Pelodictyon phaeoclathratiforme BU 1 uid58173

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|194335211|ref|YP_002017005.1| DsrE family protein [Pelodictyon phaeoclathratiforme BU-1]
    MESSKLLIISTIGQENHEKATLPFVLATASQSLDVEVVMFLQSSAVVLAKKGEAEKVRAEGFAPLGELFDTFMDMGGKLY
    L
    CSPCIKERDIAPGDLVDGVQIGAAGTLVHEVMSADSVVTY

    >gi|194335217|ref|YP_002017011.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MSVETILIVGGGISGITTAVEAAEVGYNTVLVEKNPYLGGRVAQLNKYFPKLCPPYCGLEMNFRRIKLNPKITVYTLTEV
    EEVSGKEGNFSVRLKVNPRYVNEKCTSCNACVDVCPAERLNEFNFGMDKTRAIYRPHEMAHPMRYVIERNACSDPSCNKC
    VTACKYNAIDLAMKPETVEIKAGSIVYATGWKPYDAANMENLGFGRIKNVITNMMLERLAAPNGPTGGKILRPSDGREVK
    KVVFVQCAGSRDENHLNYCSAICCMASLKQATYIRERIPDAEVFIAYIDLRTPGKYEDFLGKVQADEHVKMVKGKVAMIE
    EDSATGNVIVTSEDVEGGRKSRQIADMVVLATGMVPSVKENAMLNFEQNGFIQAGKTPGIYSVGVAKRPSDVTSSIQDAT
    GTALKSIQSLVRS

    >gi|194335229|ref|YP_002017023.1| Redoxin domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MKKMVFSLKRRVFALLFLGTLAATLFAPTPAAALPLAPEFTAVSLDGKTVASTKLAGKAYIVNFFASWCPPCRAEIPDMV
    LLQKKYESKGFTFIGVAVNENEPSMRAFITKNGISYPVVMVEERLIKAFSRYIEGGIRAIPTSFVVNSSGRITQVITGGR
    SKEVFEKIIIDALKKPVTHK

    >gi|194335291|ref|YP_002017085.1| rhodanese domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MLVDVREAYEVARKSFDVPEIMLIPFRDFEKRFQEIPVKRQVIIACNSGSRSAVATRILMTHGYRKVVNMQYGIMRWAKE
    GLPVKGRPKQTFGARLLQMFRGKS

    >gi|194335516|ref|YP_002017310.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelodictyon phaeoclathratiforme BU-1]
    MIAEQTKAPAFTLPDSAGKQISLSDFAGKKVLIIFYPGDDTPVCTAQLCDYRNNVLEFTKRDIVVLGISSDSQASHKSFA
    ERNKLPFSLLSDTEKSVAKAYDALGFLGMSQRAYVLVDENGVVLLAYSDFLPIIYQPMKDLLAKIDAA

    >gi|194335546|ref|YP_002017340.1| glutaredoxin 2 [Pelodictyon phaeoclathratiforme BU-1]
    MTIMNHIVILYGKKECCLCDEAMEVLQKVKASLPFELQKIDISTNPELLEEFGLTIPVVFVDGIQVFKYRINEKKLRLLL
    TPV

    >gi|194335930|ref|YP_002017724.1| Redoxin domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MTIRKAMLAAALVITLIAPYPGRVDAATSVAETHVNAAVAPQFSAKSVQGVLLSSQKLAGKAYIVNFFGSWCPYCRKEIP
    EMVALQEKYEKKGFTFIGMAYKDNEHSMPDFIWEQGINYPVIMADKSILKSFGSHVSGGIASVPLLFAVGRDGRLVAVEP
    GAQTREDLEKLILKIMQGSAKP

    >gi|194336184|ref|YP_002017978.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelodictyon phaeoclathratiforme BU-1]
    MSVLVGRKAPDFDVAAVVNGSQFVDSCKLSDYKGKYVVLFFYPLDFTFVCPTELHAFQEKLQEFRDRNVELIGCSVDSKF
    SHYAWIRTPRSQGGIEGVTYTLLSDLNKTVSADYDVLLEGAGIALRGLFLIDKEGVVQHQVVNNLPLGRNVDEVLRLVDA
    LQFTEEFGEVCPANWNKGDKSMKPDEEGLKEFFKET

    >gi|194336206|ref|YP_002018000.1| methionine-R-sulfoxide reductase [Pelodictyon phaeoclathratiforme BU-1]
    MPRGARLDAPGTLHHVMVRGIEGCRIVMDDTDRDQFVLRMGRLAKATGTEIYAWALMINHAHILLKSSEEGLSSFMRKLL
    SGYATVYNRRHKRYGHLFQNRYKSIVCEEEPYFVRLVSYIHLNPLRAGIVHSLEELDQHRWSGHAVIMKQCNHEWQESDF
    VLRFFGEKEGMAREAYRLFVEAESRKGEQPELTGGGLIRSTGGWSEVKSLRQRGEKQFGDERILGSSAFVREILDQADDS
    VKALIPASNFSQDAAEELRKRCGECGVALQLMESGSKRDECTALRKELAVKFIREFGLSYAETARQLGVSTSAVNQIFRR
    LARTTLFILMTIVTLSACNGAAPPTITEKPKAMTEKQHPANPYYSRTDTTSLNLSDAIWKEVLSPAVYEVARHGSTEQAF
    SGKYWDYEGRGSYFCAACGNMLFRSDAKFATTCGWPSFFETLRPNSVLYRKDSSFGMERTEVVCGRCKAHLGHVFDDGPP
    PTGKRF
    CMNSVILEFEPDKSSSKKQP

    >gi|194336217|ref|YP_002018011.1| methylated-DNA/protein-cysteine methyltransferase [Pelodictyon phaeoclathratiforme BU-1]
    MIISFQQTTIGRVAVAELDGAITNLFFADEIVPQQAAVGETELLTQAFRQLNAYLQGELKDFTLPLAPSGTPFMQRVWKN
    LRTISYGSTATYQDIALASGNPHAARAVGMANHKNPIPLFIP
    CHRVIGSKGALTGYRGGLQLKMVLLELERRGCG

    >gi|194336238|ref|YP_002018032.1| protein of unknown function DUF255 [Pelodictyon phaeoclathratiforme BU-1]
    MVIYRYIVHHATNTRPMTSPENKPNSLIAEKSPYLLQHALNPVAWLAWGEEAFKKARGENKPIFLSVGYSTCHWCHVMED
    ESFENPEIAKLLNAHFVPVKVDREELPDLDRLYMSYVQASTGRGGWPMSVWLTPELNPFYGGSYFPPEERYGMPGFKTIL
    ITITRYWENEREKIISESGSFFASLGAVSRTTPSSQPDAEMAQKKCFEWLEANYDPMFGGFGRAPKFPRPVLLNFLFNHA
    YHTGDKKALRMALHTLHKMAEGGIHDHLGIIGKGGGGFARYSTDQRWHVPHFEKMLYDNAQLAISCLEAFQCSGDNFYKR
    TAEDIFNYVLCDMRSPQGGFYSAEDADTLLTHGSEQKQEGALYLWSADEIRETLADEELATIFSFTYGIRDEGNAEYDPH
    GEFNGKNILMQQATDEECADTFGKTVEEIRAALDDARTKLYHARSRRPRAFLDDKILTAWNGLMISALAKGYQVLHNETF
    LAAAREAANFILETLYDQANGRLLRRYRDGNAAIAGKAEDYAFLVQGLTDLYEASSEVRYLQIALQLAEIQNTLFYDNAQ
    GGYFSTAIDDHTVPLRIKEEYDGAEPSANSISTLNLLRLAEMTGNEDFVRRAEETIKSCRIMLAENSSALPQMLVAKNFA
    EQRKVHLVFSGPLDSSSMNELRQTVYEQYLPGATMSHASKESAHIFPSHAAIIAKEDGNAKVYICIDKSCQPPTENPERL
    AAMLDSQFLHRPDSITW

    >gi|194336239|ref|YP_002018033.1| peptide methionine sulfoxide reductase [Pelodictyon phaeoclathratiforme BU-1]
    MMLVRIMKSALRGKGIAVAAFLLPALLLFCGCAGNNGLSPLPEEPRSTVQLEKGMHFNELTPEEERVIVYKGTERAFTGK
    YSESKERGTYLCRRCDAPLFRSTDKFESGTGWPSFDDALEGAVKQLPDADGRRTEIVCANCGAHLGHVFFGEEITAKNVR
    H
    CVNSISLGFLPEAKAASVTQKAIFAGGCFWGVEYHFNKLKGVLSAKSGYTGGLIDNPSYKQVCTGRTGHAEAVEIAYDP
    ALVSYETLAKLFFEIHDPTELNRQGPDRGTQYRSAVFYTDEEQKKVTEKLIGELRAKGYKVVTTVEKAGTFWPAEEYHQD
    YYEKNGHEPYCHIYQKRF

    >gi|194336240|ref|YP_002018034.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelodictyon phaeoclathratiforme BU-1]
    MSDLYDEQPFYSELNMPLLGDDFPELHVQTTHGPMNIPADLEGSWFVLFSHPADFTPVCTTEFLGFQERMADFEKLGCKL
    IGMSIDQIFSHIKWIEWIKDNMNIEITFPIVAANDKIAMQLGMLHPGKGSNTVRAVFIGDPKGKVRLILYYPQEIGRNID
    EVVRAVKALQIADNKKVAIPANWPTNSLLKDQVIIPPANNIEDAKKRTGMKNCYDWWFCYKPLEE

    >gi|194336394|ref|YP_002018188.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MAKIGVFICHCGENVAAKVDCTRLAAAMGEHPGVAVSVEYKYFCSDPGQESVKKAIRDNNLTGIVIAACSPRMHEATFRK
    ACAEAGLNPYLCEIANIREQCSWVHTDVNMATEKAMDITRSMVEKVKRNNKLQPIEVPVTRRALVIGGGIAGLQAALDIA
    NAGQEVVLVEREPSLGGHMAQLSETFPTLDCSQ
    CIMTPRMVETAQHPNIRLLTYAEVESVDGYIGNFKVRIRMKSRYVDI
    HKCTGCGECMTKCPVKKISSEFDCALGKRTAIYTPFAQSVPNIPVIDKASCIFFKNGKCKVCQKTCQINAIDFEMQDEFI
    DLEIGAIVVATGFQIQNTAVYGEYGYGKFPDVITGLQFERLASASGPTAGKILRPSDGSEPQNVVFIQCAGSRDPSKGVR
    YCSKICCMYTAKHAMLYAHKAHEGKTHIFYMDIRAAGKGYDEFTRRAIEDDEASYIRGRVSKVWQENGKLMVRGVDTLLG
    KPVTVVADMVVLATAMVPQSDAKEFAKIIGIAYDEYGFYNEAHLKLRPVESSTAGVFLAGACQSPKDIPDSVAQASATAS
    KVLALFSKETLEREPVIAMNNEATCAGCWGCVLACPYNAIEKKDIRDRSGRLIKQVAYINPGLCQGCGTCVTFCRSNSID
    LAGFTEKQIFAEVMGL

    >gi|194336421|ref|YP_002018215.1| hypothetical protein Ppha_1334 [Pelodictyon phaeoclathratiforme BU-1]
    MSLFSKKTATLAFVLALLFPIQTMAAEPTIAAAAQPASSVDNTKGLFVILTDEEPMTQMMALVLSTQTIEQGKSVQILLC
    GQAGKLALKYSKQTMFKPINKSPQMLLAALIARGVAVEV
    CPLFLPNVNMSESQLINGVSIAKPPVIAQKMRAEGIKLFTF


    >gi|194336428|ref|YP_002018222.1| OsmC family protein [Pelodictyon phaeoclathratiforme BU-1]
    MKSEMIITIGDGRKVDAEFNGFTIHTDQSVHAGGEGSAPEPFTLFLASIGTCAGIYVSSFCKSRGIPVDGIRLVQSHFTG
    ESGRGIGKIEITIELPPDFPEKYKDAVINAANLCAVKKHILNPPEFVVKTVTK

    >gi|194336549|ref|YP_002018343.1| redox-active disulfide protein 2 [Pelodictyon phaeoclathratiforme BU-1]
    MKKIKILGSGCAKCNQLADAVKAVIAAEGIDASVEKVEDMQQIMAYNILSTPALVVDERVVCKGRTPSYDELKEMLSAKP
    QGCCCGSHGSKENGKSSCC

    >gi|194336616|ref|YP_002018410.1| thioredoxin reductase [Pelodictyon phaeoclathratiforme BU-1]
    MESNVRDIIIMGTGPAGYTSAIYMGRANLKPLVIEGFQPGGQLMITTEIENFPGFPEGIRGPELMAKMREQAAKFGTEFV
    GGSVTEVDLSRSPFCLTLEDGQEFLTHALIVATGANAKWLGIDSESRYRGKGVSA
    CATCDGFFFRDCKVFVVGGGDTAME
    EALYLTKFASHVTLVHRREEFRSSKIMSLRTRKNPKISMMLNEVVDEILGDGQKVTGIRLKNVLTGELTEHPCDGVFLAI
    GHAPNSGLFKDQLDLDDYGYIKTKKSSTETNVPGVFACGDVQDFTYRQAVTAVGTGCMAAVDAERFLETIR

    >gi|194336617|ref|YP_002018411.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
    MSGKYLVATDLNFKSEVLDSDKVVLVDFWAVWCGPCMMLGPVIEELAADYADRAVIAKLNVDENSATAAKYGIRSIPSLL
    IYKNGVVVDQMLGAMPKNMIAKKLDEYIAS

    >gi|194336618|ref|YP_002018412.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
    MVYKKMSGKYLVATDLNFKTEILDSDKVALVDFWAAWCGPCMMLGPVIEELAGDFEGKAVIAKLNVDENPNTAAQYGIRS
    IPSLLVFKNGQVVDQMLGAMPKNIIAKKIDEHIG

    >gi|194336647|ref|YP_002018441.1| heavy metal translocating P-type ATPase [Pelodictyon phaeoclathratiforme BU-1]
    MTTKSYTVKGMHCASCAAIITKKLSKVEGITEVNVNLATETAKLEFDNNSLTAEALNEIVNKYGYSLEAEQPTTERGDVV
    SDAAKKRAEKERELHKQLRKVQFTLPVALLVFFLMMWGIAAMFFHLIPHLPLSMELLNLFFMLISTWMVFRTGAPFLHGI
    VMFVRSGAASMDTLIGIGTVTAYLYSALITLIPPVKAFLHAPDYTYFDTTIVVIGFVLLGKYLEARSKLKTGEAIEKLIN
    LQAKSALVLREGKEIEIPVEEVRRGDLVIVKPGGKLPVDGTIAEGYSSIDESMVTGESIPVDKKAGDKVIGGTINKQGSF
    TFTASNVGPDTVLARIIRMVEEAQGSKAPIQQIADKVAGIFVPVVLILALLTLLIWLTIGSSALGFSAALSYGIMGMVGI
    LVIACPCALGLATPTAIIVGIGKGAEYGILIRNAESLEKLSSVNTIVFDKTGTITTGNPQLTDIIVLHKESTPASLLQMA
    ASVEKRSEHPLAEAIVEAAKKQNLTPGEITKFRAFEGIGVSAFIENRSVTVRKPVESEKKLPELQKLQEEGKTVVIIEES
    GICKGLIALSDTVKEEAKEAIQALHRKGLRVIMLTGDNHAAAKYMAQQVGIDEVIAEVVPRQKAQKIRELQALGKKVVMV
    GDGINDAPALAQADVGIAMATGTDVAMESAGITLLKGDINKVAQAITLSRATMRVIRQNLFWAFIYNSIGIPLAAGALFP
    VWGIFLNPVFSGLAMAGSSVSVVSNSLRLKRIKLS

    >gi|194336852|ref|YP_002018646.1| dihydrolipoamide dehydrogenase [Pelodictyon phaeoclathratiforme BU-1]
    MHSMQQLPEGPGRNVDVAVIGSGPGGYEAALRAAKAGMKVCLIEKGALGGVCVNWGCIPTKALLRSAEVFDLFKKAGSYG
    LKVQASGIDLAEAVKRSRSVVQKLSKGIAFILRRAQVEVIQGEALFSGVHTLDIFRDGVCVETVQSNHIIIASGARSRQL
    PGLEPDGRHIITSREALAMKSVPSSMMVLGGGAIGVEMAWFYAMAGTTVTLVEMMPRLLPFEDGEISEALKRSFEKAGIR
    VVTGAKLEGVVVSEDRVNGLLVVDGEESQPISAELLLVAVGVTGNCDGLGLEHAGVERSRGFIVTDAACRTSVSNIFAIG
    DVRGGMLLAHKASAEAAIAVDSIAGKAPHLLDESMIPRCVYAEPSVASVGLSEEQAIEQGYMVMVGRSLFAASGKANAYG
    NLEGVVKLLFNAVDGRLLGAHVLGHGAVELIGEITLARRLEVTAELLASTVHAHPTLSETIKEAAENALQERRF

    >gi|194336903|ref|YP_002018697.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
    MAQSLHDLIQSSPLPVFVDFWAEWCGPCRSVAPVVKQLAAEFKGRLTVVKVNVDKQPEAASRYQVQSIPALMLFHRGELK
    WRTAGALSYPQLKAEVTKALGI

    >gi|194336937|ref|YP_002018731.1| Redoxin domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MAQITFKGTPVETVGTLPAKGSEAPFFCLVKTDLTEAGPADFGSKRIVLNIFPSLDTPVCAASVRQFNKEASSLDNTVVL
    CISADLPFAHKRFCETEGLKNVVSLSVFRSPEFGRDYGVTLATGPLKGLLSRAIVIIDADGIVRYTEQVAEIVEEPDYSA
    ALKVLA

    >gi|194337047|ref|YP_002018841.1| dihydrolipoamide dehydrogenase [Pelodictyon phaeoclathratiforme BU-1]
    MNKQFDVLVIGAGPGGYIAAIRAAQLGFSVACCEFSAYDDPAGEPRLGGTCLNAGCIPLKALVASSELFEKASHHLAEHG
    ITFGGVNIDVATMQQRKEAIVTKMTAGVQFLFRKNRITLLKGRGSFAGRTDAGYRIMINGKDGEEELLAQKVIIATGSKA
    RQIPNIAVDNVCI
    CDNEGALKFTEAPKKLGVIGAGVIGLEVGSVWRRLGAEVTILEVMTSFLGAADESVSREASKLFLKQ
    GLHIKLGVRIGQAKQTANGVSIAYTDDQGSEHILECDKLIVSVGRTPYTEGLNLEAIGLQTDERGFIPVNDHCATAAPGV
    YAIGDVVRGPMLAHKAEDEGVMAAELIAGQKPHLDYNSMPWVIYTTPEIAWVGKTEQQLRKEGHDYKTGQFPFAANGRAL
    GLGDAEGFIKMLADATTDEILGVHIIGASASDLIAEAALAMEFRASSEDVARTCHPHPSLSEVMREAALAIEKRALNM

    >gi|194337111|ref|YP_002018905.1| heavy metal translocating P-type ATPase [Pelodictyon phaeoclathratiforme BU-1]
    MSDSGLISDEKVRCDHCLQETSRASAITALIDGETRFFCCHGCLGVYELVHSNSLDAFYDKRCDWQPGPPHTSVKLEAAA
    FRDSVTLTDTGSSIELLLSGIR
    CASCVWLIEKFLMKQEGILSARVNYATHKATITWSSDTISLDTILQALHSIGYLPHPG
    RGNSQSDLAAKEKQDLLLRFGTAAFFSMQLMLFIAALYAGFFEGMEARFKLAFQLISWALATPVLFYSGYPFLASAFRSL
    RQWSFTMDVLIALGSLSAYCYSIAMIVQGGEVFFDTSAMIITFILLGRFLEAGSRLKAGNAIAELAELQPHEALLISENG
    ETALVSLDTIKIGDHVEIIPGERIPLDGRVVDGEAEVNESMLTGESNPVLKEAGSNVFAGSFSMNGRLRICVTENASSTL
    LAQIIRTVEDAQARKAPIQGIADKTAGYFVPAIIILSIATFLYWKVIAGSTVIALMNAVSVLVIACPCALGLATPLAILI
    GTTAVGKRGILVKGGDIFETVSKITTVVLDKTGTITTGKPSITDLHDYGLTPALVQHIASLEAASEHPTGRAIVASWQGE
    LLKTVQFRATPGRGVSGIIEGTLWQAGSRAFMAQEKVELQPFQESCASALEAEGKTVVMVACGHKLAGIIGLIDDLRPDA
    LPLIAGLRKKGLSLKILTGDNQGVANYIAAKCGITDVQAGLGPLEKAAVIRDLKAKGMCVMMVGDGINDAPALTEADIGV
    TLGHASAIALESASVTILNDDLRLINTLTESSSRCFSIIRQNLVWAFSYNLIALPLAVSGVLHPIISALLMASSSLVVVG
    NSLRLKNI

    >gi|194337135|ref|YP_002018929.1| nitrogenase-associated protein [Pelodictyon phaeoclathratiforme BU-1]
    MATILFYEKPGCRNNNRQKAMLELSGHTLETVNLLEYAWSKEELAAYLGDKPVADCFNPAAPMIKSGELNPQSFTREEAI
    AMMIQQPLLIKRPLMKIGGHHLQGFDTTILKKLIHLTPPHDEEEMTTSINMSDMNSCPHDKNFSCTTQKH

    >gi|194337169|ref|YP_002018963.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelodictyon phaeoclathratiforme BU-1]
    MSILQEGIPAPAIAAKDQDGKLVTLEEYRGRKVVLYFYPKDDTPGCTKEACAFRDNFPKFNSAGVEVLGVSIDDEGKHKK
    FSEKYQLPFRLVSDPDKRIVEAYGVWGLKKFMGREYMGTARVTYLINEEGIIEHVWPKVTPAQHAEELLNYLQQKT

    >gi|194337177|ref|YP_002018971.1| amine oxidase [Pelodictyon phaeoclathratiforme BU-1]
    MNVSADLSADVIVIGSGVGGLTAAALLQERGISTLVFEKNRYAGGSCSSFQREGYRFDAGASVFYGFGDNSSSGTLNLHT
    RIFRKLDIEVLTIFDPVQIHYHLPGGFSLPASYNQQAFLDALAARFPHESDGIRKFYHELTEVYDILSALPAGSLEDVTH
    LLSVGAAHPLKTMALALKSFRSMGKTARSYIKDEELLHFIDIEAYSWAVQDALATPLVNASICLADRHFGGINYPIGGSG
    AIPDGLCKGIRKFGGRICYQSEVTEILVSNGEARGVRLADGTEYYAKAVISNATVWDTFNRLVIDSRYRVDEKRFLRAPS
    WFQLFLGVDASVIPEGFHMHHILVDDWKSYNQLGGTIYFSAPTILDPSLAPPGRHIVHAFVTGEVEEWQHYERGSSAYLA
    AKDEVAAGIIFRIERILPGLSKAVKLKVLATPLTHERYLNRFKGSYGPLLKPGQSILQKPQNTTPIKNLFAVGDSTFPGQ
    GVIAVTYSGVSCASLIARKFGKPLDPLV

    >gi|194337335|ref|YP_002019129.1| sulfur relay protein TusD/DsrE [Pelodictyon phaeoclathratiforme BU-1]
    MKIGILLKEGPYNHQASDTAYKFAAAAIKKGHTVDAVFLYNDGVTNVTKLMDPPQDDRNIAARWSALSLEHGVEILACIA
    ASKRRGINDDLLIKGGLITGLGTLTDIAIRNDRLVTFGD

    >gi|194337343|ref|YP_002019137.1| Rhodanese domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MLRYLDLVRNCLPGVKEIMPWDLVERIGENPDLLILDVREPYEFALLHIRESVNVPRGILESACEWDYEETVPELVKARM
    REIIVV
    CRSGYRSVLAVHSMQLLGYEHAVSLRTGLRGWNDYEEPLWSSAGSMVEPAEADDYFMAKLRADQRSPGV

    >gi|194337628|ref|YP_002019422.1| Rhodanese domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MSGKPLRRKLIASVLLLSSLSPAASPLHAAASATMAKEETGELDLSATKALFDTQSAFFVDARSEYAYDISHIKGARSLT
    MSRFDEQFPEFSQNKSAETLIVVY
    CIGPRCGNARHVAEKLKKNGYKNVKVFSGGLLEWFHAGFPMEG

    >gi|194337649|ref|YP_002019443.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pelodictyon phaeoclathratiforme BU-1]
    MKKNIDVLVIGGSAAGIVAASTGKAFYPAKSFLVVRREREAVVPCGIPYIYGTLESISQNIIPNAHIEQAGVELFIDEVV
    AVDRTAKVATTADGTQITFDKLVFATGSMPKVPSWLKGTALGNVFTIPKDRDYLENLRIKLEQCTTIVIIGGGFIGVEIA
    DELRKKGKKITVVEVMPHVLNAAFDDDLSVKVEKILTDNGVILRTGEKVSELIGEGVVSEVLLENGERLAADAVILATGY
    APNVELARKAGIKINELGAIRVDEYMRTEDKDIFAVGDCAEKFSFITRIVKGLMLASTACSEARIAGMNLYGLSRLRTFS
    GTISIFSTAIGGTTFAAAGVTEHLALDRGFDVISASAEGIDKHPKSLPDTCSQFVKLIVNRDSGLVLGGAVVGGVSAGEL
    INVIGLIIENKMTIHEVLTLQVGTHPLLTGPPTGYPLIKAAEAVAKKLRSSR

    >gi|194337748|ref|YP_002019542.1| Protein-disulfide reductase [Pelodictyon phaeoclathratiforme BU-1]
    MRKTKMSHYALRRTVAILGLFLVLFLRVSTVFAAEFLDPEQAFRITAELNSARSVVLHWDIAKGYKLYRDQVAVSVESGK
    AELKAPLLPKAIMITDPSTNEKIAIYHDMLHVEVPLVKADGPFVLNVVYQGCAEDGLCYPPITKLFKVDPARPGLLSLAG
    EEAVADPVDNGSADTRNTVDSAPAAQSAASASAKASIKDNDLSLATATLAGGSLWKIALAFLAFGLLLSFTPCVLPMVPI
    LSSIIVGEGDVTRRRSFLMALAYCLGMALVYTSLGVAAGLAGEGLAGALQKPWVLVMFALLLVLLSLSMFDVYQLQLPVS
    LQSKLGKASGGLKRGRFVGVFFMGALSALIVGPCVAAPLAGTLVYISQTRDVLLGGLALFSMAMGMSVPLLLVGLSAGSL
    LPKAGAWMIGVKYVFGLLLIAVAIWMVSPILPASAVMLFWGAFALLCSVFLGLFDASSAKPTIADRFGKTFGLVLFVIGL
    LEIVGAAAGGTNVLEPLSQLQGASSASSGEEKSVGFTRIRTVAELDQALLSAKKPVMLDFYADW
    CVACKEMDRFTFHDPK
    VIEQLGNLTLLQVNVTANSEDDRALMKRFGLFGPPGMIFFDTKGNEIADSRIVGVLEARAFFDHLNKFVMSH

    >gi|194337829|ref|YP_002019623.1| Rhodanese domain protein [Pelodictyon phaeoclathratiforme BU-1]
    MNSAVEVSPETALKMIGEGALLVDVREREEVAEASFDLPGVMLIPFSEFDERFREIPSDREVIIACNLGERSLKATRFLM
    HNGYRNAVNMQYGIVRWAETGFPMKGELKCNCGGCCCGSPSGSLNSTGG