Pelobacter propionicus DSM 2379 uid58255

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118577244|ref|YP_899484.1| heavy metal translocating P-type ATPase [Pelobacter propionicus DSM 2379]
    MSAIPVTRDPGKDPAAQSVTAAIAERCELPLVGMHCASCAGRIEKVLGSAPGVFSSNVNFATSRATVQYDPQATNIESLS
    QVVRDLGYDVIVPKPGGEHAATEDMQEEEGQVRRAEYGRQKVRFIVALILTVPIAVLAMAGHLVPALEDLLNFPGRAWME
    LALTTPVLFWAGREFFSGAWSAARHRVADMNTLVSLGTLSAYLFSVVATVAPQWLSVSAGNGQHPVHGMTSPAGVYYEVA
    AIIVTLILMGRLLEARARNKTGGAIRALMGLQPKMARVERNGIEKDIPIAEVRVGDLVLVRPGEKVPVDGQVVEGASAVD
    ESMLTGEPLAVKKQPGDTVIGATLNKTGSFKIRATRIGKDTVLQQIVRMVQEAQGSKAPIQRLADIIAGYFVPIVICIAI
    ATFVIWFDFAPPETRITMAMFTFISVLIIACPCALGLATPTAIMVGTGRGAQSGILIKGGEALETAHKITTVVLDKTGTI
    TRGVPTVTDILAYDTDEHSLLRLAASAESGSEHPLGESIVRSAEERGLTRIPATGFNAVPGYGIEALVDGQRILIGTALL
    MAERGLEVDQIAAHRLADEGKTPVFMAIDGTFSGIIAVSDPVKEGSHRAIERLHALSLEVIMLTGDNQRTAEAIARQVAV
    DRVLAEVLPEGKNEEIKKLQVQGRIVAMVGDGINDAPALAQADVGIAMGNGTDVAMEAADITLVRGDLNGVVSSIALSRA
    TITNIKQNLFFAFIYNILGIPLAAGALYPLTGWLLSPIIASLAMALSSVSVVSNALRLRGFRVERS

    >gi|118577287|ref|YP_899527.1| heavy metal translocating P-type ATPase [Pelobacter propionicus DSM 2379]
    MTPQHTTLELNIRGMDCSGCARKIEVIAAALAGVTKATTVLADHKLVVLYDSAKTTPDEIRRGIETAGYAIIAEGDEDQI
    VPGCDAQPPRLSNPEGHRVQLRIENMD
    CPTEEALIRNKLKGFPGITGLEFNLLQRILTIYHTLPSLEPVEAALKAIGMEA
    GTVEAHDEIPEVEKTNWRPLIISGGAALAAEIIEVMSTGHHWLTLLLALVAILTGGLKTYKKGWIALRNRNLNMNALMSF
    AVTGALLIGQWPEAAMVMILFALAEVIEAKSLDRARNAIRGLLAMSPENATVQLPDGTWGEVSAKSVALDSIVRVRPGER
    IALDGVVIEGNSTVDQAPITGESLPVDKSPGEPVFAGTINQAGSFQFRVTALATNSTLSRIIHAVEAAQGSRAPTQRFVD
    QFARIYTPAVFAVALAVAVIPPLAFGGVWLEWVYKALVMLVIACPCALVISTPVTIVSGLAAAARRGILIKGGVYLEGGH
    KLAWLALDKTGTITHGKPLQTDFKVFGNFDPKEVRCLAASLANRSDHPISHSIAVAAEADGVMLREVANFSAIAGRGVSG
    LIGGKLYRLGNFRLAKENGFGKPDLISSIDALERQGKSVVLLTDDNQPLALFGVADTIKGSSREAIADLHRLGVRTMMLT
    GDNQHTAEAIAREVGIDEFKGELLPEDKLKAIESLQGNGGTVGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVAL
    MDDDLRKVAVFVQLSRTTATMLKQNIALALGIKSIFLVLTLLGHATMWMAVFADMGASLMVVFNGLRLLRK

    >gi|118577386|ref|YP_899626.1| protein-disulfide isomerase [Pelobacter propionicus DSM 2379]
    MKRKTVAAGFALCAAVAGVGVGVIRAENKPDPNVARAIEELKKQLPNISAPQISESEIPGLFKLVAGQQIMYWSPGGYMI
    VGEMYDVKKGKNITAEQRQEIMKEYETVLSKKVQKMPLDNAVKIGNGKNVVIEFTDPD
    CPYCKKMGKFLDEQKNITRYVF
    LFPLKMHPNAHAKSAYVLSQTDKQEALKRVFSGEFDKKPVPEAIASAKDQVNKNIKLGEELGISGTPTVFVNGSLVRGVD
    FKRLKMLLESGQS

    >gi|118578563|ref|YP_899813.1| glutathione peroxidase [Pelobacter propionicus DSM 2379]
    MPSIYDFEVQTAGGEFTSLAEYRGQVMLIVNTASKCGFTPQYKGLEALYRTYASRGFVVLGFPCNQFGAQEPGDITEIQN
    FCSLTYDVTFPLFAKINVNGSDASPLFQYLKSAAKGLLGSEAIKWNFTKFLVDRHGTVVGRYAPTTKPESLEKDIEAALH


    >gi|118578568|ref|YP_899818.1| glutathione peroxidase [Pelobacter propionicus DSM 2379]
    MPCMYDFEVQTAGGECTSLAEYRGQVMLIVNTASKCGFTPQYKGLEALYRKYASRGFVVLGFPCNQFGAQEPGDMTEIKN
    FCSLTYDVTFPLFAKINVNGSDASPLFQYLKSAAKGVLGSEAIKWNFTKFLVDRHGTVVGRYAPTTTPESLEKDIEAALH
    C

    >gi|118578593|ref|YP_899843.1| redox-active disulfide protein 2 [Pelobacter propionicus DSM 2379]
    MIIEVLGVGCADCVKLYDNARKALEESGRQGEVLKVDGISGLLKYGILSPPALVVDGVVKCSGQLPSAAEIKEML

    >gi|118578594|ref|YP_899844.1| thioredoxin domain-containing protein [Pelobacter propionicus DSM 2379]
    MRSSIAAASVIVILAGTASAELPAANPAAVNQALASGKPTLIDFGLRTCAVCKKMAPYLESVASDYRGRANVLFIDVRTE
    QATAQRFRVQMLPTQIFINPQGKEVQRHTGYMDKEGIVKGLQSAGLK

    >gi|118578641|ref|YP_899891.1| glutaredoxin 2 [Pelobacter propionicus DSM 2379]
    MRRLILASILQLSVTTASAGYYTDSAKGWWWYQKEPEKQAEKQEKKKKPPKSTPSLKDYSYEQVWEMHPDQFQEFAEALK
    KKAVQKPSEENVKEYFEVQEIARKKALAFSNVAQFVWQKYPELTTKKDYPITTPGNLARISQINEERQRILRDNRDDFAL
    IYFQRPD
    CSYCDEQSRILDWFTNETGWTVKRVNISENPGLAAKFSVEITPTLILIQKGNQDYLPVSAGVISADEIEDKAY
    RAVRLLKGDISPEEYSLYEFQKGGSFDVKKRRLQEKERP

    >gi|118578703|ref|YP_899953.1| protein-disulfide isomerase [Pelobacter propionicus DSM 2379]
    MKTANNKKLMVGGLMMVIMTAAGFSMANENLRTEKDALMKTFPNLKMDGFRESPLKGLYEITAGDQVFYFSPEGYLFFGE
    LWTKDGKNLTAEMREKVATERINSLPLDKALKVGNGPKKVIEFTDPD
    CPYCRKVDGYLAKRTDVTRYIYFVPLRRIHPDA
    EKKARYILSQSDRNKAFHDVFTGQLDGKPISIAEDAQQQQLEEMEKIAAGIGIRGTPALWIEGAHVNGADIQLISRLLDE
    GKEVSKPQSH

    >gi|118578922|ref|YP_900172.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelobacter propionicus DSM 2379]
    MSLTTLVTQQAPDFTAEAVMADNSFASITLSSLKGKFVLLLFYPLDFTFVCPSEILAFNRQIAAFKAKNCEVIGISVDSK
    FTHLAWKNTPIENGGIGNIQFPLVQDLDREIAKSYGILLNNSVALRGLFLIDPTGTVRHCIINDLPLGRSVTEAIRMLDA
    IQFSDTHGEVCPANWQEGEEAMKPTTEGVADYLTRFAR

    >gi|118579269|ref|YP_900519.1| heavy metal translocating P-type ATPase [Pelobacter propionicus DSM 2379]
    MNKPATPKTAPLLHIPECGCSRSHERQCHEDAPAHDGEAAHVHVNNDHSCGCCPTASAGSASIFDRNSPSPEGASRVRYR
    INNMD
    CPVEERLIRNRLEAMPGIARLDFNLLDRELTVYHCLADPRAIFSALQKLDMAPELLEAGSSAPVAPAGLGRRRKV
    LLAVAGCAAVAAELIAWTTGQDASWPVMALAALSIASAGLPTLKKGWIAFRNLTLNIYFLMSLAIVGAIITNKWPEAAMV
    VFLFAVAEAIEVLSLERVRQAVTSLSNLAPETAEVRVGNDWLEQPVAGVEVGSRIRVRTGSRVPLDSRVEYGRASLDQAA
    ITGESLPVDKQAGDLLYAGSIVTDGVVEAIVTAGAGDSTLARIASAIQQAQSQRAPTQRFVDRFARYYTPTVVALAVGVA
    VGGPLLLGGTWGGWLYQALVMLVIACPCALVLSTPVTVVSGLAAAARHGILIKGGVYLEGGRLLKAVALDKTGTLTRGKP
    ELTDASALDDMPVEQALLIAASLDEQSTHPIAKALVAGWRRRQPDAGLLAVEAFGALNGHGVRGFIDGQSWHLGNHRLAA
    ELGFASHSLEARVALLEGAGKTTVILCADSGPMALFGLADTVRPESAQAVTLLRALHIEPVMLTGDNSATARAIADQVGI
    WDVRAHLMPENKLTAIAELKERFAAVAMVGDGVNDAPALARADIGIAMAAAGSAIALETADVAIMDDDPRKVADFIGLSR
    HCASILRQNIALALGIKVVFLALALGGQATLWMAVFADMGASLLVVFNGLRLLRFFSRPGHEV

    >gi|118579292|ref|YP_900542.1| Fis family transcriptional regulator [Pelobacter propionicus DSM 2379]
    MRKLIIGTILALSCLAHLSALAAELPSATGSSIRAALSSGRPSVVDFGARSCIPCKKMAPILEELNRELKGKANVLFNDV
    WKDDVLARDYRIQMIPTQIFFNAAGKEVKRHMGFMDKADILKELKALGLK

    >gi|118579293|ref|YP_900543.1| redox-active disulfide protein 2 [Pelobacter propionicus DSM 2379]
    MKIEVLGSGCAKCKTLYEAVKTAVSEKGVEAEVVKVEDMASIMKYGVMSTPALVIDGTVVFSGKSASAAEIQKYL

    >gi|118579295|ref|YP_900545.1| alkylhydroperoxidase [Pelobacter propionicus DSM 2379]
    MDERLRELIAIGASVSAHCQPCLSHHLEKARELGISDEEILAAIETGQMVSRGAMNAMGTFSASLVKPAAAACRCGSSPS
    SSPSSCCA

    >gi|118579299|ref|YP_900549.1| glutaredoxin family protein [Pelobacter propionicus DSM 2379]
    MKIEVLAGCCTTDTTLLDAVHAAVRATGVKADVIKVEEDMASIMQYGVMSTPALVIDGRVVCSGTSPTPAEIQKYL

    >gi|118579420|ref|YP_900670.1| thiol:disulfide interchange protein DsbC [Pelobacter propionicus DSM 2379]
    MLKTSAIILVLTLTISLPSPVLAKTGHGGQCASCHTLTEKEATELIKSFGGTVSSVKHSPAKGLFELMVERDGQKGLLFM
    DYGKKHLIQGMVFDREKLEPAPAHKAEFPRPKQKAPLDVRTIPTAGAVIIGNPEGKKKLYVFTDPD
    CPYCRKGHEELKKL
    ARIAPDLAIYVVLYPLPMHPDSFDKCRAIVEAGSVDILDRVFEGKPVPKPKGEVSRKHIEGNISFANTNGISGTPTLVMP
    DGRIEVGMGDAETMKKMLSSER

    >gi|118579433|ref|YP_900683.1| hypothetical protein Ppro_0998 [Pelobacter propionicus DSM 2379]
    MQDVSREKDENSWIRSLWALEKGRLPADGGAVFNRLIFAASPYLLQHADNPVDWYPWGEEAFETAAREDKPLMVSIGYAT
    CHWCHVMARESFEDPEVAAIINRHLIPVKVDREERPDIDSLYMTAARILTGSGAGWPLTIFLTPERKPFYCATYIPKTGS
    NGVLGIVETVEKISEIWNTNRDLINENSDTVVRALREIVAPVSADTDFGRVLDEAQASLQGMYDYLNGGFGGGAKFPLPH
    NLSFLLRMWRRTQNQDIEEMVAYTLRMMRDGGIYDQLGFGFHRYAVDPEWRVPHFEKMLYDQALIAITCLEAFQAYGDEF
    LKDMAMEIFSFVFDELTSPDGGFCSGLGADSGGGEGYYYLWSRGEIDRNLDGETSRLFCEAFGVTDTGNFEGGNILYQPR
    SVALLARENGLDAGELDRRLETARAKLLEVRAERVRPFRDEKILVAWNGLMVAALARGAAVSGEQRLLEAARSAVRFIAR
    NLHTPAGRLLRSYHQSVASVPAFLEDYAFLCWGMVELYQVDGDPVMLQGALGLARGMLDLFSDAVTGAFYDTASEAEQVL
    VRMKNAHDGAIPSGNSIACLCLLKLGKICGDEALTHAGERCLVSWMGSLAEQPIAHIQMVTALDFFLGPDVEITLIGDRD
    KPGVRELLNVIHRYFIPGLVLRFKGDGDVYPMVGGLPTAYVCARGACRPPVNDAAQLEQLLSEIV

    >gi|118579464|ref|YP_900714.1| dihydrolipoamide dehydrogenase [Pelobacter propionicus DSM 2379]
    MSEEVFDLVVLGAGPGGYVAAIRASQLGMKVAVVEPRPTMGGACLNEGCIPSKALLDSSEHFSMARDKFASHGVIVNPPK
    LDVAVMQARKADVVKKLTDGVAYLFKKNKVQVICGTGRIVRPVAGEPHCVEVTATGATQTVKARKVLLATGGVPVEVPTL
    PFDGTLIVSSKDALEF
    CSVPEHLIVVGAGYIGLELGSVWRRLGARVTVVEMMPKMLPFTDSEVTDALMKILKKQGVEFRM
    ATSVTKVEKVGDKARVSLTAGGKTELVECDKILVAIGRKPVTAGLGLEDAGVAVNDKGRVEVDENYETSVAGIYAIGDLI
    PGPLLAHKASEEAVAFAERLTGMKSQVHYETIPGIAYTWPEAASVGKTEQALKEEQIPYAVGKFNFMGNGRARAMDETEG
    FVKILAHKENDKVLGIHIVGPRASDMIAEGVAVMVYGGTSHDIAAMFHAHPTLAEAIKEAALDVHKSAIHA

    >gi|118579500|ref|YP_900750.1| hypothetical protein Ppro_1067 [Pelobacter propionicus DSM 2379]
    MTSHDSGAHVAKLMNMDKSALPADGGDRFNRLIFARSPYLLQHAENPVAWYEWGDEAFATARSGNLPILLSIGYATCHWC
    HVMAHDGFEDDQVADLLNRHFVCIKVDREERPDIDDFYMTASQVLTGSGGWPLNIFMTPDRRPFFAMTYLPRQRFMELLA
    GIVTLWQQHPGEVEKNCSAIMEGIERLSRGNDHECPVLAELDSLAFEQLSAIHDRTWGGFGPAPKFPLPLSLGWLAGQGM
    NGNQEALEMAQKTLGMIRQGGIWDQLGGGVHRYSVDERWLVPHFEKMLYDQALLAMACLDVCLAGNDPAFLTMAEDIFRF
    VGRELTSTEGAFFSALDADSGGEEGAYYLWTRDDIEEILGRDGELFCRFFDVGEKGNFQGQNILHMPVDLETFCTGEDPE
    RTGEILDDCRERLLEYREERSYPLRDEKIITSWNGLMIAALARGGALGGEQEYIESASRAARFILKNLRRQDGRLLRSYL
    AGPSSTPAFLEDYAFLCCGLIELFEATLDSFWQEQALLLADEMLRLFRDPVRCVFVTVGLDAEQMAGQSPRDSDGVLPSP
    FSRAAHCFIRLGYACDRDDLLDHAHLLLGAPLDDAAENPLSHLGALQALAMLEQEPTIIHFRGQRDSRRIASLLASTRSF
    PLPNLVIRFTETDHEGEALVCAQGSCHGPFPDESSLERQLSRLCGQG

    >gi|118579766|ref|YP_901016.1| methylated-DNA--protein-cysteine methyltransferase [Pelobacter propionicus DSM 2379]
    MVHFQETCLGRIGIAEEGGGISHLFLGGDSVPREMEQGQTPLLREAFQQLERYLAGELTDFSLALMPDGTPFMQRVWQEL
    RRVPYGRTASYRDIATALGNPKAVRAVGMANNRNPIPIFIP
    CHRIIGCSGKLVGYRGGLEMKRRLLELERGRACPQG

    >gi|118580127|ref|YP_901377.1| selenide, water dikinase [Pelobacter propionicus DSM 2379]
    MTDTTIRLTQTVKGAGCAAKLAPGDLDRALCGLDLPVDPNLLVGLERADDAGVYRISDDLALVQTIDFFPPMVDDPYSFG
    QIAAANALSDIYAMGGVPKTAMNVVAFPAKTMDISVLRSVIEGGLDKMREAGVVLVGGHTVEDSELKYGLSVTGFIHPDR
    ILTKKNLQTGDCLILTKPLGTGIVSTAIKAGLAGSDLTERVIRNMTALNRDAALVMGDFTVHACTDITGFGFLGHLAEMV
    VDSGCGVRIIAADVPHYPEALEWADMGLIPGGAYNNRDFRGMFVDFGAAVSRRFRDLLFDPQTSGGLLIAVAPNEAEQLV
    AALKATGIECAAVVGEVVEEPLERIVVE

    >gi|118580354|ref|YP_901604.1| rhodanese domain-containing protein [Pelobacter propionicus DSM 2379]
    MRREAIVDELLRKHALDYLGSGNYIVDPDIFLDQEDVVFLDVRTREESESIAIQLKHHSNVSSMNIPVHELPERIDELPI
    DKAIGIF
    CPANVRSTLAYVYLFSKGYTDVRIIVGGYIALTEALKPGKILNAVRRSAG

    >gi|118580390|ref|YP_901640.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pelobacter propionicus DSM 2379]
    MSKRIIVIGGSAAGPKAAARAKRLDPSAEVTIIQKAPEMSMASCGYPYFVAGVFNNRNALISTPYGEVRDPNFFVNTKGI
    RARTETEVTAIDRTQRTVTCRDLKSGVLDQLSYDKLIIATGAKPRKPPVPGIDLEGVTTLQSMRDADFLRRIRDEGAVKK
    AVVIGGGLIGIETCEALQLSGIDITVIEMLPQILMFLDWELAEILENHVRSKAANVITDVKLAGFLGENGRLTAVRLENG
    TELPCELAVLAIGVIPNTDLAQAAGLTIGATGGILVDEHLRTSDPHIYAVGDCIELVQRITGGKTRAPFGDLANLEGRVA
    GENAVLGDSVTFPGTFHTGICKVFDFNAGSTGLSEGKARQEGFNVATVINASLDKPEFMGAKLLISKMVVDADSGRLLGV
    QCVGPGDVGKQIATAAMALLGKLTVADLVNADLPYAPPFSLAIDHFIATAHLMENKLKGRLNGIGPVQLKEKLDRGETPF
    LLDVRTPDEFDMMRIGIGETLIPLGDLRRRLADLPQDREREIVCY
    CKISLRGYEAAILLQAAGWKNVKVLEGGVMAWPYR
    REK

    >gi|118580394|ref|YP_901644.1| protein of unknown function DUF395, YeeE/YedE [Pelobacter propionicus DSM 2379]
    MDENNDRGWNPYLAGALTGIVSTLSLWVSGKYFGASTTFVRTAGMIEKSIDPERVGTMAYFIKEAPKIDWQWMFVLGVFF
    GSLIASTTSGSFHWKALPDMWQARFGPSRSRRALAAVVGGIIAMFGARLADG
    CPSGHGLSGTMQMAISGFIALACFFLGG
    MLVARLLYGGGGKQ

    >gi|118580422|ref|YP_901672.1| redoxin domain-containing protein [Pelobacter propionicus DSM 2379]
    MKKRLCLLALAILAALTMACQRNEQGIEGAAFTAAENRPAPEIVVSDLNGGSLRLSQLKGKVVLLNFWATWCPPCREEIP
    SMMRLNASMAGKPFQMVAVSLDEGGKTAIEEFFRAHGFLLPAYTDAQGKAASVYGVSGVPETFVIDKSGIVVKKIIGPLA
    WDAPDTIAFLEDLMKK

    >gi|118580507|ref|YP_901757.1| methyltransferase type 11 [Pelobacter propionicus DSM 2379]
    MNRVDDRTRIGRGFHRQAGEYDRHAVVQKRVVTNLTRLVQSHCDAAPGSALDIGCGTGAMLSALAGLYPTARLCGLDLAF
    NMALRSAQRLGPAAMLVNGDAESLPFGSACFDLVVSASTLQWVQRLDSCFRECQRVLAPGGLLCAAFFGGKTLWELQESY
    REALADRFSRDD
    CRGGRLQRFRSATDVRQALEGLGFDQVMVATEIEMEYHPDVPALLRSIKGIGATTPARTGTGGGLGWR
    GLLTAMADTYRSRFQRDGMIPATYEVMYIVARKSDDIP

    >gi|118580916|ref|YP_902166.1| nitrogenase-associated protein [Pelobacter propionicus DSM 2379]
    MAKVIFWEKPGCQGNARQKEILLASGHELEVRNLLTEAWTEEELARFFGSRPVAEWFNMTNPKVKAGEIAPSRVGREEAL
    EMMVAEPLLIVRPLMQVGGERLAGFDVGMVHNWIGLKSEAVGDRDPKNCPCVQSQAA

    >gi|118581305|ref|YP_902555.1| heavy metal translocating P-type ATPase [Pelobacter propionicus DSM 2379]
    MTTTVMSITGMSCASCATRIEKAVTALEGVSTATVNLALQELVVTHDESSASADMISGTVEKLGYAVARPKPAGELTFGV
    RGLH
    CASCVNRLEAKLKQEPAIDSAMVNLATETAFVRFDPRRLDMAAIFALVSDAGYTPVEVRQEDTAARDDLRSQRNWM
    IFSLLLSLPIMFTMGMHHNRAVMQLNCLLATALQFSAGLVFYRGAWAALRNGSATMDLLVALGTSAAYVYSLLSYSGLLG
    PGHAVFFETSAMLIAFIRLGKFLEARARGKAGEALKRLLHLQSDRARLLTDEGEKEVPASLVRIGDMLLVRPGEIIPVDG
    EVVEGSSAVNESMVTGESLPVLKEAGDSVTGATINTNGVLRVRATRIGEETLLSQIVRMVREAQGDKAPIQRFADTVSSW
    FVPAVIILALITFSTWFLVLQAPFLTAFTFAIAVIVIACPCAMGLATPTAIMVGSGVALGRGILVKRGSALEIISRLEVL
    LLDKTGTLTTGIPTMTDLIPIRGVDQDRLLECLATAEACSTHPLSQAVLRAAAKAGIQPGQGGDIQEQAGYGITCSYAGF
    HLAAGNERLMEQEGVNLTPLAERSAELAQAGKSLIFVAAQGTLVGLAAFADTLKPHSKQAVQELRSMGIRTCMITGDHRD
    VATIVAEQVGVDQFEAQVLPERKQDLVKQYQQGGVITAMVGDGINDAPALAQADIGIAIGGGTDVAKETGDIVLMRDDLL
    DVVRAIRIGRATLAKVRQNLFWALAYNVLGIPVAAGLLSPLGITLKPEYAGLAMALSSVSVVVNSIMIRRVEREL

    >gi|118581306|ref|YP_902556.1| redoxin domain-containing protein [Pelobacter propionicus DSM 2379]
    MSERTVTFMGNPLTLLGSELKVGAKAPDFFVLDNGLAPVTLANYAGKVKIICTVPSLDTPVCDTETRRFNQEAANLKGDV
    VVLTISQDLPFAQGRWCGAAGIDRVITLSDYRDRAFGSAYGVMIKELMLLARAIFVLDASDTIRYIQLVPEITHEPDYAA
    VLEAAKALL

    >gi|118581348|ref|YP_902598.1| rhodanese domain-containing protein [Pelobacter propionicus DSM 2379]
    MPGFVTRLLLVTFMLLLPLTSARAETASKPSEELVIDVRSEAEWRQGHLENAILIPYDRIGTDIARFTGDKNARLYLYCR
    SGRRTAIAAKALTRVGYRNLVNLGTMENAARTLKRRIISETAAP

    >gi|118581353|ref|YP_902603.1| bifunctional methionine sulfoxide reductase B/A protein [Pelobacter propionicus DSM 2379]
    MKDKPAAYQKAEPDQLKKRLTPEQYRVTQQCGTEPPFQNAYWNNHDPGIYVDVVSGEPLFSSLHKFDSGSGWPSFSQPLE
    KEQITSREDTGQGMGRTEVRSRDGDSHLGHLFNDGPAPTGQRY
    CINSAALRFIPAGKLWSEGYGLYAPRFEAAGVKTDAP
    ECETTVLAGG
    CFWGMQDILRTIPGVVSTRVGYTGGHLKNPRYEDTHDSKSGHAESVEIVFDPRRLSYEELLATWFFRMHD
    PTTKDRQGNDQGSQYRSAIFYTSELQRTIAERVKRTVDRSGKWKAPLVTEIVPATTFYPAEEYHQDYLLKNPGGYSCHYL
    RD

    >gi|118581372|ref|YP_902622.1| protein-disulfide isomerase [Pelobacter propionicus DSM 2379]
    MIRALVALLLVAGLCLAAPLQAAELDFAKALKIGSGPKVVVEFTDPDCPFCRSASRYLDGRGDVTRYVFFYPLARHPRAR
    EKVGYILSRKDGERAYHQVMSGALDGAATLASTPRGNRLREEQLMIATRAGVTSTPTFMINGRILTGFDRARIEELLGK

    >gi|118581405|ref|YP_902655.1| redoxin domain-containing protein [Pelobacter propionicus DSM 2379]
    MSLEGKKAPDFTLEGSDGKQHSLSEYAGKTVVIYFYPKDNTPGCTKEACGFRDNHGKLDANNIVLLGVSKDSIASHNKFI
    SAFGLPFVLLSDPETTMMQAYGAFGEKVACGRKTVGIIRSTVVIDADGIVKKQWPKVAKAEQHPAQVLDYLNIP

    >gi|118581728|ref|YP_902978.1| thioredoxin reductase [Pelobacter propionicus DSM 2379]
    MDSTHHPLLILGAGPAGYTAAIYAARANIVPTLITGLQPGGQLTTTTEVDNWPGDYQGVQGPELMERMRLHAERFNTRII
    YDHITRADLGRRPFLLEGDSAAYTCDALIIATGASARYLGLPSEQAFLGKGVSG
    CATCDGFFYRGKDVAVIGGGSTAVEE
    ALYLSNIARHVTIVHRRDEFRAEKYLANLIIEKSKNGNITIEWDHVLDEVLGDASGVTGMRIRHKSGQSTKEIPLHGVFI
    AVGHSPNTKIFEGQLEMDNGYIRTKCASVEGNMTATSVEGVFAAGDVQDYIYRQAVTSAASGCMAAKDAEHYLAALRH

    >gi|118581766|ref|YP_903016.1| glutaredoxin [Pelobacter propionicus DSM 2379]
    MRRIVPYSAVVLFLLLLARWRVGRKFYYPDRTVYATPANQWLENDHKNRAEPQEQCPPREGNEMKTVLMTMTMALLAVPF
    GWANGTSGTETTAGNSFAVAQATVPAPSSDSRRFSGTVELYITDW
    CGYCKRAVAYMKARNIPHVVYDIEKDEAARKRFLQ
    LGGSGVPLIMVGNRRMSGFSPELLEQYLGNR

    >gi|118581780|ref|YP_903030.1| thioredoxin [Pelobacter propionicus DSM 2379]
    MASDKVLALNDANFERDVLQSDLPVLVDFWATWCSPCKAIAPLIDAVADEYAGKIKVGKVNVDENPSTPGKYGVRGIPTL
    VLFKGGVVVDQVVGAIPKSQLEALIAKAF

    >gi|118581781|ref|YP_903031.1| redoxin domain-containing protein [Pelobacter propionicus DSM 2379]
    MGLVRLLRRHAPALLVLLILFPAAAHTVPLAGQPSPPFKAITTTGQEVSLDTYRGHVLLLDFFATWCIPCRVSVPHVVEM
    KLKYGRQGLQVLGLSADDDGGEAFRSFVNELRINYPLAPASQAVQSAFGIRSLPVMLVIDSRGVVREIYRNFNDEVGRSM
    ELLIRRLLTEQ

    >gi|118577401|ref|YP_899641.1| glutaredoxin [Pelobacter propionicus DSM 2379]
    MRKRLVLTAILLLATTNTCFGSYFEDSGKGWWWYDREPPKQDEEKKEEKPADSPKKGRKYKSLKGITEEKMWNMDPQDLG
    ELWDDMRARAFRKPTESNVRDFWRVNEVTRKKAYAFTSASDFTWQRNPELTTKGDYPISTPGRSAQVAMSEAEKRQTLAN
    NQHNYALVMFSKPG
    CRYCSEQEGILRWFTQSTGWTVKTVDISQNPSMASRFGVTITPTIILIQKGNQDFFPVTAGVASAD
    EITERTYKAVRYLNKETTPEQFDLYDYQRGGGYDVGKKRR