Acidimicrobium ferrooxidans DSM 10331 uid59215

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256370854|ref|YP_003108678.1| thioredoxin reductase [Acidimicrobium ferrooxidans DSM 10331]
    MPEHVKVVIIGSGPAGLTAAIYAARASLEPVVIEGEPSSTSDQPGGQLMLTTEIENFPGFPEGILGPELMANMRQQAERF
    GARFRGTKVSRLDLAERPFAVHTNDDRSGEPAYLADAVIMATGARSLMLGLEREYELIGHGVST
    CATCDGFFFRGHDIAV
    VGGGDSALEEALFLTKFASSVTIIHRRDQLRASRIMQQRAFANEKIRFAWNRRVVELLERDGVLVGVRTEDTVTGEREDL
    GVTGLFIAIGHAPSTEIVKGQLEMDDAGYLITKPGSTETSVDGVFAAGDVQDHTYRQAITAAGSGCQAALDVERFLAARE


    >gi|256370855|ref|YP_003108679.1| thioredoxin [Acidimicrobium ferrooxidans DSM 10331]
    MAGHEVILTDKNFDETVKASELPVLVDFWAEWCGPCKMIDPILEELADEMSDKLVIGKLNVDESLEIARRFEIMSIPTLM
    LFKEGEPVKRVIGAMPKRALLKELQPALED

    >gi|256370980|ref|YP_003108804.1| Rhodanese domain protein [Acidimicrobium ferrooxidans DSM 10331]
    MIREIDIHHFAAAHQDGAFVVDVRDPWEYESGHVPGAKNIPLSHLPRRIHELPRDKDVHVICASGSRSYAAAQLLAGSGL
    RAVSVRGGTNAWIRAGKPTLNGSRENVA

    >gi|256371058|ref|YP_003108882.1| iron-sulfur cluster assembly accessory protein [Acidimicrobium ferrooxidans DSM 10331]
    MAVTSVKIGKRPSVISLTDSAVRKVAELIAQEDDAASLFLRVAVAPGGCSGYSYDMFFDSERASDDIEAEFGGVRVVVDP
    QSAELIRGSVLDFVDGLQGAGFHISNPNATRTCGCGSSFS

    >gi|256371080|ref|YP_003108904.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidimicrobium ferrooxidans DSM 10331]
    MTETNRLAPGDRLPSFCLPNQRGEQVCADSFAGTATILYIYPKDMTPGCTLEATEFNASVDELAALGWRVVGISPDTVAS
    HARFAERHGLRFDILADPDRSVITALGAYGEKKSYGRTTEGVLRSTLLIDADGAVVDALYNVRATGHVERVLRQLRQRSA
    LATGGER

    >gi|256371103|ref|YP_003108927.1| methylated-DNA/protein-cysteinemethyltransferase [Acidimicrobium ferrooxidans DSM 10331]
    MSSALAPHGIDATAISPHDDRGPRGAGHDVTARHVRADLGDDGRANGHDVSWSLVETPLGTVAIGLSDRGLARITFDADA
    VEPTPGLSPRRAALAVVVERALDAYLRGRRRDIDVPIDLAPARGIDAAVRTALVRIPYGTTASYGAIAAAIGRPRAARAV
    GTACARNPLPLVIP
    CHRVIRADGAPGHYAGGDERKTWLLRLEASTGALGPGLR

    >gi|256371111|ref|YP_003108935.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Acidimicrobium ferrooxidans DSM 10331]
    MAREATADVVIVGAGGGGYPAAFALDRAGRSVVLVDPIGNLGGNCLAEGCIPSKAVREASLIRARSTRAETFGLRGTALD
    VDWSGVLAHKDRVQRLRYEQHTDELRASTIRFMTATARIDDAERIAIEEADGSTTLVRFHDLVLATGSAPSRLAIAGADL
    AVTSHELFRLGADLPFPSRPVIIGGGYIGVETASMLANLGAAPTILEATGGLLPGYDAALATGLASLLGQRVQLHVDALV
    RSITRVGSDYEVSWQHGGDVHVTRGDLVIMATGRHVQLPEGIDALGLAPDRAPTVDAQLRTSHPRVWAPGDVNGRTPLFH
    AAVRQSLVVAHCIMAGGRSTDAMDFDAVPTTVFTEPEVASVGLTEVEARTRHGDVMVGHYDFAGDARAQILDEREGFLAL
    IAEPHRGTLLGAQVLGVDAAQLIAPLALAIHAGLTVDQLATMAFPHPMASEGIDRAARSLRP

    >gi|256371155|ref|YP_003108979.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidimicrobium ferrooxidans DSM 10331]
    MRRRRPVVAFGIGALALVGGFTWLAARAAPASEIQAPSPLLYKPAPRLAGPSLWGSGSVSLAAMRGRYVLVNYFASWCST
    CATEERQLVDLARGSGVRVLGVDFDDTNGSARSFLAHFDAHFPVIVDASGQRALRWGVSAPPESFLVSPSGEVIARIVGP
    LKAIEVEALVRLAEAKGYGA

    >gi|256371506|ref|YP_003109330.1| alkylhydroperoxidase like protein, AhpD family [Acidimicrobium ferrooxidans DSM 10331]
    MSQHWHEVQDELRDPVKELRAQIPETWHAYATLHRHALEAGHIDAKTKELIALAVAVTTQCDGCIASHARGAARQGATAE
    EVAEALGVVVLLTGGPGTVYGPRAYQAFLEFREDYRTAE

    >gi|256371516|ref|YP_003109340.1| dihydrolipoamide dehydrogenase [Acidimicrobium ferrooxidans DSM 10331]
    MSDSTYDVVILGAGPAGYAAALYGGSAGLSIAIVEQDRVGGTCLQRGCVPAKEFLETATVRRTIEAAGAFGIGATYTGLD
    FATAQARKQDVVAKLTGGLTGLMRSRGNTIVEGRGVYRGGGVIEVGGERLVGETVILAPGSVPRTIPGFDVDGEVVLTSD
    EVLSLTKLPDSVVIIGGGVIGCEFASMMADLGTKVTVVEALPQVLPGVDPDLVGILLRSFRRRGVTVRTGVGVSGLDRTG
    SGAVVRLADGTQVEAEQVVVAVGRRPNTDGVIDPASGVGLDERGFIKVDDQYRTSEAGVYAIGDAIATPQLAHVGFAEGV
    AVVKSILGEISPSVEYDKVPWCIYTHPEIAFAGLTEEQARAQGRDVIVKKDPLGGNSRARILGETDGMVKVVADRATHQL
    LGVHIVGPWATELLSPGYLAVNWEASAEEVAAFLQPHPTLSEAFGETVLALTGRSLHVG

    >gi|256371527|ref|YP_003109351.1| UBA/THIF-type NAD/FAD binding protein [Acidimicrobium ferrooxidans DSM 10331]
    MAGFRDLLFQTKASVHEVTTDEAARLQREGWALLDVREQDEYEQGAIAGAVFIPRGNLELVVESKLPDKSTPIVVYCAGG
    VRSAFAARTLGDLGYERVVSMAGGFNRWKDEGRAWSTPRTLTPEQRSRYHRHLLLPEVSEAGQLRLLEARVLLLGAGGLS
    SPAALYLAAAGVGTIGIVDMDVVDASNLQRQVLHTLDRVGMAKVDSAEAAIAQLNPDVRVVKHPVRLDADNVLEILSGYD
    VVVDGTDNFPTRYLVNDASLKLKIPVVHGSIFRFEGQVTVFSPYDGPCYRCLIPEPPPAELAPS
    CAEAGVLGVLPGIVGS
    IQALEAIKLILGLGDTLAGRLLTFDALAETFHSYRLHRDPACPACSLDPAQITIAAYDDLCLPHPVRP

    >gi|256371551|ref|YP_003109375.1| DSBA oxidoreductase [Acidimicrobium ferrooxidans DSM 10331]
    MHFAVTWDYRCPFARNFHEHVLAALEAGASWNVDFVPFSLLEVHVPEGGTSVFADESKRDQLLALSAGVVVRDRHPEAFA
    RVHRALFAARHDEARDLADREVLADVLTASGLDGPSVLAAAEEPRAIRALGEAHHDAVERFRVFGVPTVILDDGRAAFVR
    LMTRPNGDGALARRTLDHVLGTFDDHPEINELKFTTIPR

    >gi|256371621|ref|YP_003109445.1| dihydrolipoamide dehydrogenase [Acidimicrobium ferrooxidans DSM 10331]
    MVVGELIETVDLLVVGGGPGGYTAALRAAQLGRDVVLVEEGAIGGVCLNVGCIPSKALIETSRAWHGLGELAERGVMVAD
    ASLDRARVRQSVEAARDRLTGGVAQLLKAAGVEVVEGRAAFVGANHARVQSAHEATQVQFRQAVVATGSAARRVPGLEVD
    HEHILDSTDLLFRDAPIERLIVVGGGYIGLELGAAWARLGAKVTIVEAMDDVLMGAEPEVRRALRDGLGRLGVEVRTRAV
    VSSVEAVADGVVVGIEQGAGVDKLAADVVAVVVGREPRLEPELGLEAAGVAVADGRVVVDVARRTTNPAIFAIGDITPGP
    MLAHKAYLEAKVAAEAASGHPSGFDARVIPAVVFAEPEAAWAGLGEAEARARYGSIVVGRFPYRANGRAVAVGSTWGEVK
    VIARADGEVVGVWIVGADASNLISEAALAIEMGATLDDIALTIHPHPTLSEMLPEAAEVGLGRPTHIIVRTQSGGR

    >gi|256371630|ref|YP_003109454.1| hypothetical protein Afer_0835 [Acidimicrobium ferrooxidans DSM 10331]
    MTMDQLELFVDPVCPWTWLTSRWLESVEAELGLTVRYSVVSLLELNGDDPSNPWIEAMRQGRRLQRVMVRLLAAGDDARV
    SALYRAAGRATFEGGRTLDAELVRELGEGLGLSDEDIAAADDGRLDAAVVTEHQRAMRLAGPDVGSPILARRGGERGFYG
    PIVDRPLAPDEAVRLWHIVEGVLDTPALFEIKRGRAVEPRFA

    >gi|256371653|ref|YP_003109477.1| Peroxidase [Acidimicrobium ferrooxidans DSM 10331]
    MTADAQTLGVIKLGDIAPDFEAETTKGKIRFHEWLGDAWGILFSHPRDFTPVCTTELGEVARLRSEFESRGVRVIGLSVD
    DVESHHTWEADIADIAGAEMWFPMIADPDRTVSSLYGMVHPNELDSATVRSVFIIDPAKRVRLMITYPASVGRNFAEIVR
    VIDALQRTSRYPVVTPANWTPGQRVILATSVPTDQARAAVGHDAEEIRPYLRLVADPGTN

    >gi|256371751|ref|YP_003109575.1| DsrE family protein [Acidimicrobium ferrooxidans DSM 10331]
    MWTNEGEGKIVYVQTHGINDPGRSATPFFLAASAAAMEVEVGIYFTMYGPQLLRRDIVDKIGPKGDRGQPLSYFIRQATD
    LGVRLWV
    CQPSLDLNDLTLEELIDGVEMIGGAAFNNLAMTADAVVSF

    >gi|256371813|ref|YP_003109637.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidimicrobium ferrooxidans DSM 10331]
    MTNTTTSHERPEGVGRRIVVVGGVAGGMSAAARLRRLCEHASITVIERSGHVSYANCGLPYYVGSVIEDREDLVLQTPER
    LQARFRLDVRVNAEVVSIDRERREVRVRSVETGEASVLPYDTLILSPGAVPIRPSIPGADRMRVLRTVEDAERLASEVTT
    RPRSAIVVGAGFVGLETAENLAHHGIPVTVVEARSQVLPVLDPELAIAIEETLERHGVRVITGAGVAEVHAWGVTLDDGQ
    EVEGDLVVAAVGVRPDVRLARAAGLELGPHGGILVDETSRTSDPAIYAVGDAVEKVDAISGSLELVTLAHVANRQGRRVA
    DHICGRAVEARPSIGTAIVRIFDTVAASTGLSEQRLRALGRAYQVVRAHPMSHASYYPGAQPMSLKVMFDPSDGRILGAQ
    AVGGEGVDKRIDVLATAIAAGLPVDELANLELAYAPPFSSAKDPVNMVGYIAENIRSGTCDVVEPEEVESLVRDGWTLLD
    VRTAEEHRHGAIPGSVSVPVDELREHLESLGDGPFVVY
    CAVGLRGHVATTALLEHGFKARNLNGGHRSWAAWKAAERMAL
    AG

    >gi|256371856|ref|YP_003109680.1| OsmC family protein [Acidimicrobium ferrooxidans DSM 10331]
    MRFGATATTSAAGRAEIELARGRRFEVASDGTLASPVEFLLGALASCQVLTYQHVAEAQNVPLDSVTVRVEGSLDPATLD
    GAARPCVSDVVVHVELRGPSTPERYEQLANEVDRRCPVHATLERDVAITRQLAVV

    >gi|256371946|ref|YP_003109770.1| heavy metal translocating P-type ATPase [Acidimicrobium ferrooxidans DSM 10331]
    MSPQTDAPSGPHEEVALRVSGMTCTSCALRIERSLDKLPTVDADVNFATGKAEVRFDPAVVDLAEILRAVRRSGYDATVA
    LSSDASPRFHWWAIALAALVAAGAMVAPPTQLARDVELVATLVVLATAGRPFFVAAWNAARHRSVTMDTLVALGAGVAMT
    ASAIVTVAGLQHEPTYFDAAAMIVAFIGIGKLLEERWTRRARAGLDALEELSRRTLARIDDDGSLHEVPLGELEAHDRVL
    VRPGDIVPADARVLDGDAAVDGALRTGRRDLRRVGPGDEVLGGDAVVGSSLTIELDAPARLGLVVELARLVEVAQHRRAR
    LATLADRVSARFVPAVIAVAVVVAFVRLAIGAPVAIALSSAIAVVVVACPCAMGLATPIAFLVASTRAAARGIVLEHPDA
    LEHATSIDTVVLDRTGTITEADLVAHWPERVALSERRLVAALAARSRHPVSRALSRVEGDPANASGDGNDPEPVVEHVVE
    TPGVGVTGRVDGHEIAIGSPASVGATGVDPAASERAVFVRIDDQSPIVIELAERTREGTAATVAALHRLGARVILATGDS
    RPTLADEAREFGIDDVAIGLDPTAKVALVTKLRADGHHVAMVGDGTNDAAALATSDLGIALGGGTHLAQANADAVLLGDD
    IAMVPTVLDLARRTVRTIRQNLGWALGYNVIAIPAAAAGLLSPMVAAALMAMSSLVVVGNALRLDVRESAGASGTTEVR

    >gi|256371953|ref|YP_003109777.1| transcriptional regulator, ArsR family [Acidimicrobium ferrooxidans DSM 10331]
    MSDAPLESDHAVKVALFDRAAEVATALGSGRRLEIIDLLAQGERSVEEVARETHQSVQSASHHLRRLAIAHLVATRREGA
    RVYYRLRSREVAELWLQLTRVSAQLDRDVEALAAAYLGPEELAGLRAADVIDRMADGSLVVLDVRPEEEWRAAHLPGAVP
    APLVALREVPTRLAPGSEVIVYCRGPW
    CAYASIAVRWLRDRGIEARRLEDGFLGWLVDGRAVESGSTEVAEG

    >gi|256371982|ref|YP_003109806.1| Glutathione peroxidase [Acidimicrobium ferrooxidans DSM 10331]
    MFPYDLVMERLDGTKEELSAYRGKVLLVVNVASRCGLTPQYEGLVELYHARRDDGFVVLGFPCNQFLGQEPGTAEEIETF
    CRTTYGVDFPMFAKIEVNGEGRHRLYASLCEVPDGDGVAGDVQWNFEKFLVSRDGERIERFRPTVEPQDPMLVGAIDALL


    >gi|256371998|ref|YP_003109822.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidimicrobium ferrooxidans DSM 10331]
    MSQVRLGDEAPPFVLPGTGGQRYDLRAQRGTPVVLAFYPEDFSPVCSAQLRAYSASIDDFRALGAVMWGISPQGLDSHES
    FVQRRGIAFPLLADTDREVARSYGVLGPLGFYRRSVFVLDRDQRVIYLHIARAGLTFRPSDELLEAVREAVGA

    >gi|256372084|ref|YP_003109908.1| thioredoxin [Acidimicrobium ferrooxidans DSM 10331]
    MDVTDATFERDVLEASKERPVVVDLWAPWCGPCRTLSPIIEKVVAETEGRVVLAKVNVDENPGIAQAFRVQGIPAVFAIR
    DGKVVDSFVGAYPEQAVRDFVTKLAPAETVVDVLIAEGTEPSLRQALELEPGNERAAVGLVELLLVRGELEEAEAILARF
    PDTEPIAALKARARLAARGEAALDEATIESRLEDLLGRVKGDEEARQEFLDLLRLLPEGDPRVSTWRRRLTSALF

    >gi|256372332|ref|YP_003110156.1| thioredoxin [Acidimicrobium ferrooxidans DSM 10331]
    MATRNLTLSDFEATIQENDIVFVDFWAAWCGPCRMFAPIYEQASEVHPEIVFGKVDTEAEQQLAAAFGIMSIPTLMIFRE
    QILLYSQPGALPKEALDDLISQVLALDMDDVRRQIAEAQAAEARQA

    >gi|256372397|ref|YP_003110221.1| protein of unknown function DUF255 [Acidimicrobium ferrooxidans DSM 10331]
    MGNRLATSDSLYLRDHADDPVDWWPWSSDSLATAARLGRPLFVSIGYAACHWCHVMAETTFRDPAVAALINEHFLPVKVD
    REELPDIDARFMAAALAINGSGGWPLTAVATSDGRPAWVATYLPPRSTSNLPGLIETLTTILDAIARDPRALERAADELT
    RARLEPRSRRPTAPPTDEITMRLRTDLARQLDRSEGGFGTAPKFPQAHALLALWELVRTGDGVETVRVRELVLASVRRYA
    ESGLVDHLDGGIFRYAVDRPMVDVHYEKMLVDQAWFILLLAVIGPDREDLDLYFTLERTIAFVRRALVRFDGLLATSLDA
    DAHGVEGGAYLLRAEEVRAVLGDEAAWVIDELHLPPDRPHHGHRIGASTLRLEGNALTRFDALAAWRRGRGSARRDDKAL
    CDHNAAVATALLVAGRRSGRDEWIVWGLGLARRVHATFVDASGARHVAYGGEARGATSSDELWVSIMALAAWEVTGATAW
    LERARTSASRLVERFLLPGLGMVVSSTEPGEAVPDRLDGAHPSVSSLALWHLTRLVAVSADDRLAHARSQLADALADVLE
    AAPAAAALGALAMGHTDRVRTVVVATPNLTELARVALAAARPLDVVVRDPTHPLATGAAGDRAEVCVAHACLLPTSDPRV
    LADALWSTLP

    >gi|256372399|ref|YP_003110223.1| uncharacterized peroxidase-related enzyme [Acidimicrobium ferrooxidans DSM 10331]
    MTRIPEWFGRLDPDPNAPDDVRARNDAVAERTGFLPTIFGALSWRPEEYRAFFGYHDALMEVPSGLTKAERELIVVATSA
    GNHCLY
    CVIAHGAILRIRAHDPTIADRVVVDPERADLDERSLAIVRFAFKVRDEANAITPEDFAPLYEVGLDDTDIWLVG
    AITAFFALSNRLAGFAKILPNSEFYAMGRTPRSS

    >gi|256372455|ref|YP_003110279.1| hypothetical protein Afer_1690 [Acidimicrobium ferrooxidans DSM 10331]
    MTGMGSAALSSSGLAGPFYHRLGLEAIALVLIGLVLVAARYFLFAGATNPARVQVAGSADEGVYEVAEPRARAILRWGFG
    ALWIVDGLLQMQRAMPTSLVGQVIQPAAQGSPRWLVDLVQLGIDAWQRHPLWAATGAVWIQLAIGVWLLLGKSGAFAKVG
    YVAAILWGLTVWVGGEAMGGILAPGASWLFGAPGAVLLYVVAAAALLAPWSAWQPDRLPRWLLGLVGAELFVFGVLEAWP
    GRGFYHGQIPAMIRTMAGTPQPSFLARPMVDLANALHGTTTVVVNAAVAAVLIAVGVAFLAKRLVWPAFWVLAVLSLLAW
    WFVQDFGFLGGVGTDPNSMVPGLVLAGAAVVGVVSPARESVDVRGLWPSGVGIAGRLLGTWTVVVALMGIGPLAYAAINQ
    TASPALALAASDTPFAIDRPVPSFTLLDQRGVPVSIDQFAGKRVVLTNLDPVCTFD
    CPLIAQELRTADLALPPSVRANTV
    FVAVAVNPVIHSVQAVKIFDQRENLTGLSNWYFLTSPSLTQLSKVWQALGFGVSQPVDGVMTQHEDIGYVVGPNLTERYL
    IPMDPSLNASVATSISSLYVHLVEEV

    >gi|256372475|ref|YP_003110299.1| Redoxin domain protein [Acidimicrobium ferrooxidans DSM 10331]
    MTRTTSESTYEQSDLRRRPRVFMFAMVLALLVAVGYVVYAVGVARSATNGASASLTASSSGSALVGRTVPGFSLPVLAND
    SSASKLGPGSFRGRPLVINFFASW
    CGPCNAETPMLAKAAAASAGSVAFLGVDENDQRSAALAFLARTGVSYPVVRDAGSL
    QSSYLLVGIPDTFFVAPDGRVIGAVQGQISSSTLENWLRKLDALAHHG

    >gi|256372621|ref|YP_003110445.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Acidimicrobium ferrooxidans DSM 10331]
    MMRLLCIGGSDGGISAALRARELDASAEITVVLADDYPNFSICGIPYHVSGDVADWHDLAHRTRSDLEALGITLLTGHTA
    RRIDVAGHTVVATDADGREISLGYDRLVLATGATPLRPPIGGLDQLGHGDGVHAVHAMEDLHAVMASLATRAPSRAVIVG
    AGYIGLEMAEALTTRGIAVSVLEALPHVLPTLDGPLGDVVAEELATHGVAVYTSTTAKAITTEGRRLRVHATWAPEAEPR
    ALELDAELVLVVTGVAPDTALARAAGLELTPRGAIRVDRTMRTNAPDVLAAGDCVVTYHALLGETYLPLGTTAHKQGRIA
    GENALGGDRHFAGSLGTQVVKVFDLVAARTGIRDGEAERAGFRPRTVASSADDHKAYYPGATSVRVRMTGDLLSGRLLGV
    QMVGALTSAVHKRIDTAAAALFAGLSVDELGDLDLSYTPPLGSPWDVLQVASQRWISEARPVDDAH

    >gi|256372746|ref|YP_003110570.1| 3-mercaptopyruvate sulfurtransferase [Acidimicrobium ferrooxidans DSM 10331]
    MSRDPILAPTDLSAELQILDVRWRLGTPVSEHRARYDAGHVPGAIFVDLEAVGTGAHRPGAGRHPLPEPGQVARDLAALG
    VDLGAPCVVVDDARGASAARLWWLLDALGVEAYLLDGGLEALEGPRCQDPCDRRAAATPRAVPATWPGELVLDVDTLADQ
    LNDPSLCVLDARARERYLGQSEPIDPRAGHIPGARSLPIDEVLATGRFPDPATARRILGPVGDREIVAS
    CGSGITACVLI
    ALARRAGRDARLLEGSWSGWCEDPARPVCRSVCGDELTRGSTRTNS

    >gi|256372748|ref|YP_003110572.1| Rhodanese domain protein [Acidimicrobium ferrooxidans DSM 10331]
    MRGPPKPPTSAEVLAARAPHVPRMHWSRIEPLCGLPSVPRFQAWSTPHPRPACGGWCPRHLRRCPQRDRAGNNPRPARQL
    AGGDPSTHERYLGQSEPIDPRAGHIPGARSLPIDEVAATGRFPDPATARRILGPVGDREIVAS
    CGSGITACVLIALARRA
    GRDARLLEGSWSGWCEDPARPVCRSVCGDELTSSQRRTTLRQRGSRHRTGRSRHRSTPGPKVASQSAHRDRRPPPAGATP


    >gi|256372760|ref|YP_003110584.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Acidimicrobium ferrooxidans DSM 10331]
    MVMSTLHASAPWDLGIIGSGSAAFAAALEARARGASVVLIERDALGGTCVNVGCVPSKALLVAAHRRSLAASAYPGLGAE
    TLPIDHDELAAGVRGVVSSLVKRKYRDLAERMGIDVRYGTARFVSDETVSVGGDELTARRWIIATGAHAVLPSVDGLDPA
    ELWTSTDALTALEIPARVAIIGAGSIGLELATAYSGLGARVHLIESTPQAVASAPLELTGALVEHLRASGVAVALTTTVG
    SAQATTSGWLLQLQGPEGATQVEVDRVIAAVGRRPTTENLGLETVGVELGARGEVVVDATMRTSNRGIWAAGDVTGGPQY
    VYVAAAQGALAARNALSDGDEHFDDRAIPAVVFTDPPLAQVGLTLDEAQHQGYDAESTTFSFADLPRAIVEHATEGLAVM
    VAERTSGRLLGVHLWGVNAAEVIQSAVLALRTNLTISDLATTWAPYLTASEALRLAAQSFTTDVANLSCCA