Azorhizobium caulinodans ORS 571 uid58905

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|158421859|ref|YP_001523151.1| putative molybdenum cofactor biosynthesis protein [Azorhizobium caulinodans ORS 571]
    MAFSADEIERYARHIVLHDVGGPGQQKLKAAKVLVVGAGGLGAPALLYLAAAGVGRLIIVDDDAVSLSNLQRQVIHRTAD
    IGRPKTDSAKEAVEALNPHVEVETHAVRLTPANALDLISRADVVLDGSDNFATRYLVSDACVLAKKTLVTAALGTFDATL
    TTISAHETGPDGTPNPTYRCLFPEPPPPGTVAP
    CAEAGVLGALAGIAGSMAALEAIRAIVGFGEGLVGKLLMMDARSMRF
    ETLSYGWDEDNPLTGTGARITDLSAHEKAA

    >gi|158421992|ref|YP_001523284.1| hypothetical protein AZC_0368 [Azorhizobium caulinodans ORS 571]
    MRPGRFMIHRRSRGVTHLFRSPVLVALFVALAAAATLAAAWFFQLVVGLAPCPLCLDQRLPYYTAVPVGLLLAFVGRSRP
    DLARYGLWLLAALMAVDAGIAIYHAGVEWQFWPGPTT
    CTGSTPPMVTDIMSALKTTRVPRCDEAAWRLFGISMAGWNAVI
    ALGLTGISLKGALARR

    >gi|158422007|ref|YP_001523299.1| AhpC/TSA family protein [Azorhizobium caulinodans ORS 571]
    MIVTFSICSLEASMTLRLGDTVPDFTAQTTEGPISFHEWLGNSWGILFSHPKNFTPVCTTELGQVAHLKGEFDKRNVKVI
    GLSVDTIENHPAWVADIKDATGANLNFPLIADSDKKVSDLYDLIHPNASDTATVRSVFVIGPDKKLKLTLTYPASTGRNF
    QEILRVVDSLQLTAQHSVATPVDWKQGDDVIIVPSVSDEAAKEKFPEGWKTVKPYLRVVRQPGTASA

    >gi|158422082|ref|YP_001523374.1| putative twin-arginine translocation pathway signal protein [Azorhizobium caulinodans ORS 571]
    MLARSCLRRMFPETFMLLHRRRFLEGVGLLALAGGVGLPLARLLGVSVDLISPAAAQTVEDAKLTAPAASPLPVKALGNP
    KAPVTIIEYASMT
    CSHCAAFATQTFPTLKTKYVDTGKVYYILREFPFDPVSTAAFMLARCVPDDKYFPMVETLFETQRSW
    AFGNNPAAGLLTVAKQAGMSEADFEKCLTDKDLAEKVQASAQYGNKELGVDSTPTFFINGKKIAGAISIADLDKELAPLL
    QGK

    >gi|158422110|ref|YP_001523402.1| alkyl hydroperoxide reductase [Azorhizobium caulinodans ORS 571]
    MPIQVGDSLPNVTFRVSTSDGPVPKTTDEVFKGKRVVLFAVPGAFTPTCHKNHLPGYVSRAEEIKAKNIDTIAVVSVNDP
    FVMGAWEQASGADGKVLFLSDGNGDFAKALDLFFDGSAVGLGLRSKRYSMLVEDGVVKVLNVEDVPSKADASSAQALLAQ
    I

    >gi|158422298|ref|YP_001523590.1| methionine sulfoxide reductase A [Azorhizobium caulinodans ORS 571]
    MFWSKKPLDLPTPETALKGRPDAIPTARLHHVNQNPLKGPYPDGFRTAIFALGCFWGAERAFWRTPGVWVTAVGYLAGLT
    PNPTYEEVCSGRTGHTEGVLVVYDPAVISYADLVKLFFESHDPTQGMRQGNDVGTQYRSGIYTSDPQEKAVAEAVKASYE
    AALKAKGFGPITTEIIDGGPFYFAEDYHQQYLSKNPGGYCGLGGTGVSCPIGVGVAAQ

    >gi|158422339|ref|YP_001523631.1| thioredoxin [Azorhizobium caulinodans ORS 571]
    MAVEKVSDQSFDADVLQSSTPVVVDFWAEWCGPCRMVAPVLDELSGELGDKVKIVKLNVDENPVTASKYGIMSIPTLLLF
    KDGKIASRQVGAAAKAKLASWIGSAA

    >gi|158422674|ref|YP_001523966.1| alkylhydroperoxidase [Azorhizobium caulinodans ORS 571]
    MSIEALKTQLPAFAKDVKLNLSALPREDSLTEQQLYGLLVACGYTTRNGTVAQALEAEAAPHLSPAALDAAKAAASIMAM
    NNVYYRFTHLASNKAYETLPAKLRMSVIGNPGVDKVDFELWSLAVSAMNGCGR
    CIDAHEAVLREAGLSEAQIQTAVRVGA
    IIASAAVALEAAGAGFPEAAE

    >gi|158422675|ref|YP_001523967.1| alkyl hydroperoxide reductase [Azorhizobium caulinodans ORS 571]
    MLGIGSTLPAFSVTGVKPGFNLHEENGQSAFETVTEASFPGKWKIIFFYPKDFTFVCPTEIAEFARLAGDFADRDAVVLG
    GSTDNEFVKLAWRRDHKDLNRLPIWSFADTNGSLVDGLGVRSPDGVAYRYTFIVDPDNVVQHVYATNLNVGRNPKDTLRV
    LDALQTDELCPCNREVGGDVLKVA

    >gi|158422709|ref|YP_001524001.1| methionine sulfoxide reductase B [Azorhizobium caulinodans ORS 571]
    MTQKDSPEKIERSEEEWRNALTPEQYRVMRQHGTERAFTGPYWDEKRAGIYECAGCGAALFNSETKYDSGSGWPSFYAPV
    RADAVKSVEDRSHGMHRVEIRCARCDGHLGHVFPDGPRPTGLRF
    CMNGTALHLSPADENTRDA

    >gi|158422772|ref|YP_001524064.1| thioredoxin reductase [Azorhizobium caulinodans ORS 571]
    MASHSKVIIIGSGPAGYTAAIYAARAMLEPILFEGIQPGGQLTITTDVENYPGFADVIQGPWLMEQMRAQAEHVGTRILS
    EHVASLDLSRRPFKMVTEGGETYVADVVILATGAQARWLGLGSEEAYRGFGVSA
    CATCDGFFYRGKDVVVVGGGNTAVEE
    ALFLTNFASKVTLVHRRDKLRAERILQDRLFAHPKVSVVWNAAIDEILGVSEPVSKVTGVRLKDVNTGAHAELATDGVFI
    AIGHAPSTALVEGQLRIKSGGYVWTAPDSTATSVPGVFAAGDVADDVFRQAVTAAGRGCMAALEAERFLAQHEVAEAAE

    >gi|158422785|ref|YP_001524077.1| putative thiol-disulfide isomerase [Azorhizobium caulinodans ORS 571]
    MNRMAAPEARGNRHTSDIVRTASAGPPMRDLTRRTVLCAGVAGVLLPALPVPLRAASEPPGQAILERTAAETLPSFTLPE
    LGGRDVALSAQAGRVVLVHFFATW
    CEPCREELPALSRLATDHPQDVTILAVDVGEVDLRVRRFFEGLPVPFTVALDRDRA
    VTRQWGISALPSTVILDRALRPRWRAAGDVAWDAPAARAVIAELLSSSSNPVPGAAAPEPSPSSGGLTQ

    >gi|158422787|ref|YP_001524079.1| selenide water dikinase [Azorhizobium caulinodans ORS 571]
    MVLILIANGSKSLSPKPACATGSLSRLRGRGGVGRGQNAPFVSRLPRPYQVAAHPLSRSTECPMSQPVTEQPFRLTSLAH
    GGG
    CGCKLAPSVLQELLAGAPAAQPYAQLLVGMETGDDAAVWDLDGETCIVATTDFFMPVVDDPDHFGRIAATNAISDVY
    AMGGTPIMALAILGMPLGKVDTGIVRKILEGGSAACAAAGIPVAGGHSIDSVEPIYGLAVIGTVRKALVRRNADARPGDA
    LILTKAVGVGVYSAAFKKEALSSDAYDEMIASTTLLNKVGSALAKDSAVHAMTDVTGFGVIGHALEVARGSKLAVTIEAD
    RVPLMAHAEALVRQGFVTGASIRNWASYGAEARLPADFPEWRRHLLTDPQTSGGLLVSCAPEEADRLVEEIQAAGYPNAR
    RIGAVTEGAVGLTVA

    >gi|158422872|ref|YP_001524164.1| BcpB protein [Azorhizobium caulinodans ORS 571]
    MLLQGLRKPSMLRARCGALTVRPEAGKPLAAVSGCATIGRVWIPSPGACQMSALDPAALPVPEDDGAADHLPGLELPIIR
    LMGTHGHPVDLSDLSGRAVVYVYPRTARPGEPPLEGWDEIPGARG
    CTVQSCAFRDHLEDLRAVGIEHVFGLSAQDTEHQK
    EVATRLNLPFPLLSDHGLQLARAIRLPTFEVGGLKLLKRLTLVVEDGAIAHTFYPVFPPEESARQVVEFFRTYDRG

    >gi|158422895|ref|YP_001524187.1| arsenate reductase [Azorhizobium caulinodans ORS 571]
    MMDVVIYHNPECGTSRNTLAQILNAGVEPHVIEYLKCPPSRVMLRQLVDRAGMTVRALLREKGTPFAALGLANPALTDDD
    LLDAMMAHPILINRPLVVSPKGVRLCRPSEEVLDLLPPQRGAFTKEDGERVVDDAGNRVTNS

    >gi|158422974|ref|YP_001524266.1| AhpC/TSA family protein [Azorhizobium caulinodans ORS 571]
    MRVSMRRLDRSRSIVATRSGTMTEQSVPPTGALPAGVQAPDFTLSATPDQTLSLSEMRGHPVILAFYPADWSPVCGDEMS
    LLNAVLPEFHRLGAQLVGISADGVWCHAAFAAERKLHFPLLADFEPKGEVARRYGVYRVQDGVADRALFVIDAEGVIRWS
    YVSPLGINPGADGILEALEKLSVRTEGAVS

    >gi|158423080|ref|YP_001524372.1| heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase [Azorhizobium caulinodans ORS 571]
    MSSALSRSRFRVEEMDCASCAAKIETAVRRLPGVTEVSISVTAGTMTVAHQDAPEDVVAQIERRVSGLGYPAKATTADAP
    PAPAGAPASACCGQGHDHHDHDHHDPDRHDHAHHDHGPHPHHGHGHDHHDHAPHERGGHEHSGDTAPAPLGRATPADNPP
    AAVPPARRWWQTGKGRLTLMSGAALAAAYGLGHLLPEWAGLIFTVAMLVGLVPIARRAFSAARAGTPFSIEMLMTVAAIG
    AVIIGATEEAAAVVFLFLIGELLEGIAASKARAGIQSLAALVPKTALIDTQAGTREVPADSLRVADLILVRPGARIPADG
    EIAEGESAIDESPVTGESTPVVKGQGAAVFAGTVNGDGALRVRVTAAAQDNTIARVIRLVEEAQESKAPTERFIDRFSRY
    YTPAIVLVAVLVAVLPPLLFSGDWQVWIYKGLAILLIGCPCALVISTPAAIAASLSAGARRGLLMKGGAVVETIGKVTVA
    AFDKTGTLTAGTPRVTDILPFEASEADVLRLAAALETGSSHPLARAILERAAEAGITPPGASEARAYGGRGVGGRVEGQD
    VFLGSPGAAAERTTVPVEARAQIEALNDAGKTVSVLVVDGRLAGAIAMRDEPRADALSGLRALRAAGITPIMLTGDNPRT
    AAAIGAQLGIEVRAGLLPEDKQRIVTELKRDGARVLKVGDGINDAPALAAADVGIAMGGGTDVALETADAAVLHARVSDV
    AAMVALSRRTMANIRQNITIALGLKLVFLVTTLIGLTGLWPAILADTGATVLVTLNALRLLRAPAAD

    >gi|158423370|ref|YP_001524662.1| dihydrolipoamide dehydrogenase [Azorhizobium caulinodans ORS 571]
    MAETSYDVIVIGGGPGGYVAAIRAAQLGFKTAVVEKKHLGGICLNWGCIPTKALLRSAEIYHYMEHAKDYGLSAEKIGFD
    IGAVVKRSRGVSQQLNTGVGFLMKKNKIDVIWGSATLTAPGKIKVEAAPDAPKGALGGGDYLGKHIIVATGARPRALPGI
    EPDKKLIWTYFEAMVPDRMPKSLLVMGSGAIGIEFASFYKTMGADVTVVEVMPQILPVEDEEIAALARKRFEKQGMKILS
    GAKVTGVTKQADSLTVHVEDSKGAKQDFQVERMISAVGVVGNVDGLGLENLGVKIERGIIVTDGYGRTNVPGVYAIGDVA
    GAPMLAHKAEHEGVICVETIKGLHTHPMDKAKIPGCTYCTPQIASVGLTEKKARELGRDIRVGRFPFIGNGKAIALGEPE
    GLVKTIFDKKTGELLGAHLIGAEVTELIQGFVIAMNLETTEEELIHAVFPHPTLSETMHESVLDAYGRVIHT

    >gi|158423431|ref|YP_001524723.1| OsmC-like protein [Azorhizobium caulinodans ORS 571]
    MPTRTINLPWVAPVSRITRYTGCGARPFRVARPNRRKEQRMKTQGSAVWEGGIKDGKGAISTKSGALSAYPYGFASRFEG
    KPGTNPEELIGAAHAGCFTMALSLILGEAGFTATHMETTAEVSLEKQSDGFAITAVHLTLRATIPGADAETFQQLAAKAK
    AG
    CPVSKLLKADISLDAALVA

    >gi|158423858|ref|YP_001525150.1| glutaredoxin-related protein [Azorhizobium caulinodans ORS 571]
    MPPQARCWGMGTGPTPANHSGPKTMSIRDFIDNEVKNNDVVVFMKGTPQFPQCGFSGQVVQILDHLGVSYKGINVLSSDE
    LRQGIKDYANWPTIPQIYVKGEFVGGCDIVREMFQAGELVPFFEEKGVALHDRAIG

    >gi|158423898|ref|YP_001525190.1| hypothetical protein AZC_2274 [Azorhizobium caulinodans ORS 571]
    MSRLPLRTIADAPEAARPFLETAEKNNGYLPNLLRVLANAPVALETYLTVSGINARASLNLSEREAVQITAAATHGCGFC
    VAGHTAIAEKKAHLPAETITALRGKAEVPDAKLDAVARFTESVIAHRGAVPEADLATFKAAGFSDQQALEVVLGVSLATL
    CNFANNLGQPPLNEQLAAYRWEPAKPVAAE

    >gi|158423958|ref|YP_001525250.1| glutathione reductase [Azorhizobium caulinodans ORS 571]
    MSRSVDLFVIGGGSGGVRAGRIAAQHGAKVMLAEEYRLGGTCVIRGCVPKKLFVYAGRYAHDLEDMAGFGWTVEGARFDW
    PTLIARKDQEIARLEGIYRRNLVAPGVEIVDGRAEIIGPNRVRLVATGEEIEAGHILVATGAHPALGPAIPGAERAITSN
    EAFHLPRLPPRILIQGGGYIAVEFACLFRALGSEVHLVFRADQILRGFDEDVRALVAQEMAHSGIVFHTGQTLTGITAEG
    GTKTVTLSDGSAIAVDEVMLAIGRLPNTSGLGLDAVGVATDKVGAVIVDADGRTNVPSIYAVGDVTNRINLTPVAIREGH
    AFADSVFGNKPWRVDHSLVATAVFTEPEVGTCGLSETAARAAGHAVDIYKSQFRPMRATLSGRETRMLVKLIVDQQSDKV
    LGCHVVGEGAGEIIQMAAIAMGMGATKADFDRTVAVHPTAAEELVTLRTKSA

    >gi|158424432|ref|YP_001525724.1| HesB protein [Azorhizobium caulinodans ORS 571]
    MAAHVDSAAGALNYPCNMQSTAERRGTTSMDTPTTVIVTDSAARRISEILSAEAPESALRVSVEGGGCSGFQYRFDVTRE
    RNPDDIVIEQDGATVLVDKVSLDYMSGCRIDFVDDLIGAAFKIENPHATASCGCGTSFSI

    >gi|158424450|ref|YP_001525742.1| rhodanese-related sulfurtransferase [Azorhizobium caulinodans ORS 571]
    MTATTFVSTEWLAANLGTPGLVVVDGSWHMPATGRDRRAEYEAAHIPGAVFFDLDGISAHDTDLPHMLPGAEAFAAAVGA
    LGISEKSRIVVYDAAGLFSAPRVWWTFKAFGATDVAILDGGLPKWTSEGRPTEQGTVTPAPQTFSAQLDASIVADISRIE
    RVLTDGAAQVLDARAAERFAGVAPEPRPGLPSGHMPGAFNLPVGKVVRDGRLVSPDEIRSAVAASGLDLSQPVITS
    CGSG
    VTAAILWVALETIGTRPQALYDGSWTEWASRGKPIAVDPK

    >gi|158424601|ref|YP_001525893.1| organic hydroperoxide resistance protein [Azorhizobium caulinodans ORS 571]
    MSVDVKYTTKATANGGRDGRSVTEDGKLSVKLDTPKELGGAGGEGTNPEQLFAAGYSACFLGALKFVAGLEKVRIPAEAT
    VTATIGIGPRSEGGFGITAALAVSLPGIERAQAEDLVAKAHQV
    CPYSNATRGNVDVGLTVV

    >gi|158424635|ref|YP_001525927.1| ArsC family protein [Azorhizobium caulinodans ORS 571]
    MADTLTIYGIKNCDTMKKARAFLEEKGAAYAFHDYKTAGIDRKRLEGWIGAVGWEPLLNKAGTTFKKLPDADRADLTQEK
    AIALMLAQPSMIKRPVLEKDGGILVGFKPADYEAFIA

    >gi|158424696|ref|YP_001525988.1| putative outer membrane protein precursor [Azorhizobium caulinodans ORS 571]
    MERPMLSRTGLRAALAAVAALGLTATTVLPAAAFTDQEKAELGPLIRDYLLKNPEVLQEAIAVLEKRQGEAEAQARAKTL
    ASIKPKVFDSPRGVVIGNPKGNVTLVEFFDYN
    CGYCKHTLSDINALVKNNPNLRVVLREFPVLGPGSVEAAQVAVAVRMV
    APDKYKAFHDALLSGRGQADRARALAAAKEVGIDVAQLQKQATSPELNATLDESMEIAQALGLNGTPSFVIGDEVIVGAV
    GLEKLQEAVTKNGKTAAN

    >gi|158425027|ref|YP_001526319.1| rhodanese-related sulfurtransferase [Azorhizobium caulinodans ORS 571]
    MSSSAFETPVVSTEWLAAHLGEGDLRILDCTWHHPSTNLDGRTQYRGRHLPGAVHFDIDQVADKTNPLPHMLPKEEDFAA
    KMGLLGVGTGDRAVVYDRLCGGAAAARAWWMFRVFGHENVALLDGGYAKWAAEKRPAEMAPVRPEARSFTAGFNPALLRT
    LDQMKANLASGAEQVLDARGPGKFDGTQEDVYAFAKRGHMPNAVNVPWGDLVDTQTGALVAPEAISARFAAAGVDLDRPI
    VTT
    CASGILAPMLSLALKLLGREAPVYDGSWAEWEKAADAPVAAAA

    >gi|158425033|ref|YP_001526325.1| iron-sulfur cluster assembly accessory protein [Azorhizobium caulinodans ORS 571]
    MINLTDSALNAVRTAIGSAGGPVGGLRIQVEAGGCAGYKYQMGLVVDAEPDDTVIEREGVKVFVDNKSHEYLAGTTIDFV
    VALEGSGFTFDNPNANNSCSCGKSFG

    >gi|158425040|ref|YP_001526332.1| HesB/YadR/YfhF family protein [Azorhizobium caulinodans ORS 571]
    MNFQMTPAAERFIRLMLRADGNAASGFRLVLSPGGCSGLSADISVTPAPASGDAVVEKNGVRLFLPAESRILLEGVTIDF
    ADTASQTGLVFRDPKATGTCSSHGTVQLS

    >gi|158425062|ref|YP_001526354.1| glutaredoxin-related protein [Azorhizobium caulinodans ORS 571]
    MSTSDRINGLISENDIMVFMKGTPAMPRCGFSGAVVQILNTLGVPYATLDVLEDPFVREGIKEFTNWPTIPQVFVKGEFI
    GGCDIVREMAQKGELQALFSEKGIAPRAA

    >gi|158425063|ref|YP_001526355.1| rhodanese-like protein [Azorhizobium caulinodans ORS 571]
    MTFRVPFRRIHPGEAEVLLRRDDLLVFDTRDACSYEAGHMPGARRLSQANLSEIILATPRHHPVLIYCYHGNASQEYAQT
    FADFGFQDVSSLDDGYEGWRTRGATHAMPDIDADLAAWLVAHGFPADDVDAVIDNGTTPLMKAAHTGDTEALCQLIAAGA
    HLDLRNADGNTALWLACVGRHLDAIDMLVAAGIDIDNQNDNGATALMYASSAGLGPVVGRLLARGADAELETLDGFTALD
    LAGTVECLALLRPARQAAG

    >gi|158425065|ref|YP_001526357.1| nitrogenase-associated protein [Azorhizobium caulinodans ORS 571]
    MARVIFYEKPGCGTNGRQKRLLEQAGHEVVARSLLSEPWTGERLAAFFGDMPVPARFNPAAPGIKSGGVDPRAFSAEQAL
    ALMLEEPLFIRRPLLEVEGVRCAGFEGPLVARLLGPASGDAPQGCSRPEVGACPTPAEAVAP

    >gi|158425121|ref|YP_001526413.1| thioredoxin-related precursor [Azorhizobium caulinodans ORS 571]
    MDQENRMPLSRRTFALASLSLPLAVAAAPAFAAAFQPYTPAAFAAATKAGGPVFVHVYAPWCLQCRAQEGILSRLVNDPK
    YAKATFLRVAYDEQKDVVAKLGVPRSTLIAYDGSKETGRMSWGVTEADVVKVLDSAY

    >gi|158425217|ref|YP_001526509.1| glutaredoxin-related protein [Azorhizobium caulinodans ORS 571]
    MNERWVLITQPRCRPCEEAKQMLTERGIPFVAFDIVERPDMRDFLKTLLPNPTTPQVFRDGTRIGGRDDLREYFRAADLC
    ERF

    >gi|158425233|ref|YP_001526525.1| HesB protein [Azorhizobium caulinodans ORS 571]
    MRNVSAGLEPAWFGEKFMAPRPRPAVMRITEAAAARVRQIMARTDPPPVAVRVGVKNGGCAGMSYTMDYATEILPTDEVV
    EDKGVKVIIDPKAVLFLLGTEMDFKTDKLASQFVFNNPNQTSACGCGESVAITPAKEDALSL

    >gi|158425246|ref|YP_001526538.1| putative bacterioferritin [Azorhizobium caulinodans ORS 571]
    MRLYDVVTSKGRQMSQIPAIGTPAPAFTLPRDGGGEVSLKDFAGRKLVLYFYPKADTPGCTKEAIAFNGLRAEFAAADTA
    ILGVSADAVKAQDKFKTKYTLEFPLGSDETHAMLEAYGVWAEKSMYGKTYMGVSRATLLIGRDGKVAQVWPKVKVDGHAE
    DVLKAAQALD

    >gi|158425276|ref|YP_001526568.1| rhodanese-like protein [Azorhizobium caulinodans ORS 571]
    MSEINPFGGRVVHLTPADVKAGLEDGTILLVDVREPNETTAERIPGSVLFPLQTFDASALPDPQGKRLVFSCRSGQRSQK
    ALALAQAAGLPYEEHMQGGILGWKEAGFPTDVG

    >gi|158425306|ref|YP_001526598.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Azorhizobium caulinodans ORS 571]
    MMARNVRRGRTPVLDLTAQTTLPLELPRPLAGMVAGPAAALDICAADYDVVRRAVAYVTHHVRDQPEVEAIAAAAGVTPR
    ALTDLFRRWCGLTPKAFLQAVTLDRARQVLAECPNVLDAALELGLSGPGRLHDLFVVHEAMSPGEWKTGGAGLVIRYGLH
    PSPFGTALAMCTPRGLCGLAFADAGEEEAALADMRRRWPYATYLEDPTATAPLVSRIFNPEAWREEQPLRIVFIGTDFEI
    RVWETLLRIPMGRATTYSTIAGHVGKPSAARAVGAAVGKNPISFVVP
    CHRVLGKNGDLTGYHWGLTRKRAILGWEAGRIG
    TEG

    >gi|158425393|ref|YP_001526685.1| hypothetical protein AZC_3769 [Azorhizobium caulinodans ORS 571]
    MSEVVHTFTTKVPRWRPYVTPVRLEEATEEQREAMKITPSNTKVSDYVLTLAHDPESLAVRSPLFNAIMYGDDGLSRAER
    ELGAVGASVVNRCVY
    CAAVHASRYNQLAKAPEVIKAIFAAETKAELEPRNQAIFDFAVAVSNTPPEAAADHIAALREQGL
    TDLEQVDLILSAAIFGWANRLMHTLGEPVAT

    >gi|158425581|ref|YP_001526873.1| putative glutathione S-transferase [Azorhizobium caulinodans ORS 571]
    MGRMVDGVWHGQEDFPTDAGGRFTRPDSVLRHWVTADGSPGPMGAGGFKAEPGRYHLYIARACPWAHRAMIFRTLKGLED
    AISFSVTHWLMAEEGWTFHPGPGVIPDPNEGVTRMHELYARSDAAYSGRVTVPVLWDKQTRQIVNNESADIIRMLNSAFD
    GVGAKPGDYYPAELRAEIDAVNDRVYKTLNNGVYRCGFATTQAAYEEALAPLFETLDWLEERLSRQPYLMGDRQTEADWR
    LWTTLLRFDLVYVGHFKCNVRRIVDYPALWAYTRALYQVPGIAETVDVFHIKHHYYESHRGINPRGIVPVGPEVDFTAPV
    ERPAA

    >gi|158425633|ref|YP_001526925.1| dihydrolipoamide dehydrogenase [Azorhizobium caulinodans ORS 571]
    MANYDLIVIGTGPGGYVAAIRAAQLGLKTAVVEKRATHGGTCLNVGCIPSKALLFASEKFEEAGHSFASMGITVPAPKLD
    LAAMQAFKDKGVDGNVKGVEFLLKKNKVDAYHGVGKILAPGKVEVTAADGTQQVLETKNILIATGSDVAQLPGVTIDEEK
    VVSSTGALALKRVPGKLVVVGAGVIGLELGSVWRRLGAEVTVVEYLDRILPGMDGDVAKSFQRILQKQGFAFKLGTKVTG
    VDTKGKTLKVSVEPAAGGAAEVLEADVVLVAIGRVAYTGGLGLAEIGVETDKRGRVVVDHHYKSTVDGIYAIGDVIAGPM
    LAHKAEDEGVAVAELLAGKAGHVNYDVIPGVVYTFPEVASVGKTEEELKEAGIAYNVGKFPFTANGRAKVNNTTDGFVKF
    LADAATDKVLGCHIIGPEAGEMIHEVCVLMEFGGSSEDLARTCHAHPTRSEAVKEAAMAVEKRAIHM

    >gi|158425881|ref|YP_001527173.1| thioredoxin precursor [Azorhizobium caulinodans ORS 571]
    MLFNQAGGAQTAAQGAGDGLVIDTTTQTFMADVIEESRTRPVLVDFWAPWCGPCKTLGPVIEKAVRSKKGKVLLAKMNID
    DHPAIAQRLGIQSIPAVYAFVNGQPVDGFMGALPEGQVNDFIERLTGADAGIAEILEAAEQALAEGDAVGAGNAFAQILA
    EEPDNLKALSGLARAHVLLGDLEQAEATLAGVPANKANDPAVASARAAIELARQTADLGETAELEAAVAADPANHQARFD
    LALALAAGGKREDALVHLLEIVKRDRSWNEDGARKQLVQLFDAWGPTDPLTVTGRRKLSAILFA

    >gi|158425918|ref|YP_001527210.1| heavy metal translocating P-type ATPase [Azorhizobium caulinodans ORS 571]
    MAHEHHTHGSNADAGSCCGGKAPAPLDLAPKAASPAAGDCCGGAAPPPLVLPATGAPEADCCGGNAPPPLDLSPKAIDPV
    CGMSVDIATAKHRATYQGKTFYFCCNGCKTKFEADPEAQLAKAKARDEAKAAQKTEASACCGHDHGHAHHAPASGALVKD
    PVCGMDVDPATAKYKSHHGGHDVFFCSPSCKTKFDAHPEHYTDGGAPPPVDVPEGTIFTCPMDPEIRQIGPGT
    CPICGMA
    LEPEVASLDDGPNVELIDMTRRFWIGLALALPVFVLEMGSHLGLHLIAPQVSNYVQFALASPVVLWAGWPFFQRGVASVR
    SGHLNMFTLIALGTGVAYLYSLAGTFLPGLFPNAFRGHGGAVPVYFEAAAVITVLVLLGQVLELRARAATSGAIKALLGL
    APKTARRIAADGSEADVAIEEIHPGDLLRLRPGEKVPVDGTVEEGRASVDESLVTGESLPVTKETGATAIAGTLVASGGF
    VMRATKVGRETLLAQIVQMVAQAQRSRAPIQRLADQVSGWFVPAVLAAALASFAVWMWVGPEPRLTFALMAAVSVVIIAC
    PCALGLATPMSIMVGVGRGAQAGILIKSAEALERMEKVTVLVVDKTGTLTQGKPKVTGIRATGLPEDELLRLAASLEQAS
    EHPLAAAVVAEAQARGLKLAPVADFDSPAGKGVSGTVEGRRLLIGNADYLRDSGVPTDAQVKEAEALRAEGATVVLVAVD
    GTAAGLIAIADPVKATTPDALKALKAEGVRVVMLTGDTRTTAEAVARRLGITEVEAGVLPDRKADVVQRLRAEGEVVAMA
    GDGVNDAPALAAADVGIAMGTGTDVAMESAGITLLKGDLAGLAQARSLSRATMRNIRRSLFFAFVYNAAGVPLAAGILYP
    VLGLLLSPMVAAAAMSLSSVSVIANALLLRRWRPQ

    >gi|158425920|ref|YP_001527212.1| glutaredoxin [Azorhizobium caulinodans ORS 571]
    MKSIVIYTKSWCSYCHAAKELLRRKGWTFTEIDVTTDPAGQQEMSKKAGGRTSVPQIFIGDTHVGGCDDLYALEDAGRLD
    ALMAA

    >gi|158426079|ref|YP_001527371.1| thiol:disulfide oxidoreductase periplasmic protein [Azorhizobium caulinodans ORS 571]
    MTTPETPRRRRPLFVILPLAVFLALAALFFVRLFAGDPSRIPSALVGKAAPAIDLQPLAGLSGSSGPVPGITSAQLKGKV
    ALVNVWASW
    CVPCREEHPVLMGLSRDPRILLVGLNYKDQPDNARRFLGTFGLPYAAVGVDASGRSAIDWGVYGVPETFVL
    APDGTIAQKFVGPLSEQTVREQLMPLIERLSGKPAA

    >gi|158426133|ref|YP_001527425.1| alkylhydroperoxidase [Azorhizobium caulinodans ORS 571]
    MTPGNDEIMTRWPLMAKKTTTAAKLSTPDKGVEKPNNLSATPKKASSGKRFQNTATQHPERKQAALRGTASKAAGVPAAE
    PVIALDLPMAPLDAPTQAYFDKCVEKIGFVPNVLKAYAFDLAKLGAFSAMYNDLMLAPSGLSKLEREMIAVAVSAVNRCY
    Y
    CLTAHGAAVRALSGTPELGEQILMNYRAARLDARQRAILDFAVKLTETPHLVEEPDRTALRDAGLSERDIWDVAAVAAF
    FNMSNRVASATDMRPNPEYHAQAR

    >gi|158426153|ref|YP_001527445.1| ATPase [Azorhizobium caulinodans ORS 571]
    MTTGAFRMSQAVDYSIFMAKDADGRSQMSLAVDGIDCAACIADIENGVMSLPGVVHARLNYSTHRLTVEWEGEGEPDALV
    HRLENLGYRAHPFLGRAEEAEAKRAQWLLRCLGVAGFAMMNVMLLSVSVWAGNVTDITPETRDLFHWISALIALPAAAYA
    GQPFFQSAWRALRTRSLNMDVPISLGVILALGMSVVETILHQEHAFFDSAVMLLFFLLAGRYLDHEARRRTRAVAGNLAA
    LRGEMAQRLDAQGTPVLVPVQALKTDDLILVPAGERVGADGVVVRGRSAIDEALITGETLPRAVAAGDRLYAGSLNGAGS
    LTVRVTAGGEGTLIDDVQRLLDGALSQRTGYVRLADRVARLYAPVVHLTALLSAIGWLVLGASAHDAVMIAVAVLIITCP
    CALALAVPAVQVVATGRLFRAGLLINAGDMLERLASVDTVVFDKTGTLTLPEPALRLPPDADPELVALAARLALSSHHPL
    AAALSRYANGPAFTTVDEVAGMGVTTTLDGIELRLGSLAFCDTHLPEDFPLTATPISLRAGTRTLVIGIDQALRGDAAQI
    VSDLKQRGLAVHIFSGDRFGPVAAVAGALHVTDFRAEMRPADKIAELERLQAAGRRVLMVGDGLNDAPALAAATVSLSPA
    SGVAVTQAQADAVFIGTRLAPVRAALDGARTAARLMRQNLGIAVIYNLIAVPLAVLGHVTPLVAALAMSGSSLIVTLNAL
    RAARPGRDDAATELNALHLTPAEARP

    >gi|158426174|ref|YP_001527466.1| arsenate reductase [Azorhizobium caulinodans ORS 571]
    MRQGMQDAWEVGSTMSDFPVTIYHNPACGTSRNTLAMIRAAGYAPTVVEYLKTGWTQDQLKGLISAMGGTARDILREKGT
    PAAELGLLVPEVSEADLLAAMVAHPILVNRPIVVTPLGTRLCRPSERVLDLLERKPDSFTKEDGEVVALKP

    >gi|158426287|ref|YP_001527579.1| putative thiol-disulfide isomerase [Azorhizobium caulinodans ORS 571]
    MTDANLPRPDDAPGAPPAKTPTAAAGKPGRMIGLVAGAAVLGAVTGALALYGMNGLKGNASATKPLPDGTVPAATAAISD
    PDCAGAVATAKRLAPFAKGELAALSLATEPRRLPPLTFTDGAGKPVTLADFKGKTLLVNLWATW
    CVPCRKEMPALDTLEK
    EQGSADFQVLAINLDTKDPKKPRAFLDEIGVSSLAFHADPETKTFQALRSVGRGFGLPTTLLVDAKGCEIGYLAGPAEWA
    SEDAQTLIRQAVGKGV

    >gi|158426299|ref|YP_001527591.1| glutathione S-transferase [Azorhizobium caulinodans ORS 571]
    MIQLYHHPFCPHSRFIRLLLAEYGIEPELIEVRVWERDPDFLALNPANETPVLTEEHVPSAPGASIIAEYLDETRGLALA
    DRRLLPHAPLERIEVRRLVAWFHEKMFLDVTEHLVRERIYKRYMRANQGGGPPDATALRAARSNIRYHLKYIGWLAKARN
    WLAGERLTHADLAAAAHLSVADYLGDVPWDEDEDAKAWYARVKSRPTFRGILADTMPGMPPSATYTDLDF

    >gi|158426331|ref|YP_001527623.1| highly protein [Azorhizobium caulinodans ORS 571]
    MSENRLGAETSPYLLQHKDNPVHWWPWGPEALAEAKRSGRPVLLSVGYAACHWCHVMAHESFEDAETADLMNALFVNIKV
    DREERPDVDQIYMNALHELGEQGGWPLTMFLNADGAPFWGGTYFPKTASYGRPGFKDVLWQVSQAYRETPEKVAHNTDAI
    LSRLAAAAKPAGGVALTLADLDKAAQQIAGLFDRAHGGLRGAPKFPQAGLLELLWRAGDRTGDPQLKAVVAFTLNRMCEG
    GIYDHVGGGFSRYSVDERWLVPHFEKMLYDNAQLLELLALAYQETGDELFLLRARETVSWLKREMVTADGAFAASLDADS
    EGHEGKFYVWTADEIVAVLGKEDAAEFAAFYDVTDEGNWEGQTILNRTSFGDVSMVEEARLRPMKEKLLAARAQRVRPGL
    DDKVLADWNGLMIAALARAGALLDEPEWVDLAATAFDAVVRLMVKDGRLGHSYREGRLVLPGLASDLAAMARAGIALHEA
    AGDEAPLAHAEDFLNRLEADYLDPQSGAYFLTAADAPALVMRPLSSLDEALPNYNSVAADALIRLAALTGQDGLRARADR
    LIGALTGAAAQNPLAHPSLLNALDTRLRLAEIVAVGARSVRDRRAPTALPDAGGGPRCRWGRPEKGQPGPRPSAECAAGR
    RGIHLRGRALLPSRDES