVKIEKTHVVTDKHGATGVPGLYAIGDVAGPPWLAHK
    ASHEGVHCIEHIAGLKPTNLTAPIPGCTYTTPQIASVGLTEAQAKEQGLEPKVGRFPFRVNGKAVAAGEPDGLVKTIFDG
    KTGALIGAHMVGHEVTEMIQGFAMAMTLEATEAEIQATVFPHPTMSEAMHEAALDAYGRVLHI

    >gi|197105203|ref|YP_002130580.1| glutathione peroxidase [Phenylobacterium zucineum HLK1]
    MASIYDFTAETIDGAPAPLADHRGKVLLIVNTASKCGFTRQYEGLEALYRRYRDRGLVILGFPCNQFGAQEPGDAEEIRS
    FCSLTYEVDFPLMRKIDVNGPTAHPLYAFLKKEKKGVLGTEAIKWNFTKFLVDRSGKVVDRFAPTVEPKALEGAIEALL

    >gi|197105299|ref|YP_002130676.1| bacterioferritin comigratory protein [Phenylobacterium zucineum HLK1]
    MSDVIEGAPAPDFELETADGPVRLSDFAGKTLVLYFYPKDDTSGCTREAQDFTALAPEFAKAGATVVGVSKDSVKSHEKF
    AAKHGLAVTLGSDPEGAVIERYGSWVEKSLYGRKYMGIDRSTFLIRDGRIVRIWRKVKVPNHAQQVLEAVRAR

    >gi|197105307|ref|YP_002130684.1| protein-disulfide isomerase [Phenylobacterium zucineum HLK1]
    MTLTALKSAAVLAAALSLAGCQQQSDEAFGQRVRAYLLEHPEVLQEVSVALQQKQQAELAKASSDAIEKHRAQLERDPRD
    FVANPDGKITVVEFFDYN
    CAYCKIAAPEVVKLIQENPDVRFVFKEFAFQTPDSIEAAHIALTPQAKAKGLELHRLLMAQK
    PLNQAAIDRSLREAGVDPAAARAAAKDPAIERQLLDVRALAQALHIDGTPAFVVGDKVIPGADIEALRAAIAAAKATDLK
    RPSGNPS

    >gi|197105362|ref|YP_002130739.1| alkylhydroperoxidase AhpD core protein [Phenylobacterium zucineum HLK1]
    MTTRLNYVAVAPTALDAMMGLETAVRESGLEHSLGELVKTRASQMNGCAFCLHMHTQDARKAGESEARLHLLAAWRESSL
    YTPRERAALAWTEALTRVGDTGAPDADYEALEPHFSETEIVWLTMLIVTINGWNRLAVGFRSQHPRAWKAAA

    >gi|197105379|ref|YP_002130756.1| probable periplasmic substrate-binding protein [Phenylobacterium zucineum HLK1]
    MAGRAARGGRPGPAVPRERDRLRRPEARVSAQRIVSLLPSATEIVATLGLAGRLVGRSHQCDYPPEVAALPALSSTKVRL
    DGDSRDIHLSVEEILTRAVSVYDVDAARLRALRPDVILTQTQCAI
    CAVTPADLEDALRDWTGARPALVSLEPDDLSEVWG
    DMLRVGEAVGASDRARAAVEDLQARLEAIRARAATAGRRPRVAAIEWIEPLMAGGNWMPELVGIAGGESLFAQPGVHSPW
    LAWETLVGADPEVIVILPCGFHLPQGLKDLALLRVRPEWRRLSAVRRGEVYVVDGQHFFNRPGPRLVESAEILAEILHPG
    LFDFGHAGRDWLRAA

    >gi|197105432|ref|YP_002130809.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
    MTTTEDVTLSPAAAERIRALGEAEGRPVMLRVAVEGGGCSGFQYQFDLVDQPQADDLKVERDGAAALVDVVSLALLKGSE
    IDFVDELAGAEFRIRNPNARSSCGCGVSFSI

    >gi|197105444|ref|YP_002130821.1| glutathione peroxidase [Phenylobacterium zucineum HLK1]
    MTASAHEFSFTTIDGEPLPLTTFRDKVVLVVNTASQCGLTPQYDGLEKLYAEYRGRGFVVLGVPCNQFAGQEPGAEAEIK
    DFCETRFGVDFPLTAKVEVKGEGAHPFYRWAQEQLGEPAVPVWNFHKILIGKSGEALQAFGPRTDPLDSDITDAIERAL

    >gi|197105451|ref|YP_002130828.1| glutathione reductase [Phenylobacterium zucineum HLK1]
    MAGYDYDLFVIGAGSGGVRAARVAALSGARVAVAEEHRVGGTCVIRGCVPKKFMVYASEFAHHFKTAEGYGWTVEGARFD
    WPAFLAEKDKEIARLSGIYVRNLQNAGAELVHGKARLVDRHTVEVEGRGQVTADKILIATGGRPWMPKDLPGIEHAITSN
    EAFHIAELPKRIIIAGGGYIAVEFAGIFNGLGVDTTLVHRGPNILRGFDDDVRAHVAEEMEKRGIKVLLGTQHSAIEQTA
    TGLVSRLTNGMSPCESDLVLFALGREPYVEGLGLEAAGVELDARGAVKVDEYSRTSVDNIWAVGDVTDRINLTPVAIREG
    HAFADTVFNDRPTTFDHEMVASAVFSQPPIGSVGLSEAEARHSHGGKVDIYLARFRPMKYAFTGGDERCLVKLVVEQGTE
    KILGCHVVAPDAPEIIQMAAIAMKMGVTKPQWDSTCAVHPTLAEELVTLREKQAPPALGQVA

    >gi|197105717|ref|YP_002131094.1| methylated-DNA--protein-cysteine methyltransferase [Phenylobacterium zucineum HLK1]
    MIVQPPETLTLDRIATPIGTALVVTDEAGVLRAFNWTDYEDRMLAWVARRYPKAALVEGRSPARPALEAYFAGDLGALSA
    VPWDGAGTAFQRKVWAALCAIPVGETWSYARLAQAIGRPTAVRAVGLANGSNPVALVVP
    CHRVIGSDGSLTGYGGGLPRK
    RWLLAHEGASFRDRLAA

    >gi|197106064|ref|YP_002131441.1| thioredoxin reductase [Phenylobacterium zucineum HLK1]
    MSENAPRPEPRSVRCLIVGSGPAGYTAAIYAARALLKPVLIQGIQPGGQLTITTDVENYPGFADVIQGPWLMEQMQAQAE
    HVGTEIVNDIVVKADLSQRPFRLETDSGQTWLAETLIIATGAQAKWLGLESEQKFQGFGVSA
    CATCDGFFYRGKNVVVVG
    GGNTAVEEALFLTNFAAKVTLVHRRDELRAERILQERLFNHEKIEVIWDSAIDEVVGQTDPLGVTGVRLKNVKTGETREI
    PCDGVFIAIGHAPASELFKGQLEMDASGYLKVKPGTASTAIQGVYAAGDVTDDVYRQAVTAAGMGCMAALEAVRFLAEED
    HRKAHHPISHGEAQKIGAW

    >gi|197106185|ref|YP_002131562.1| alkyl hydroperoxide reductase, subunit c [Phenylobacterium zucineum HLK1]
    MSLINTEVKPFTAQAYKDGKFLTVSDSDLKGKWSVVFFYPADFTFVCPTELEDLADNYAEFQKLGVEIYSVSTDTHFSHK
    AWADTSPAIGKIKYVMVGDPSGVITNNFGVMREGQGLADRGTFLVDPDGVIQFMEITAEGIGRNAAELLRKVKAAKYVRE
    HPGEVCPAKWEEGEKTLAPSLDLVGKI

    >gi|197106186|ref|YP_002131563.1| alkyl hydroperoxide reductase, subunit f [Phenylobacterium zucineum HLK1]
    MLDDNLKAQLRAYLENIRQPVELVASLDDGAKSKELLELLEEIAAASDKVRVVTGGDDARKPSFAIVRAGTDVSVRFAGL
    PLGHEFTSLVLTLLWVGGHPPKVEPEVIEQVKALDGDFSFETYFSLS
    CQNCPDVVQALNLMSVLNPKIRHVSIDGALFQD
    EVEKRQVMAVPTVLLNGEPFAQGRMELGQILAKIDTGAQARAAEKIKGKDAFDVLVVGGGPAGAAAAIYAARKGIRTGLA
    AERFGGQVLDTLAIENFISVPHTEGPKLAAGLEQHVKDYDVDVMNLQKATKLVPAREPGGLITVELENGASLKSRTVILA
    TGARWRQMNVPGEDAYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLA
    SLPNVRIVTSALTTEVKGDGQKVTGLVYKDRNSDEVHNVDLEGIFVQIGLVPNTEWLKDSVALSPRGEIETDYRGQTSIP
    GVFAAGDATTTPYKQIVIAMGEGSKAALSAFDYLIRQPVPAQSQAAA

    >gi|197106269|ref|YP_002131646.1| cation-transporting ATPase, E1-E2 family [Phenylobacterium zucineum HLK1]
    MALTYEAAGGPDFSAFLKRREDGRATLDLLVRGARCAGCMSKIEREVQAVPGVASARMNLTSGKLAVAFKGASGDPAAVI
    GALEKLGYPATPYDPAQAQAAHDREGRRLILAMAVAAFGAMNTMMFSVPIWAGLFGQELGPATRTVMMWFSGAVGAPCAI
    YAGMPFFQSAWRSLKAGRANMDVPISIGVILTLVISFSETVLQGRDAYFDAAVSLLFLLLIGRWLDHQLRAKARSAAGDL
    LALQAPAAIRLDEAGGEHRVPLSDILPGDRLLVRPGERLPVDAVIEDGLSELDNSLLTGETAPAAVRPGQLCRAGALNLS
    GVLRLRAEARSEDSALSAIARLVEAGAQAKSKYVQWADKAAAIYVPVVHTVAALTFAGGWALGLGPREALIRAVAVLIVT
    CPCALGLAVPAVQITASARLFRKGVLVKSGAALERLAGVDHVVFDKTGVLTEGRPKLVDPAPAAVALAAPLARASRHPLA
    RALAAEAGEGAMASDVREHAGLGVEGLIGGRRARLGRASFVGVESHAAGETELWFGFEGETKIRFRFSDALRADAAETIA
    ALKARGLSVEVLSGDVPAAVARAAGAAGIAHWRGGLSPQDKAEAIDALAAQGRKVLMVGDGLNDAAALAKAHAAMAPGSA
    LEASQNAADLVFSGEGLSAVVEAVDLARTARKRAMENFGFAALYNVVAAPAAMLGFVNPFVAALAMSGSSLAVTLNALRT
    GARR

    >gi|197106452|ref|YP_002131829.1| peptide methionine sulfoxide reductase [Phenylobacterium zucineum HLK1]
    MLFAKKSLDLPTPEEALPGRPNAIPTAETHFVNGHPLKGPYPEGAEIAYFAMGCFWGVERKFWQVPGVWATAAGYQNGIT
    PNPTYEEVCSGRTGHAEAVMVVYDPKVVGYQDLLKVFWENHDPTQGMRQGNDIGTQYRSGIYVANDAQAQAAEASREAYQ
    QALARQGFERITTEIAPAGPFFFAEDYHQQYLAKNPHGYCGIGGTGVTCPIGVGVEA

    >gi|197106504|ref|YP_002131881.1| thioredoxin reductase [Phenylobacterium zucineum HLK1]
    MGDRILDCVVIGAGPAGLTAAIYLARFKRDFVVIESGASRAAWIPRSHNHPGFPDGVRGKTLLARMRRQAERYGAEIRRG
    RVETLSPLASGFKVETEAGALRARTVILATGVIDNAPDIPGLEHGVEKGLVRI
    CPICDGYEVTGCRVGVIGRDDHCANEA
    IFLRTWSDDVTHVHVGAEPLPPETLARLKTAGVQVIDSAIQGVKIGKRKVAAFDFGADEPRTFDVVYSALGVTPRAQLAV
    QAGARLDESGRLVVSDHQETSVPGLYAAGDVVRGLNQISTAEGEGAIAATDVHNRLRRAG

    >gi|197106769|ref|YP_002132146.1| hypothetical protein PHZ_c3308 [Phenylobacterium zucineum HLK1]
    MSKARISVLGLLASAGLVYGCATDDGAMSAAAHGTMAAATETASAPMPVTIDNFMLPDETLMGHELYRLADAKAIVIVTQ
    ANG
    CPISRTLAPHVRELKARYEGQGVEFLMLNSALQDSREAIAKEAAEFNFGIPVLLDSNQLVGEQLGVTRTGEFFVIDP
    KTWKVTYRGPLDDRFDYGVQKAKANHTWAADAIDATIAGRPALAASKQSPGCLIDFPERAKKAQHAKISYTTDVAPILEA
    KCVTCHQPGSIGPMALTSYEMVKGFSPMIREVIRTDRMPPWNASPHVGKFEDDKSLTKAEIKTLVHWIEAGAPRGEGPDP
    LALAKREAPEWPLGKPDLILEVPSYTIPASGVVDYQRPHIVNPLKEGRWIKASTFKVDQRQAVHHFLTGYMKDIPTGPAN
    ESRWGSSVGGYAVGSESVLWPTNVGTFLPPGGAIGIQAHYTPFGKEVTDKSKLGLYFYKDDEKPDLVMRGAVVIDNTIVI
    PPGASRHKEVAYLEFPKEALLYSAFPHAHYRGYASDLWLHYPDGKKEMLLSLPRYDFNWQRDYVFEKPIKVPAGSRLVAH
    YWYDNSKRNPANPDPTKEIVWGDQSWEEMFFTNVRYRWVDETAANPVNYDELMNQTRMLGMLDDNLDGKLQKAELKGEMG
    KRLLAYFGQIDRDSSGSIEKPELAAVQSMFGRRRNADQAQQQQAPAAPKPAAGGR

    >gi|197106798|ref|YP_002132175.1| 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase [Phenylobacterium zucineum HLK1]
    MAETTTYDVVIIGGGPGGYNAAIRAGQLGLKAACVESRGTLGGTCLNVGCMPSKALLHASELYAAAGNEFAKLGIEVQPK
    LNLGQMMQQKADSVGQLTKGIEFLFKKNKVDWVRGKGRIAGAGKVEVTAEDGAVTTLQAKNIVIATGSEPSTLPGVTVDQ
    QRIVDSTGALSLPEVPKHLIVIGAGIIGLELGSVWRRLGAKVTVVEYLDRITPGMDAEVAKTFQRSLTKQGFEFKLGAKV
    TGAKASKKGVTLTYEPVAGGAAETLEGDYVLLAIGRRPYTDGLGLESVGITPDKRGFIPTDHFRTSAEGVWAIGDVILGP
    MLAHKAEEDGVACIEMIAKGYGHVDYNLVPSVVYTAPEVAWVGKTEEQLKEEGRAYKAGKFPFTANSRAKINHETEGFVK
    VLADAATDEILGVHMIGPHVSEMVGEYCVAMAFRAASEDVARTCHPHPTRSEALRQAAMGVEGWTMQA

    >gi|197106881|ref|YP_002132258.1| glutathione S-transferase [Phenylobacterium zucineum HLK1]
    MDVYYSPLACSLASRIALYEAGAEARFHRVDTKAGRTEDGEDYRAINPKGLVPAIRTPEGEVLTENAAVLQYIADAHPAA
    RLAPQGFQRHRLQQWLNFIASELHKYVFTPLLSPRHDAAAKALARENAAERFAYLNDHLTGREWLLDEFSVADAYLAAVL
    NWAQAVQLDLDGYPAVIAYRDRLRARPAVARALGEEFAEYRKAA