Petrotoga mobilis SJ95 uid58747

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|160901555|ref|YP_001567136.1| RnfA-Nqr electron transport subunit [Petrotoga mobilis SJ95]
    MAQKSWIEIAKDNLWYNNPVFIQILGICSTLAVTNTLINTSIMTLGVVFVTGLSALTVSLLKSFIPRKVRMIAQTLIISF
    YVIIVDIVLRAYVPDVSRALGPYVGLIITN
    CIIMGRTEAFAQSNPPLLSLWDGLTSGIGYMYVLLMVAFVRELLGFGTVF
    GFQVLPDNFVNWTIMVMPPSAFFMLAIFIWILKGYQFRKEVKK

    >gi|160901556|ref|YP_001567137.1| RnfA-Nqr electron transport subunit [Petrotoga mobilis SJ95]
    MSPDVGLISLFFASIFTSNILLANFLGMCSFISVSKDFTSSNGLGLAVTFVMTITTAINWLVYHYLLIPFGLEYLRYIVF
    IIVIAAIVQISEMVIERMSTNLYMSLGIFLPLITVN
    CAILGVALFMQIRNYNFLQSVIFGLGSGLGWWLAIISLAAIRKK
    VDKSPVPGPLKGPGITLITIGLMAMAFMGFSGMLNVQ

    >gi|160901625|ref|YP_001567206.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Petrotoga mobilis SJ95]
    MRYLNFEIGDKIPEFSLKDADGDQINIKDFMGKWLVLYFYPRDNTPGCTKEAVDFSNYLEEFKKYNCQIVGVSPDTAEKH
    ANFKEKNDLKVILLSDPEHSILEKFGVWQLKKNYGKENWGVVRSTILIDPNGIIKKVWENVRVKDHVLEVLESLKELSNN
    RE

    >gi|160901870|ref|YP_001567451.1| formate dehydrogenase, alpha subunit [Petrotoga mobilis SJ95]
    MVVTINHNDYEAEPGQTILQVAKQNGIYIPTICHSPHLSDVGSCRMCLVELENNRKLVASCVTPVTDGMKVLTDSERVIE
    ARKTVVDLLVSDHPMDCMT
    CEANGNCVLQDLAYEYGIKESTFGTKKLPRFEIKAQNEFIQLDPDKCILCGKCVRTCKEIQ
    MCNALDFVNRGFETKVSPPFDEDLGGKDSPCVFCGQCVEMCPTGALTYIPSKGKGRYYEFKKTITTCPYCGVGCQLELRT
    KNNKIIQVGSVYNENSPNPHGESCVKGRFGYDFVNHPDRLTDPLIKRNGHFEKVSWEEALDYVAEKLLNIRGKYGSDSIG
    GLSSAKCTNEENYIMQKFMRAVIGTNSVDHCARL
    CHASTVVGLGMAFGSGAMTNSISEIEGSDVIFVIGSNPTENHPVIG
    SKIKKAKKNGTHLIVADPRKIELSEIADISLHHKPGTDVALINGIMNVIVNEGLLDKKFIEERTEGFESYIKVIEGYTPS
    KVSQITGVPADKIIEAAKMFGLAEKAAIYFAMGITQHKYGTNNVLSLTNLALLTGNVGFESTGVNPLRGQNNVQGACDVG
    ALSDVYPGYQKVSDPKIREKFENYWGVKLTDREGLTLTEMFEEAGKKIKALYIMGENPFLSDPDQDHVKKALESLDFLIV
    QDIFLTESAQFADVVLPAASFAEKEGTFTNTERRIQRVRKAVNSPGRAKADWEILTKLANKMGYEMKYNSPSEIMDEIAQ
    VSKLYGGISYERLEKGGLQWPCPDVNHPGTKYLHKDGFSRGKGKFFPVEFAPPEKEADEKYNFTLMTGRMLYHFHTGTMT
    RRSYPIDKHEPDSYVEINIEDAKKLGIKDKDRVRITSPQGTVETYAKVGQRVQPGQLFMPFHYAESPANKLTNRVYDLKA
    KIPELKITPVKLEKVEKRVSRREVLIDERFTSIRRQE

    >gi|160901880|ref|YP_001567461.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Petrotoga mobilis SJ95]
    MEGRIPLIGEKFPEMKVLTTDGAKELPKDYKGKWLVLFSHPGDFTPVCTTEFVEFAKKHEDFKKINTELLGLSVDAVHSH
    IKWMEWIKDNLGVEITFPIIADTMGRVASRLGMVDPEKGSATVRAVFILDPEGTIRLIMYYPSEVGRYIEEIYRAVRALQ
    LADKNKVVTPANWPENSIFGSKVIIPPASTYAEAMKRKTSAEEGYDWWLKVKEVKE

    >gi|160901913|ref|YP_001567494.1| heavy metal translocating P-type ATPase [Petrotoga mobilis SJ95]
    MLKKEVILEGLDCANCAAKIEDEVNKLNGVKAYMNFMNKTLTLEIESEQEYKNILQQVKTIVHKHEPDVVVKEKSVNKSN
    KKVLILEGLG
    CANCAAKMEKEISGLEGVEFAAVDFVSKKLTLEISPKVNRSELNEKIEGIVKKIEPDVKVIFEENNSKTK
    INENNEEEEEGVNKKEIIRLVVGGAIFAVGIIFNFQNWLELTLFIISYIIVGGEVVLRAIKGIARGQVFSEHFLMSIATI
    GAFFVGEYPEGVAVMLFYLVGELFQDIAVGHSRKSISALMDIRPDYANLKVGDEIRKVSPEEVNIGDIIIVKPGEKVPLD
    GKVIEGNSMVDTAALTGESVPRELGPGDDVLSGFINKNGVLTIEVTKDYGDSTVSKILDLVQNASSKKAPTEKFITKFAR
    FYTPIVVFGALALAIIPPLVIPGATFSTWIYRALVFLVISCPCALVISIPLGFFGGIGGASKRGILVKGSNYLDALNNVE
    TVVFDKTGTLTKGVFEVVSINPQSDFTKEELIEYAAYAESHSSHPIALSILKAYNKDVDITKIEDYEEIAGHGIRAKVGG
    KEILVGNSKLMNKENIKYQEVETLGTVVHVAVDKKYAGNIVISDAVKEDSADAIKGLKALGVRNIVMLTGDSKAVGEKIA
    TQLGIDEVYTELLPTDKVEKIEALDAKKSHKGKIVFVGDGINDAPVLARADIGVAMGGLGSDAAIEAADIVIMTDEPSKI
    VTAIKVAKRTRKIVMQNIVFALGVKAIFLALGAVGVATMWEAVFADVGVAIIAILNAMRVMNTKSI

    >gi|160901938|ref|YP_001567519.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Petrotoga mobilis SJ95]
    MALKVGDLAPDFKLKDQNGDDNSLSGFKGKKVLLSFHPLAWTGVCETQMKNLDLKYDELGKLNVVPLGISVDASPSKKAW
    AQNMKINKLKLLSDFWPHGEVARKYGIFDEENGFSKRANFLIDEEGKIEFVKVYELRDQPDLNEIMNYIKR

    >gi|160901977|ref|YP_001567558.1| peptide methionine sulfoxide reductase [Petrotoga mobilis SJ95]
    MSEIPTDKAIFAAGCFWGVEYMFKKVAGVLDVVSGYTGGFVENPSYEQVCSGKTGHAESVLIVFDPNIVSYESLVRYFFE
    IHDFSQENGQGPDIGEQYRSEIFYINEEQKAIAEKVKDELIHRGLKVATKITKASEFYKAEDYHQNYYEKTGKAPYCHFR
    RRVFKNDYIKFLV

    >gi|160902042|ref|YP_001567623.1| glutaredoxin-like domain-containing protein [Petrotoga mobilis SJ95]
    MEKLMDKETQNKVREILEELTEPVQIFLFKNDGEYSEIVEQLLGELKELDDRIKVDTYHSDSEEINNYDIERDLFPAMVI
    LDSEGNDYGIRYYGIPSGYEFTTLLQNLIAVSNNSVTSFSDENKEKLSKIDKKMRIRVFVTPT
    CPYCPRAVFAAHQAAML
    NPNITGEMIEANEFDRISFEYGVSSVPHTVIEVKESEEWVKKGEFVGAYPENSFVEEVLKAVE

    >gi|160902043|ref|YP_001567624.1| thioredoxin reductase [Petrotoga mobilis SJ95]
    MFFNVEGANKKSEIKQQYDVVIIGGGPAGISAAIYALQGGASTLVIEKAIEGGQMNLTDIIENYPGFKTIKGEELSSLMK
    EHAEQFGADFYDGKVIELIDSLTADKDEDFHKMVVMENGKTIKSKAIIIASGSYPRKLGVKGEEEFSSRGVSY
    CASCDGH
    FFKNKKIAVVGGGNTAVEEAVYLSNIAKEVYIIHRREKLRADKLYQDRAFSRNNIKFKWNSVIEEIKGKDKVESLVIKNL
    KNDEVYEEPFDGVFVFVGLVPETSFLNKDLFDFDEYGFLITDENMETKVKGIYAVGDVRKKELRQIVTAVSDGAIAASHA
    IREYVNEDQISSTQSINLTK

    >gi|160902089|ref|YP_001567670.1| SoxR-reducing system protein RsxE [Petrotoga mobilis SJ95]
    MADLKNFTNGLIKNNPTFVQVLGMCPTLATTTSAENGLGMGIATLAVLTMSNIVISLIRKIVPKKIRIPIYIVIIASFVT
    MIDLIMHGLTYELWQTLGIFIPLIVVN
    CIIMGRAESFASKNGVLDSIFDALGIGLGFTGALVLLGSVRELLGNGTIFGFT
    VWGDALNLYLFILPPGAFITLGLLLGMFNSIGISRENKKKKAGAKK

    >gi|160902090|ref|YP_001567671.1| electron transport complex, RnfABCDGE type, A subunit [Petrotoga mobilis SJ95]
    MNLILLFISAALVNNIILTRFLGICPFLGVSRSKSSAVGMSIAVIFVMTIAGVITWLLNQILIMLGVEFLRTIVFILVIA
    VLVQFVEFFIKKSSPALYEALGIYLPLITTN
    CAILGIALLNIQTNYTFIESLVNSFASGLGFSLALIIFSSIREKMQLNN
    VPKPFQGTALALITAGLLSMAFMGFSGLVKL

    >gi|160902182|ref|YP_001567763.1| heavy metal translocating P-type ATPase [Petrotoga mobilis SJ95]
    MSEVKEKPIESTNSQEKFAANNKVSFSVQGMTCATCVKNVERALKKLDGVKYVSVNLATEKAIVISQEAIPMNEIKKAVA
    DVGYKVSEEMPTEDLIEKRFKESRKDMYISLAITIPLMVVMILSMSGVHVPFMLLIELIGGAATIFIPGRKTLKSAWIAL
    SHLHTNMDTLVSLGAISAWATTILAIVGLNILSFGTIASMLITLNLVGRYIEARMKHSASREIKLLLSMKVDKANVITDD
    GVVELPIETVKIGDLILVRQGEKIPLDGTIVEGQASINESMISGEPLPLLKSEKDPVVSGTIVESGLLKIKVEKVGEDTF
    LNQMIKLVEEASSSKVPIQALADRITLYFIPTVFLLAVLSGMIWFFQYETFQPFLINVSNVIPWVFTDAGPLSTAIFSFV
    ATLVIACPCALGLATPMALVAASSVSAKKGLIIKNGEAIQTAKDIDTILMDKTGTLTKGQPSVIEHNLDDETFLIISEIE
    KNSTHPLAKAIVEYAHEHIKNQNVEIEEIEEITGKGIVGTYKNNEYYIGKPRDPKPYQAFMENAETVIEVSKNEKIVGYI
    RIADEIKSDAVEAIKQLKEMGMEPIMVTGDNENTARAVAKKVGIDKVFANISPQNKVEIVRKYQIEGKKVGMIGDGINDA
    AALKSSDMGIAIGNGTDLAIESADVIISQGEISKVIDAINISEITFKKIKQNLFWAFFYNIIAIPLAMIGILHPAIAEVA
    MLFSSINVIYNSSRITKKL

    >gi|160902196|ref|YP_001567777.1| redox-active disulfide protein 2 [Petrotoga mobilis SJ95]
    MSLFEKKKKETTSCNGENHNIGGMPKPDHSKAGSASVKILGSGCPKCNQLEAATKEALQQLGMDMAIDHVTDFSEIAAYG
    VMATPALVVDGKVVSYGKVLKTKEVVEILQKVRS

    >gi|160902305|ref|YP_001567886.1| dihydrolipoamide dehydrogenase [Petrotoga mobilis SJ95]
    MYDVVVIGSGPGGYVAAIRLSQLGKKVAVIEKENLGGTCTNKGCIPTKAMLTSSHLYEEILKKSNKLGIKVGEVTYEISE
    IMSHMKKIVLQSKKGVEYLLKKNHIDLIQGVAEIIDKNHIKVGDKSIETQNIILAHGSEPVMFPPFDKIQGIWTSDDVFK
    MEHMPESILIVGGGVIGVEFATFFSSLGKKVYVVELLEHILPNDDKDVAEEAKKSLVKKGVEVFEKHKVVDIQKDEDAYV
    SKIDFNGETKEIKSSKILLAVGRRPVITQDVKNLGVEIEKGVKTDSKMRTNVENVYAIGDIRAHIMLAHVAMNEGIVAAH
    NIAGESKEMDYSAVPNIIFSNPEIATVGLKEEEIDPEKVIISKFPVSANGRARTMEERDGFVKIIADKETKKVLGVTIVS
    PNATDMIMEGVLAVKYGMIVEQLTDSIHPHPTLTESILGAEESVEGLAIHI

    >gi|160902306|ref|YP_001567887.1| alkylhydroperoxidase [Petrotoga mobilis SJ95]
    MKYEDLKFFFEKIVKYITKIIKGVISVSMKDSFQKAMDWMKEFSKTNPEQMKSFQNMMEAIEKEEGAVLDKKTKELIAVA
    LSIARNCEW
    CIACHVKFALEAGATEEEILEAAWVAVLMGGGPALMHAGLVLEALKDLK

    >gi|160902573|ref|YP_001568154.1| thioredoxin-related protein-like protein [Petrotoga mobilis SJ95]
    MKKFFVVSLFILSVITIFSVPLEEFVFENFNEAFEVAELTNKKVVVMFSSPTCPACTQFKETTLLDEEIQKWLRTEFVFV
    EIFPTTEKATFQGEEYNYGQLFYAFGARYTPTFVFFDEQQNPFGAITGGYPADIFIDILKYVSYEKNEEISLDKFIEDGL
    GKNIHILPKTLRLSKDQIERLLDLDPNSKVYEPGKNYDPYTNIVLLQNNTNEQNLENFYVKIFESKN

    >gi|160902723|ref|YP_001568304.1| glutaredoxin 2 [Petrotoga mobilis SJ95]
    MKAFYFKNKSCSVCKAFFPKFLEICYEYNIPYEIVEVTENQEKSAQLLVFTVPTIIFLDEEGKEVKRFAQYFGTNEIRNF
    LDRYFTILDQKSGRR

    >gi|160902795|ref|YP_001568376.1| methylated-DNA--protein-cysteine methyltransferase [Petrotoga mobilis SJ95]
    MKAVIGTPIGSVIIYVKNDKITKIRLTFQKEGWAARQKNKDFPSLDGSAARQKNKDFPSLDGWAAGRRGVNKNENYYNSK
    TKKHFDIIYAYLYGDLQKIPKEIFDFPGETAFVKRVYETLYNTKKGSVITYKELASKAGNPKAYRTVGNLMKKNPLPIII
    P
    CHRVIKSDGSIGKFTPTIKWKKYLLDLEKNLSEGGKNGFKRY

    >gi|160902872|ref|YP_001568453.1| YruB family glutaredoxin-like protein [Petrotoga mobilis SJ95]
    MQHVKVKVYTTPNCPWCRKAKSYFRELGIKFSEVDVSRDPKAAEELVRRTHQMGTPVIQIGSQYIIGFDKNKIDSMLGIN