Persephonella marina EX H1 uid58119

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225685405|ref|YP_002729767.1| thiol:disulfide interchange protein [Persephonella marina EX-H1]
    MKNSILGLLACFSFSFAGVLEQTGAKIVEEKDLGDISQIVIQFPDGRKEVGYITKDNKYLIIGNVIDAKTGENITAKKYR
    ELDKVDVSKVPLDEAVKLKFGKGTKKLIMVADPD
    CPFCKKAYQYLKNKDVEVYLFLFPLNIHPQAYDKSVKILCSKDPAK
    AYDKVESGNQLQVSKCKEGEDKLKRHILIANKLGVRGTPLFIDMQGHKINGLNIPELEEALK

    >gi|225849693|ref|YP_002729927.1| molybdenum cofactor synthesis protein 3 (Molybdopterinsynthase sulfurylase) (MPT synthase sulfurylase) [Persephonella marina EX-H1]
    MSFQFTEEQIKRYSRHIILPEVGGKGQQKLLDAKVLVIGAGGLGSPSLYYLAAAGVGTIGIVDFDVVDFSNLQRQILHST
    ERVGKPKVESAKMTLEALNPDVKVIAYNERIHKGNVIDIIKDYDVVLDGSDNFPTRFLINDACFFLGKPLVSAAILRFEG
    QLTTFDYRNKDESPCYRCLFPEPPPPGLVPS
    CQEAGLLGVVGGIMGTLQANEALKLILDIGEPLIGKLLVFDALTTEFNV
    VKLRKDKKCPLCGEKPVIKELIEYEQACDVHF

    >gi|225849697|ref|YP_002729931.1| alkyl hydroperoxide reductase, C subunit [Persephonella marina EX-H1]
    MSEVILVGQEVPDFEMETYEPETGKFGTFSLKKAKDEGKWTILFFYPADFTFVCPTELADLAEVYPKLKELGAEVVSVST
    DTKFVHLAWHRDEKLLENVKYPMGADPTGKISRMFGVYDEATGLALRGTFIISPEGKLVGSEVNFYNVGRNADELLRKME
    ANAYLIGHPDEACPAKWEPGKKTLKPSEELVGHVYEALNE

    >gi|225849706|ref|YP_002729940.1| hypothetical protein PERMA_0142 [Persephonella marina EX-H1]
    MFPEGADTFLKKRFNELIDPVKLILRKSGKDIDRDIEKVLESISTFSEKISIEINESLSCIDAPCISIQTTEKDFGIRFM
    GKPDGGEFKTFIDTIVMVSRNEYDLSERTVELIEQIDRPVEIKVFITNT
    CGWCPPAVLKSYSFAMVNEYITATAIDCYIF
    SDLAVKYNVATVPKIVINDKVEQIGLKDENQLLGSIFASIS

    >gi|225849726|ref|YP_002729960.1| putative lipoprotein [Persephonella marina EX-H1]
    MLRVLTAFLIIIGIFTASCQQKTEGGVSEKFKVDPEPVIKEAMKEKKFLILIFESEDCKYCTKLHKEVLNDLDFKQSLVK
    NKTAIAIINVYGEREVTDPETKQKMNEQALTFAYRVQGYPTIVVFDPAKDYKPIYTIPGYVEKRDFISLLDFLGSNCYQK
    VQYEKFVENGKSC

    >gi|225849898|ref|YP_002730132.1| copper-transporting atpase Ran1 (protein responsive toantagonist 1) [Persephonella marina EX-H1]
    MEKLSVLTASLFLIGGISWFFFGKKKEDSSPAEESIRKKENIELDISGMHCAGCAAGIEGTLRNLPGIISVSVNFATSKG
    YIEYDATKITKEDIIDRIRQLGYDASLNLEEFEKKRKG

    >gi|225849914|ref|YP_002730148.1| thioredoxin [Persephonella marina EX-H1]
    MAGKVCIVNESNWEQEVLNSELPVLVDFWAPWCGPCRLIAPVIEELAEELEGKAKICKLNTDENPNIAMKYGIRAIPTIM
    VFKNGQVVDTKVGVQPKEVLKSLLV

    >gi|225849923|ref|YP_002730157.1| bacterioferritin comigratory protein BCP [Persephonella marina EX-H1]
    MVKEGDKAPDFCLEGLDPEGNEKEVCLKDLLSEGKYLVLYFYPKDNTPGCTTEACDFRDNLNVIGDKAVVAGVSPDSIKS
    HKKFKEKYGLNFYLLSDPEKNVLQLYDAYGEKKMYGKVTKGVIRSTYIISPEGKIVKKWKNVKAKGHVQKVVEELERLIG


    >gi|225849948|ref|YP_002730182.1| iron-sulfur cluster assembly accessory protein [Persephonella marina EX-H1]
    MQSTVNFTVTETAANEIKKIADEQGIENPILRVRVVPGGCSGFQYAMGFDEEITENDKVVELENGVKIAIDEFSAPYIGG
    AVLDYVQDFMGGGFTIKNPNAANSCGCGNSFSC

    >gi|225849975|ref|YP_002730209.1| electron transport protein SCO1/SenC [Persephonella marina EX-H1]
    MRKILPVFFIILMFSYASDLHGSLKGFPKKLPDLKDLISDDGNSFDFSHFKGKVLLITYGYTSCPHVCPTILSYLKEVET
    VLNNRGYKGMFSIIFVSVDPLEDDTERLKSYKRFSGLEDFVFVTGDRKSLERVWRSLNVYVNDKGYTEMKHGDQTVKHRM
    IDHTAKLTIVDKKGYIREEFLGMYIPVEKVVEDVITLIEE

    >gi|225849991|ref|YP_002730225.1| putative thiol-disulfide oxidoreductase ResA [Persephonella marina EX-H1]
    MKGKAVSILIIFSVVLTLSFGKTAPDFSVKDENGKIVNRDDLKGKPTLLIFWGVLCHSCREEMPVLDRLYKKYGRDINFY
    AVVLGTKDLQKIKKVKKEWNFEIPVLIGNGDMMYKYKIIGTPMIIVLDRNTEIFRRLIGPQSEEKIEGIIKSLL

    >gi|225850116|ref|YP_002730350.1| dihydrolipoyl dehydrogenase [Persephonella marina EX-H1]
    MYDLIIIGMGPGGFEATLTALRKKLNIAIVEKSKVGGNCLNRACIPTKYFWTGAHQIEKLNVLDNYGIEIQNVSINFKKA
    WEGKEKAISFLRKSLNMLLKTKKVPVYKGRGRIIGQNEVEVIKEDGSKEVIKGENILIATGSIPVSVGNIIPDGNFVITT
    EDLLERTDSLPEEIIIVGGGVAGCELGYILSAYGSKVHIVELMDRLLPMPDIPEEVSRYLLRKFKKMKINTYFKTTLESY
    EIKDNRVFAKLSDGTQLTADKILLSIGRKPNTDIDTIGIQKDERGFIKVNKKMQTNFKNIYACGDVVNSPMLAYIASYEA
    KIAVDNITGKDVEADYSVIPYVLFSGFEIATVGLNEKQAKEKGIEVVTGYYPYTYNEKAVDEHESEGFVRLVFEKESKKI
    IGGTIVGTGASELIHIIQMAVKEEYTAEDIHNFIYFHPSLSEIFIYATYDIVAGKLF

    >gi|225850208|ref|YP_002730442.1| rhodanese domain protein [Persephonella marina EX-H1]
    MKKLKFLVASVAGSLTFSMAASAADFLIWVDDAHKLLGKPDVRFVDGDSPKKFKEGHIPGSVNAFAHDLHYLEDIRKCDG
    LPMCPDRAAEFIGKVLGIDNNTTVIAYDDGRGPNASGVWFFLSLYGVKDVKMMDGGFATWESKGYEVEKGEGKKPSPKTF
    KVNVNRDMIATKEEVLKAVEDIKKNGKNSQYFILDARRFAEYTGKKLLDALEKPGKHITVARGGHIPGAVFFEWKKVAGN
    SKGKPGKHLFKPLKKLKKAFYKKLGKKGLTPDKTVITY
    CHVGLGRGSFIYAALKLVGHKKAKVYVGSWDEWGNTPELPVE
    K

    >gi|225850209|ref|YP_002730443.1| hypothetical protein PERMA_0654 [Persephonella marina EX-H1]
    MEHIDHLLMGLLTGALFGIVLHKVGAIRYSRVEGMLLLRDLKIMKFAFMGIATASLIYGLADIFGFAEQANLIPRVMPYM
    GIAHVVGGFLFGIAMASAGFCPGTCVARVGAGKFISIAGVIGLILGIIIYANIQPMLVEVGILGSKEKITLHGVLGVPYG
    ALAVVWGVLFIIFALLADWLDPARKMGLDRTDENLSLTEKVIKGEWHWAVSGVLAGSIIAWATAQGEYLGFSGGALAFVG
    WMSHLIGYPISIVPKVNETILWHAGLIMGVIPGAFLSAIISRTFKFDPVPPAFAKGVAPFPWVRMILVFFAGIFLALGAM
    IGGG
    CTTGAFLSAYPTLSVGPMAMSATYFAVGVLTANLIYFGRWSRFIQAKKESDQVYD

    >gi|225850326|ref|YP_002730560.1| putative OsmC family protein [Persephonella marina EX-H1]
    MEKKAVVRLQDSTFTGEINGKSINLTETGMRAVDLMLISIGYCFGLTVEAYVNHKGYKIEDLQITVKGKKHEKENRYDSI
    TIEVSFRSDLTPEQIERVLTIGKRGCTVSNTMLKTPDIKTVYLENVNS

    >gi|225850343|ref|YP_002730577.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Persephonella marina EX-H1]
    MVYDLEYDVVVIGGGHAGIEAALASAKLGVKTALITLDKEKVGLMPCNPAIGGIAKGIVVREIDAFGGEMGKAIDATGIQ
    FKTLNTRKGPAVRSPRAQADKEEYRKYMVNKVLNTENLTVIEGEATDIYLKESSYEVEGVEVDRRLKIRAKSVVVTTGTF
    LDGVIHIGDKRIPAGRMDEKPSTKLPDFYRKLGFPLQRFKTGTPARLDKRTIDFSGLEEAPGDEPAPKFSFWTDPEHSYW
    FRKNQKEQIPCYITYTTPETHRIIRENLHRTALYGGAIKGIGPRYCPSIEDKIVKFENKERHTVWLEPETKNGISIYPNG
    LSTSLPEEVQWEMYRSIPGLENVVLLKPAYAIEYDIVPPTELYPTLETKRVKGLYHAGNFNGTTGYEEAAGQGLVAGINA
    ALRALGKEPFYIRRDEAYIGVMIDDLTTKGVIEPYRLFTSRSEYRLHLRQDNPVLRLYRKAYNLGMLSYEQFKAVEEIEK
    EIGRWLDIYRNERRKIVSKGETRSVSAYDLLKRPDIDVNKLKEYGFETPESDYVAEEIDINVKYSGYFERERKMNEKMRY
    LENIKIPEDIDYSQIAGLTKEVVQKLTAAKPLTLGHAARLEGITPAAITAIMIHLQKLKRLKA

    >gi|225850450|ref|YP_002730684.1| thiol peroxidase (Scavengase P20) [Persephonella marina EX-H1]
    MATTVTLKGNAVALAGPEINVGDRAPEAVVVASDLSEKTIGGATGKTQVIITVPSLDTPVCEAETKKFNDILAGLDVDVT
    VVSMDLPFAEKRFCESFNIGNITVASDFRYRDMEKYGVLIAEGALKGILARAVFVVNGEGKVVYKQIVPEITEEPNYDDV
    LACLKSL

    >gi|225850654|ref|YP_002730888.1| protein disulfide isomerase [Persephonella marina EX-H1]
    MNIKSIFSVFLLILFVSLPSFSDECKIKDVSPEKMESKLRSVLGNGKVISVSRAPVEDLYEVVIEIRNKRIPVYVDCSMR
    YLISGEIIDLKERRSLTRERAMELAKAMEEKKAKELEKRLGKKKVEKLKNVLGERIAGVNLVDISKIPKTTVTFGNSRAK
    YTIYVIDDPE
    CPFCAKFHDEMLKVLDKRNDVKFEIILFPLPFHKHAQTIAQRILCEKSLKKKREILEESFNAVKSKDQSK
    LSRLGKKCEKGKKIIEKHFEFAQAYGIGGTPTLIFPEGVVISGYMKADKISQVLDALK

    >gi|225850681|ref|YP_002730915.1| alkylhydroperoxidase AhpD core [Persephonella marina EX-H1]
    MAYIKLPELEEMDPEIQELAKEILKKTGKLGEIFQLLAIRKDIYFMTDNCVKTLLLKETELPYSTKERIALLISKENNCP
    M
    CVDVHKNIAKMLGMSEEQIEETLKGVDHINTTEEEKELLRFCIRASRKDNYKMTKEDIDRILSLGYTVTQLVEAITITA
    YFNYINTLSNVFGLGK

    >gi|225850694|ref|YP_002730928.1| rhodanese domain protein [Persephonella marina EX-H1]
    MRKFSSSNLIFLLIIGLGVTYYLYLKGYIFSDFQNLDPKSAYSLIEKEKDNVFILDVRTPQEYKEGHIPDSTLIPLDSLP
    NQIDKIPRDKKVIVY
    CRSGMRSASASRLLSSLGYDVYNIAGGIKSWRDEGLPVER

    >gi|225850718|ref|YP_002730952.1| putative bacterioferritin comigratory protein [Persephonella marina EX-H1]
    MAKDKRKKVGEIAPEFCLIEAEGKEVCLRDLLSENRHVLIYFSQTEEKRRCDRSECPLKENLEKVMNLGVTVVVIDPDPV
    EEHKRFKHDHDIKFLMLSDPDMTAIKGYGVYEKVDVHGIEKEKIVSTVFLLDPQGRIVQVWEPKVIEDNIDDIIKTVKKL
    RGI

    >gi|225850780|ref|YP_002731014.1| putative lipoprotein [Persephonella marina EX-H1]
    MRKIFFFLIVLPFFILSCEKKDHENNRDLHRYTLVDKDGNPVPLPEDKLIVLNFMAYSCSACMEEIPVMKKVIQEKKYRD
    RFQIIAMVIDSDKGDLSDPVFPIYPNHKQNFVRFPVPGTPTTYIITPEGKKLVTIYGAVTEENFRKYLDEALEKSKKILN


    >gi|225850786|ref|YP_002731020.1| thioredoxin domain protein [Persephonella marina EX-H1]
    MGYSIDVTDENFEKLVIEKSYEKPVVVDFWAPWCGPCQMLKPVLEKLSKEYDFILAKVNTDENSMTANQFGVSGIPDVRI
    FIDGKEVDRFVGALPEPKIREILSKHMKSEIDRYLEEAYMEYMAGNLEEAEKIYEKLMREHPENKKIILEAAKFYIKENK
    LDEAERLLSEIKEYEKEYFPKAQALKELITFKNWCENLTAENELDRLLKEGACSAIHEDYKTALEKFLKIVQIDKKYRDE
    AGRKAMVAIFNILGESDPLTREYRKKLAMWLY

    >gi|225850804|ref|YP_002731038.1| electron transport protein SCO1/SenC [Persephonella marina EX-H1]
    MKKLITLLSVLIFVTLSLSYQFYGLPYLQKIKDFTLTDHNGKKVKLSDFKDKIVLVFFGYTFCPDVCPATMLRIKETLDN
    LGDYKKYVKVLFISVDPERDTPEKLKEYVKFYDKDGTIIGLTGKPEEIKKVAKSFRAFYEKVPVKDNPDVEYLMDHTAFI
    YLLDNRGILKLIYTPRKDNPKRIAEDIIQMVKLLKMEK

    >gi|225851274|ref|YP_002731508.1| thiol/disulfide interchange protein [Persephonella marina EX-H1]
    MKKVLSVIIALFIISGISSGKGLKPYSFILKDENGRTVKLEDLKGNVVILTFWSTTCHTCREELPKLSKLAKEYQGKSVK
    FFGIVIDTKDISYIKDIKERWKFDITVLIGDSVVISKYRIIGTPITYILKKDLTIGKIIYGDYPVRKYRKIINKLLKEN

    >gi|225851292|ref|YP_002731526.1| uba/thif-type NAD/fad binding fold protein [Persephonella marina EX-H1]
    MFLDRETYSKIHISVNELKEKIDSGEDFILLDVREPQEYEFSRIREKEAMLIPLMKLPAVIDKLPKDKPIYIICRSGNRS
    LQATLWLMEKGFKNVKNVEGGILAWSEFIDPTVPQY

    >gi|225851420|ref|YP_002731654.1| thioredoxin [Persephonella marina EX-H1]
    MRDLTTLLLIATGFLLILIGSSMASIRWLDYQEGINEMKKTGKMMIIYIHSDHCQYCRKMEATTFKNRKVEEVLERFFVP
    VKVEKNSEEGLNVRKIYGYMGTPTFHFIQPDGKKVYSLFGAWNEKEFLEILRYFYEGHYREKTLTEYFMK

    >gi|225851455|ref|YP_002731689.1| hypothetical protein PERMA_1928 [Persephonella marina EX-H1]
    MLLFMISFSYGSGINWLDFNEGMRRAEKEKKLILLDIYAQWCHWCNVMENTTYSDKEVVHIVNRYYIPVRVDAEKYPEIN
    RKYNQGGLPSTVVLDWKGNVLWGGIYVPPDQMKGILNRFKSMNEDQIRRIVLKNREKKIKKLKRLERRLKEKSINKGSID
    KIFRYIKFKFDYEYGGFSGAPKFPVRELPYFLALRYLTGDKTAKGMLKKTIEGYMKLFDPVEGGIYRYAVTEYWTEPHYE
    KLLKDQAEVSILLFNIYSLFGDGRYLEYAERILSFCKNKLYDKETGLFFNSQGADIVDDEGRLLVPGEDFFIYGKEKREE
    IVRKIGYGPNIERDIYFPVNALISNALLHSYGYTGNVEDLSLGLDVLERILKEGFTENGVRYSPDRSSFLLSTQVYTVEA
    LLTAYQLTSEKRYLELSEKITGIVTDRYYSKKLGIYTDLKETGFNINRISFIDDIITLNYRFARVLLKLNLFTGSRIYLE
    KSRDILKRFPDRYGSVSGLAYYLYLYPPLAVHIIGMKEERNEYIRKAFKVFPYYVYPHFIENSDLNFIKKLGYEPQKITS
    AFVCNCCVCFKKIQDKRDIKDQILSIFSQYIPLEE

    >gi|225851475|ref|YP_002731709.1| hypothetical protein PERMA_1956 [Persephonella marina EX-H1]
    MKRFILTAVLFAFYMNISTAFENVSAEKFRELMKRKDVIILDVRTPQEYEKDGHIKGANLLPVQLFQYIYLAGLRDKDVL
    VY
    CRSGNRSVTASKMLEQMGLKKVYNLKGGIKEWKSKGFPVEYGWK

    >gi|225685395|ref|YP_002729761.1| hypothetical protein PERMA_A0033 [Persephonella marina EX-H1]
    MRVLLLVCFLIGSALAFDKPDKGWFFYEDPEKPKKETVKKVEKKIEKPKEKKKEKPKKVEKPKPKPQPQQVVKKKKEDKF
    VFPVRPDAPQPVKEFLLNPNRETAEKFLAWQYQYFQHLQKIGFALREAYLAKGPQVYPIRGYPESELASKLYFNDYRKHL
    IAKAIKRLKNRFGLIIFYSGK
    CKVCQQELPILLGLRQIYGITMRAVNVDGNMIDLPIKQVYNPQLAKQYGITRVPTVVAV
    LEKKDGTVKQSVVGVGLMTADTILSMITQFLILEGEIKGSELNFYFSRNVVNEVK