Pelotomaculum thermopropionicum SI uid58877

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|147676466|ref|YP_001210681.1| hypothetical protein PTH_0130 [Pelotomaculum thermopropionicum SI]
    MDSYYNPADLARFATVGEEAPHLWEKFMAYYSAVFEEGALSAREKALIALAVAHALQCPYCIEAYTQDALEKGSNQEQMT
    EAVHVAAAIRGGAALVHGVQMKNVCNKLGF

    >gi|147676470|ref|YP_001210685.1| rhodanese-related sulfurtransferase [Pelotomaculum thermopropionicum SI]
    MNRLLRMSKNRRIFVYLAVIGVLLFLVLVAAGCGGKTAGTAPPKEVKPLDKEMEPYYVDVAWLKENLSKVVVLDARSEKE
    YNEGHIPGAINVTWQSLSNMTPKQGEVGWGVVLPQEELAKKIGSFGIDGSKPVIIYNDPKGLGEEGRVLWMLRIAGLKDS
    RMLNGGFPAWKAGGGEISKEVPAVKPVDFKITSPDNSLLATTDYIRNNMSKIKLVDARSIEEYTGKTNHGEKALGHIPGA
    ISIPYNNAYNSDGTIKSIAELKEIFSKAGLDPSDDIVVY
    CTVGIRSGFLTEILRMCGYEKAKNYNASFSEWAGLGLPVEK


    >gi|147676566|ref|YP_001210781.1| cation transport ATPase [Pelotomaculum thermopropionicum SI]
    MKGVEAAAVGAKPEGLKKLTVKIAGMSCAACASRVEKALSKIPGVEDARVNFAAETATVDYHPELVSPATIFDKIKETGY
    RPVMGRAELKLSGMS
    CAACAARIENGLNKLPGVARAAVNFATEKAIVEFDPAEIDVPRIKKAVADIGYRAYEVDDRTTAG
    LEREEREREIRRQKSLVIFSGILSAPLVVYMLAMVFNLHHKIPAFFLNPYFQFALATPVQFIAGANFYKEAYVALRGRSA
    NMSVLVALGTTAAYLYSAAATFFGGRIGVSEVYYETGAIIITLVLLGKTLETIAKGRTSEAIKKLIGLQARNARVIRNGQ
    EIEIPVEEVEVGDLVVVRPGEKIPVDGVVKEGYSTVDESMLTGESVPVDKKAGDEVIGATINKLGTFKFEATKVGKDTAL
    AQIIKIVEEAQGSKAPIQRMADVISAYFVPAVVAAALITFFAWYYFGAPGNFTRSLLNFTAVLVIACPCALGLATPTSIM
    VGTGKGAENGILIKSGEYLEKAHKLTAVILDKTGTITKGEPALTDLIPAPEYSGCENALLQIAGSAEKNSEHPLAQAVVN
    YAAGKGVVLKDPQQFKAIPGHGVAAELEGRKVLLGTRKLMKDNNIDISGLLADVEKLEEEGKTVMFMAVDGRMAAVIGVA
    DIIKENSREAIAQLKEMDLEVWMLTGDNRRTARAIARQVGIENVLAEVLPGEKAQQVEELRKQGKVVGMVGDGINDAPAL
    AAADVGFAIGTGADVAIEAADITLMRGDLRGIVTAIRLSRATIKNIKQNLFWALIYNTVGIPVAALGLLNPVIAGAAMAF
    SSVSVVTNALRLRRFKTGLI

    >gi|147676579|ref|YP_001210794.1| dinucleotide-utilizing enzymes [Pelotomaculum thermopropionicum SI]
    MQLTFTEEQVVRYSRHIILTEVGSRGQKKINAGRVLIIGAGGLGSPVAFYLAAAGVGTLGIIDDDVVDLSNLQRQILHFT
    EDVGRPKVDSAKEKLLALNPDCNVVSYRERLMAHNILDIIKQYDIIVDGTDNFPTRFLANDACIMAKKPFVYGGVLRFFG
    QVMTIVPGKGPCFRCIFSEPPPPGAVPT
    CSEVGILGVLPGTIGLIQATEVLKYLLGIGNLLVGRLMMYDALLMEFRDVQV
    KRNPDCPVCGDNPTIIDLVDYETPVCSIQRR

    >gi|147676602|ref|YP_001210817.1| hypothetical protein PTH_0267 [Pelotomaculum thermopropionicum SI]
    MKFYRLFQPVKINSVELRNRIVMPPMVTNFGYADNTVSGRLVAYHAARAKGGFGLNIVENFAVHPLGKAFSAVLGLWDDR
    FIPGCRGLTEAVHRHGGKIFAQIYHAGAQTTENVIGVQPVAPSAVPHPVMGTLPRQLNVEEIEEIVESFGRAARRAREAG
    FDGVEVHGSHGYLVSEFMSAYTNRRTDEYGGDLLGRMRFPVEIIRSIRRHAGRDYPVTIRIAGDERVSDGRTIEETRVAA
    RLLEEAGYDALHVTTATTATMHYIAPPYYLPPALNVEYAEKIKKCVSIPVITTGCIYDPHFAESILAEGRADLVGMGRAS
    IADPELPCKVAAGLLEDIRPCTGCLQGCIGSLYYGRPITCMANPEVGREEEAVLKPALQAKKVLVVGGGPAGLEAARVAA
    RRGHKVIL
    CEKSGSLGGQLKIAAMPPHKQRMAHLVKYLVNQVKKAGVEIRLATEVDLKLVREISPDTVVVATGGEPFIPA
    IPGAEGKNVVSAWDVLGGRAGVGGKVLVIGGGSVGCETADFLAVQGKAVDLVEKLDKVGHDMVERVRYFLMQRLLSAKVG
    IYTEANVLEITGDGVKVERRGVMQELSGYDSIVLALGTRPVNSLVEELSKSKVNYVVIGDAKKPGNALEAIGQAAEAGRA
    I

    >gi|147676775|ref|YP_001210990.1| arsenite S-adenosylmethyltransferase [Pelotomaculum thermopropionicum SI]
    MEDIREFVRKKYAVAVAGKTGCCGDAGGDCCGGVTAGATCNGAVTEDLYSPDELAWLPEEAAAAAFGCGNPSALAELREG
    EVVLDLGSGAGLDVLLSARRVGPRGKVYGLDMTDEMLAAARANQARAGIENVEFLKGYLEEIPLPDNAVDVIISNCVINL
    TADKDRVLREAFRVLKPGGRLAVSDIVVRRPLPRKVQQSLAAWAG
    CVAGALQEQEYREKLAAAGFVDIGVEITRVYDTKS
    RAAAALLPGLTDEERRQTGGALASAFVRAKKPC

    >gi|147676833|ref|YP_001211048.1| dinucleotide-utilizing enzymes [Pelotomaculum thermopropionicum SI]
    MKDALSSLSGEQRVRYERNILLPGVGVEGQKRLLQSGVLIVGAGGLGSPAAYYLAAAGVGRLGLADADAVGLSNLQRQIL
    HRTGDIGRPKAESARDKLAALNPDVRIEIVREYLNPDNAEALVGRYDIVVDCTDNFPSRFILNKVCVLQRKPFVYGGVLA
    FTGQAMTVVPGAGPCFRCLYPSEPAPGGPT
    CSELGVLGAVPGVIGAIQAAEAVKYLLGLGDLLVGRLLVYDAASMTFSEV
    SLKRSPRCPDCSGL

    >gi|147676985|ref|YP_001211200.1| hypothetical protein PTH_0650 [Pelotomaculum thermopropionicum SI]
    MEIKILGPGCPKCKALYKAVTETVEEMGVSADVKKVEKLDEIIEAGVMLTPGLIINGKVKVTGKVPGKEDIKKYIQQEI

    >gi|147677017|ref|YP_001211232.1| hypothetical protein PTH_0682 [Pelotomaculum thermopropionicum SI]
    MDKAPSAGAGERCRIYESGALHRVTGDFIRPGGIVLTDRALSFCSFPPGARVLDVGCGAGATVEHLITVYNLNAVGVDPS
    PALLEQGRRRRPGLPLLEASGEDLPFDDGVMDGVFAECTLSVMGSPDRALAEIWRVLKKRGLLVVTDVYARNPEGIAALR
    RLPPAG
    CLTGAMSRDEITEKMSLHGFEILLWEDHSRLLAELAARLIMVNGSLDALWRNSACDAAQCLEIGETVKRSRPGY
    FLLIAGKKG

    >gi|147677297|ref|YP_001211512.1| thioredoxin reductase [Pelotomaculum thermopropionicum SI]
    MEGERWDIAVVGCGPAGLSAAVNAAVRGRKAVVFGGEFCSPKLQKSPVVNNYLGLPGISGENLRKKFLEHVRRLNIPVRR
    LKVDSVCRAGDGMFLVAAGDRSFQARAVVIATGVTVSRLIEGEREFTGKGVSY
    CATCDGLLFGGRDVAVIAHTPEGVEEA
    NFLAGACRRVYFIPGAKTAVSGLKPEVEVVRGEVEAITGNGFVSGIRLRDRELAVDGVFIYRETFLPDRLVPGLALNGNH
    IKVGRSFNTNIKGIFAAGDCTGKPYQLAKAVGEGQVAALSAVQYLDRVE

    >gi|147677386|ref|YP_001211601.1| thiol-disulfide isomerase and thioredoxins [Pelotomaculum thermopropionicum SI]
    MASEKVLILNGSDFNRIISESATPVLVDFWADWCGPCKMIAPVVEEIAEEFEGQVRVGKLNVDENQSMAASLKVISIPTL
    ILFKGGQEVERSIGYKTKDELRRLLEKHL

    >gi|147677499|ref|YP_001211714.1| NAD(FAD)-dependent dehydrogenases and rhodanese-like sulfurtransferase [Pelotomaculum thermopropionicum SI]
    MSGRFKVVIIGGVAAGTKVAARARRLLPEADITIVEKDRYISYAGCGTPYYIAGQVKEFDSLFKTAYGVVRDEDYFLSER
    DVKVLTGTRASSIDRAGKRVEIIRLATGERSFLEYDRLVLATGSTPVVPPIEGLELKGVYRLNHPEDALAIKSAVEQGVS
    SAVIIGAGLIGMEAADALNKMNVPVNVVELKNQVLPGVLDEDLAALLARRLKRNGIGLNLGRKVLRIEGEGGRVAAVVTD
    QGRLEAGLVIVAVGVRPNVGLAREAGLEIGETGAIKVNEYLQTSDPDIYALGDCVENTHLVSGRKVYIPLASTASRQGRV
    VGDNVAGRRTRFKGVLGTTVLRVTGINIARTGLGEAQARDLGYDVITALNPATDGTHYYSQHGRIFLKIIADAGTGRLLG
    VQGFGPGDVSKRVDVAAAAITFGATAGDLHDLDTGYAPPFATPIDALAHTANIIRNKMEGLAEGITPARVREKLRRGDDF
    VFLDVRTGPQFKMRHIKDGRVMLIPLGELRRRLDEIPRDKEIVVS
    CMVGVRAYEALRILKGAGFADVKFMEGSLEAWPYE
    TEKG

    >gi|147677516|ref|YP_001211731.1| putative oxidoreductase [Pelotomaculum thermopropionicum SI]
    MAREKKTVIPHRHPMPVQDPGLRTRNFNEVALGYGEEAAVAEAARCLQCKNEPCRQGCPVEVDIPAFIRLVAGRDFAGAI
    KKIKEKNALPAVCGRVCPQENQCEKYCTMGKKYEPVAIGRLERFCADWELAGGVLPQKTAPPTGKKVAVVGSGPAGLTCA
    ADLAKLGHRVTVFEALHVAGGVLMYGIPEFRLPKAVVQAEINNLKNLGVEIQVNAVVGKFATVDELLEEWGFDAVFIGTG
    AGLPHFMKIPGENA
    CGVYSANEFLTRTNLMKAYLFPEYDTPVRVGRKVAVLGGGNVAMDAARTALRLGAEESWIVYRRSR
    KEMPARLEEVEHAEEEGVKFMFLTSPTRILYNEDYWVTGLECLRYELGEPDSSGRRSPVAIAGSEFIMEADTVVVAIGQG
    PNPLVPRTTRGLECNKKGNIMVDPQTAATSKPGVFAGGDVVTGAATVILAMGAGRIAAKSIHAYLENR

    >gi|147677752|ref|YP_001211967.1| thioredoxin reductase [Pelotomaculum thermopropionicum SI]
    MEKKELVIIGGGPAGLSAGLYGSRAKLDTVLLERGIPGGLVISTDQVENYPGFPEGIGGFELMQKMEEQARRFGLEIVSV
    NVESIRVDGKGFCVKTEDGELLAGAVIIATGAQPQLLGVKGEEQYTGRGVSY
    CATCDGAFFRGKKVAVIGGGDAAVQEAI
    FLTKFAEKVFIIHRRNELRATRAVQEKAFGNPKIEFVWDAVVSEISGSDLVESVTVKNVKNGEERDLQVDGVFIYVGQKP
    NSDLVRDIVSLDEKGYIITDENMMTSQPGLYAAGDVRRKLLRQVVTAVADGAVAAVAAEKYLEEAH

    >gi|147677941|ref|YP_001212156.1| glutaredoxin and related proteins [Pelotomaculum thermopropionicum SI]
    MSAKVLVYGKEGCPYTLAAKKDLSQRKVPYSYYDVQKDQKAMQEMLKLTGGVRKVPVIVENGNVKIGFGGT

    >gi|147678069|ref|YP_001212284.1| NAD(FAD)-dependent dehydrogenases [Pelotomaculum thermopropionicum SI]
    MLQGYKQPGQTDCCLIDEEFRGVKKLSSGTVLVIGGVAAGTKAAAKARRENPGLKIVVITKDRHVSYAGCGLPYYIGGIV
    QEEKELLVRQPEDFLLDHDIEIITGQEAVRIIPGEKAVMVKDLTTGELQKFFYDKLVLATGASPFIPSIKGKELANIFTV
    RAISDAAAVKRLLAGRNIQDAVVIGGGMIGLEVAENLSRLGVKTTLIELSPQILPSYDLDVALYVQNYLREKGLSILTGT
    AVTGFEDNGRGEVGAVLTGAGPVKADLAVLSIGVRPNVDLARECGIQLGPTGAIAVNKMMETSIKDIYAAGDCAENINLI
    TGRPVWYPMGSTANKTGRVTGINVSAKENKDSLEGVLGTSIIKLFELNVAKTGLTEREAGKLGYDPETVLVPVPDRAHYY
    PGNRLIITKLVADRKSRRLLGGQIYGEGAVDKPVDILATAITLEASVDQLAKLDLAYAPPFSPAMSSTIVAANVMINKLA
    GKFKGTSPLSLKEKLAAGAVLVDVRTAEEYFVRAIPGSINIPLRELALHAGSLDKNKEIILA
    CKVGLRSYTAFLKLKSFG
    FNNLSILEGGITAYPFETE

    >gi|147678938|ref|YP_001213153.1| hypothetical protein PTH_2603 [Pelotomaculum thermopropionicum SI]
    MQAFLFRVRPGWMAGAWSESGLVALTLPQPSQKAALLELGNGLRTSPCSLAAATALDGRVQELIDEMERYFRGEKVTFSA
    AVDWSGYTPFQRRVLEVTRAIPYGEVRSYGQIARQAGSPKGARAVGGVMRANRTPLVVP
    CHRVIASTGSLGGFGGGLQMK
    KYLLTLEKVQGREGPVDFSIPVG

    >gi|147676574|ref|YP_001210789.1| adenylylsulfate reductase subunit alpha [Pelotomaculum thermopropionicum SI]
    MNAGRVKIERKSADIVIVGGGTAGCFAAVTIKEMCPSADVLVVEKAHVKRSGCLAAGVNAINAYLGPGETPESYLDYVKR
    DSAGLVREDLVLSIGQRLNRVTEKLESWGLPFLKDESGRYKFRGKRSVEINGEHIKPVIASALRRSGAGILNRAVATNYV
    VKDGRAAGVFAFSAREEKFYVISAKAVICAAGGAAGIYRPNNGGPARHKMWYCPFNVGTGFAMGLRAGAEMTTFEMRFIA
    LRIKDVLSPTGTVVQGVKARQINALGEEYLNRYGSDSTPVRLYATVEENKAGRGPCYLDLTGLPDSDNSRLKEAYLNMSP
    GIVLKWADEGVEPNGKPLEICGSEPYVVGGHGQAGYWVDSRRRTTLEGLFAAGDAAGGAPKKYVSGCLAEGEIAALAALE
    YIRGIEVPAAGDQEVAAELGRVFEPLGRQKGAAPDDYEERLQKIMDEYAGGISANYELSGPKLLIARELLRELQDEISAN
    ISAGDMHELVKAHEVIDRALVARVLVEHLLYRKETRWRSYQERVDYPVRDDRRWLVFVNSVYDGETKNIRIIERPWKGLG