Pelobacter carbinolicus DSM 2380 uid58241

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|77917678|ref|YP_355493.1| NAD(P)H-nitrite reductase [Pelobacter carbinolicus DSM 2380]
    MKIVTVGTGMAAAEFVQQLRQGGFAGEIVMCSDEPHAPYSPCVIPYLLAGEPADNVYWKGRDFYARYQVTPRLGEKVVEI
    DREAGLLRTASGRIENYDRLFYAAGSRSWFPRPEWLEAEGVFGFKTLSDMQSIDRYIGEHGVQRAVVVGGGFIGVDAALA
    LRHRGLQVSLVHCHERLLERMTDADGGRFATDKLQQRSGIAFYMQSEVEALDCNGGQLQRVWLQNGTALETQLLIVATGF
    VPNSALLSGREEGIAVGDDLLADPRILVAGDVAVTRHAIDGPDGLYATAPNAIAQARVAAANILGGVERYAGSLNANVLR
    KHIDFPVVSAGRFEGESVTFSNDRLFRRVYLCDDRINGYILVGDTRLAGYIYDLYVSRQPVADKIQGILADIRGESYYRS
    LMGLAPVAPAC

    >gi|77917732|ref|YP_355547.1| thioredoxin reductase [Pelobacter carbinolicus DSM 2380]
    MQDTLFDVLIIGGGPAGLTAGLYTSRADLKTVLVESMMVGGQVITTTKIENYPGFPGGVDGPELMQRFHEHCQEYGLQIM
    QGEVQQLNDKGEVKEVVVDGKAIKARTVIVATGAEPRKLGIPGEKELVGRGVSY
    CATCDGAFFRNVPVAVVGGGDTAAEE
    ALFLSRFASKVYLVHRRDALRATRILQERIFANDKIEVVWDSVPEQVLSDNRGVNGLEIKNKVSGDKSVLELEGVFFAIG
    VIPKANFLAEILDLNPEGYILTDAECRTSMPGVFAAGDVRSKSLKQIATAVGDGAVAAIAAEKYLDEQ

    >gi|77917801|ref|YP_355616.1| putative thioredoxin [Pelobacter carbinolicus DSM 2380]
    MKKIQILGTGCKKCQTLLENAETAAKQLGIEYELVKVSDIKDIAAFGVMMTPALAVDGEVKVAGKVPKAEDLKKYLA

    >gi|77917839|ref|YP_355654.1| SAM-dependent methyltransferase [Pelobacter carbinolicus DSM 2380]
    MPYVCPLNKPNLYESLALRKATGPAIRPGGLSVLEEVLERYPFNEGARVLDVGCGMGTSVAWLRSRCGLRASGMDLSRAL
    LSEGAQQESRLPLVQARAERLPVADNCCHGVICECVLSLVSDAKRVLSEFYRVLTPGGLLIMSDIYRRNPLDSDQSLPCA
    S
    CFSGASGREGVLRWLTDTGFTLHLWEDHSHLLRELAAKLIFMHGSMSAFWEQFAGETDGSKMEQAVQAMRPGYYLIVAG
    KA

    >gi|77917853|ref|YP_355668.1| glutaredoxin 3 [Pelobacter carbinolicus DSM 2380]
    MKKIELYTKSHCPYCRRAKDLLHIKKAIFVEYDVTNDPAKEQEMRERSGRMTVPEIFIDESLVGGCDDLYALEQQGILDG
    MLRD

    >gi|77917876|ref|YP_355691.1| SoxR-reducing system protein RsxE [Pelobacter carbinolicus DSM 2380]
    MKLWAIFSSGLWRNNAIFKLVLGMCPTLAVTTSAMNGLGMGLATTSVLLCSNMAVSALRTLIPAKVRIPAFIVIIATFVT
    VVQLLMEAYAFELYQALGIFIPLIVVN
    CLILGRAEAFASRQPLWASAADGAGMGLGFTLALVMLGGVRELLGAGSLFGLQ
    MTGAGFHPMLLMILPPGAFLALGFLLAAINGWKNRKRSISER

    >gi|77917881|ref|YP_355696.1| NADH:ubiquinone oxidoreductase, RnfA subunit-like [Pelobacter carbinolicus DSM 2380]
    MKNLLLILIGAVLVNNFVLARFLGLCPFLGVSRKVETALGMGMAVTFVMVVASGCTWVLQYLVLTPYHLDYLQTIAFILV
    IATLVQMVEMIVRKSSPVLYQSLGIFLPLITTN
    CAVLGLAVLNIQQGYSFVQSLVFAFGGAVGFTLALVLFAGLRERLRL
    CPVPAAFRGTPIELITAGLLALAFMGFAGLVPG

    >gi|77917912|ref|YP_355727.1| hypothetical protein Pcar_0297 [Pelobacter carbinolicus DSM 2380]
    MKATDNTTTGPGWNFDNSYARLPDYLYTRLDPTPVRAPQMAIFNSSLSDALGLATNTLAGDEGVAIFSGNRIPEGAQPIC
    QAYAGHQFGYFTMLGDGRAHLLGEHITPTGQRFDIQLKGSGRTPFSRSGDGRAVLGPMLREYIISEAMHALGISTTRSLA
    VVTTGEPVYRETPLPGAILTRVAASHIRVGTFEYLAAQGNRDGIRTLAEYTIHRHFPELLQADNPFLALLQTVLEKQVEL
    VVRWLHVGFIHGVMNTDNMALCGESIDYGPCAFMDSYDPDTVFSSIDQDGRYAFARQPAMAQWNVTRFAETLLPVLHDEG
    EKAVELANRSLATFPDIFQRLRMDGMRAKLGLFTKEDADMSLMQDLLTCMQQNQADYTNTLRDLALETLPDTPFFREPSF
    TAWHQRWQTRLTRQEEPVEASRALMRAHNPAFIPRNHRVEEALAAAQERHDFTVLEKLLEVLSRPYDDQPEHAEYRQPPP
    PSEKPYQTF
    CGT

    >gi|77917939|ref|YP_355754.1| fumarate hydratase [Pelobacter carbinolicus DSM 2380]
    MTATRIEKDSMGTMEVPASALYGAQTARALANFPISGQRFSRPFIHALGLIKRYAAQANLELGMLDEQRATAIMQAADEV
    INGELDEHFVLDIFQTGSGTSTNMNANEVIANRAAQILGQAAGSRAVHPNDHVNLGQSSNDVIPTAMHIAAALEIRNSLV
    KALFDMQEALGEKALAFNDIIKIGRTHLQDATPVRLGQVFSGYARQLALAIRGIERAQDDLLELALGGTAVGTGLNAHPQ
    FATRAIAAISDQTGLEFREASNHFEAQAAKDAVVAASGALKRGACALFKIANDIRLLGSGPRCGIGELQLPPVQPGSSIM
    PGKVNPVMAESLMQV
    CAQVIGNDAAIALGGLSGNFELNVMMPVMAHNLLQSITLLTNASTQFTRRCLQGLEADRARCESL
    VEQSLAMCTALAPVIGYDQAADIAKQAFASGRTVREVALEQQVLPEEKLAQVLDPRPMTEPGIPGKTR

    >gi|77917962|ref|YP_355777.1| dihydrolipoamide dehydrogenase [Pelobacter carbinolicus DSM 2380]
    MADEIFDLIVLGAGPGGYVGAIRAAQLGMKVAVVESRPTLGGVCLNEGCIPSKALLDSSEHFALARDKFDMHGIEIPAPK
    LNLAKMMERKEGVVSDLTGGIAFLFKKNKVTWIKGRGKLLGAGGDGLQQVEVTGKNAGVVKGKNVLLATGGKVAQVPGIT
    VDNDVIIDNVGALSIDKVPEHLMIIGAGYIGLELGSVWLRLGSKVTVVEMLPKMLPKTDADTTQALQRSLKKQGMTFNMG
    TTVGGIEVSGGKATVKLVKNDKEKEVVCDKVLMSIGRKPNTDGLGLEELGVEMGERGTIKVDDNYATNVPGIYAIGDLIP
    GPMLAHKASEEAVVFVERLVGKNSEVHYGTIPGVCYTWPEVASVGKTEQQLQEEGTPVKVGKFNFVGNGRARAMAETEGF
    VKIIAHAENGQVLGVHIFGPRASDMIAEAVAVMSYGGTAHDIGAMFHGHPTLSEAVKEAALDVDGAAVHC

    >gi|77918041|ref|YP_355856.1| hypothetical protein Pcar_0426 [Pelobacter carbinolicus DSM 2380]
    MPTRSGCLLKNLLLRLRTDRTGRWLCLLPVCIALAVYLALVCPSCLYASGQLNGLDYETALQKGKDAQRPLLVFFTTPWC
    YQCTEMKRKVFQNKDIISILNERFFLVEVDISKNTKLKEDFRIYYTPTTVFLDIHGKPIMEEKGYIPTKRFRKLLRYVSN
    GYYKTIAFSDFEKK

    >gi|77918042|ref|YP_355857.1| hypothetical protein Pcar_0427 [Pelobacter carbinolicus DSM 2380]
    MKGIKLILVALTAFVTLATFTAPVTAAEHGVHWLTYEQGLKKQKELQKPMLLLFHLPYCYRCKEMERKVYQDPEVISFVN
    QHFIPVEVDLDKEKPTAKLFEVDYTPTHIFIAPDGSAVLREKDVIAKSQFERMLEFVAEQKYKTMNFDAYEKCRP

    >gi|77918044|ref|YP_355859.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Pelobacter carbinolicus DSM 2380]
    MAKYLIVGGVAAGMSAAARLRRLDETAQITVFERGEYVSYANCGLPYYIGDEIKERERLVVQTPEALRELMDIEVRTSNE
    VLAIDPAAQSLKAKDLKTGREYEETYDKLLLAPGGSPVKPPIPGSDHPAIHTLWTIPDTDTIRAMVDGGKVKKALVVGAG
    FIGLEMAENLKYRDIDVTVVEMAKQAMNVVDFEMASMVHREVAMHGVDLQLEDGVSEFTPGANGGVVAKLSSGKTIEADL
    VLLSIGVKPNTAFLADSGIELGKRGHILVDDSLKTNQKDIFAAGDVIEVLHPLTRKQTAIPLAGPANKQGRIAADNMHGA
    KPRTYNGTMGTAIAKIFDLTIGMTGASEKLCLSHDIPFDSVIIHPNDYAGYYPGAMKMCLKLLYSPETRKVLGAQGTGYS
    GVDKRIDVIATAIKADMTVDDLTEIEHAYAPPYSSAKDPVNMAGFVAQNVLEGLIKTVKWTDIETNPAEYFLLDVRTPAE
    CASGVMPGSVNIPQAELRNRLDEVPRDKKVVLY
    CRVGLIAYQAARVLAGKGFDNVYNLSGGYETWNVSVTRHKAVKTTPT
    QQTEHKVIPMTQPSNATPSKIVEVNACGLQCPGPVMRLKKEMDVLQPGEALSITASDPGFMNDAPAWARSTGNVVRDISV
    QKGIVKAVIEKAGQAPEAVPVAAGNDKTIIVFSGNLDKVIASFIIANGALAMGRKVTLFFTFWGLNALRKPSKVKGLRKN
    IIEKAFGWMMPRGSVKLPLSNMNMGGMGSKMIRGIMKHHNVPALEEMIEMAIQGGVNIVACQMSMDLMGIRKEELIDGVQ
    SGGVAAYLEASESSDNNLFI

    >gi|77918126|ref|YP_355941.1| nitrogenase-associated protein [Pelobacter carbinolicus DSM 2380]
    MNFSACCTNEGGPVAKVIFWEKPGCKGNAHQKEILLASGHELEVRNLLTEPWTKVELAQFFGDRPVAEWFNMTNPQVKAG
    EIVPAKVSREDALAMMVAEPLLIVRPLMQVGEQRMAGFNVEAVQNWIGLKSETISAPDPQNCPCVNSEG

    >gi|77918446|ref|YP_356261.1| NADH dehydrogenase I, F subunit [Pelobacter carbinolicus DSM 2380]
    MGSLKEVRSSIEEAYKKKLDRPRIIVGLGTCGMAAGGTKVMAAIETEVEKLGLDVDLDFTSCIGMCYAEPVVEMGLPGAA
    SVVYGGVYPEDVAQLIESHMVNKTPVTDKAEIQISAGGATYEGIPVMEKSPYYEKQVRSVTSRLGRTNPERIEDYIATGG
    YAGLEKALTMEPQEIINQVKISGLRGRGGGGFPTGTKWQFVADAVGDKKYIVCNADEGDPGAFMDRSVLEGDPHAIMEGM
    MIAGYAIGANEGVIYCRAEYPLAIKRLNMAIAVAEEMGILGDNIMGTDFNFKLRIKAGAGAFVCGEETALLNSIEGKRGM
    PRVRPPFPAHKGLWQKPTCLNNVETFANIPFIVRNGGDWYASMGTEKSKGSKVFCLTGKINNTGLAEVPMGITLREVVFN
    IAGGIADGKKFKAVQSGGPSGGCLPAEQLDLPIDYDSLISGGAMMGSGGLVVMDEGTCMVDVAKFFLNFTQLESCGKCTP
    CREGTKRLLEILERICDGLGVPEDIDTLERLAKTIKTSAL
    CALGQTAPNPVLTTLRYFRNEYEAHINEKRCPAGVCPELL
    TYAIVEDKCVGCGVCIKACPVGAITGEKKAAHTIDASKCVKCGACVPKCKFDAIVQA

    >gi|77918496|ref|YP_356311.1| putative oxidoreductase NADH oxidase subunit [Pelobacter carbinolicus DSM 2380]
    MKHLIIGNSAAGTAAAEAIRENDPTAEIVMLSKDATFFSRCQLHLVASGKRPSAKTRFVPQNWAEHYGIEVRFGQHATAV
    NALQKKVLCSHGENIDYDRLLLATGASSLTPPIEGIEGPGVFGLRNLEDAEGIYKQIMGRRHVAIIGAGLVGCELAEALV
    EAGHTSVTIIEIAPHPLPLQLEERTGERMLRLMVDHGIDMICRDSVTAILRDSQGEPTAVRLKTGREIPADLVVCAAGVR
    PNIDLFAPLGAIGHRGIVIDSGGRTSVPDIFAAGDVTESCDSTVGRVMPSAIWPAARRQGRVAGINMSGGDESLTEHTGL
    KTSAVLCGTPLVSLGPVFDPHPSWQKQIYEHTDSRGRLCTKVCYSDQNGSLAAAVLWGDISLSGLYAEAIIHKHPLGDLA
    PSAIPDYRLQAVV

    >gi|77918521|ref|YP_356336.1| transcription regulator ArsR [Pelobacter carbinolicus DSM 2380]
    MIPDSRTLKKSIYGHLARVGKALSSPGRLHIIDLLCEGPKTVEHLAEETGMKFANTSRHLQTLLEARLVEFEKRGLYSYY
    QISDPLVMSMFHSMQELGENLIKDIKELVEDIYGKNSKIEHVDCKDLVKRMQRGKVTLIDVRPKEEYETDHIVGASSIPL
    EELEEHLASLSPDQEIIAY
    CRGRYCLLSVEAVSILKAKGYHAVRLDEKCMDLCEINEAG

    >gi|77919087|ref|YP_356902.1| dihydrolipoamide dehydrogenase [Pelobacter carbinolicus DSM 2380]
    MNKKVDVIVIGAGSAGLAAVRQIEKTTDNYLLIDQGPLGTTCARVGCMPSKAFIKVARDFHGATRLAQAGLTGTAPADCD
    IPAVLEHVRRLRNRFASGMVEVTRKLAGDRLIKGAARLLGPNRVLVNDEEITCSSIILATGSRPTIPEAWRGFSDRILTA
    DTFFEQQDLPRRIAVVGLGIIGLELGQALARLGIEVTGFGRNPHICGIRDPEINRVALETLGRQFPLHVGDEAEMTPAGK
    TLRIRNGFHEVEVDAVIAALGVTPNMDNLGLENLGVPLDARGLPPYHPYTTQIGDLPVYVAGDANGCLPILHEAQDEGFI
    AGRNATGTQIQKYRRRAGLKIVFTDPQVAAVGQTLNKLEDADIIVARADFSEQSRAIAEGRNAGLMHLYVNKADARILGG
    EMIVPDAEHLAQLLALAIHREMTVHDMLTMPFYHPTVEEGLRTALRDAARQLHHMHSKEELTLCESCPELPLC

    >gi|77919178|ref|YP_356993.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Pelobacter carbinolicus DSM 2380]
    MDKKKHIVVIGGSAAGPKTAARAKRLDQDAEVTIIQMAPELSMASCGYPYFVGGVFNDRNQLLSTPYGEVRDPDFFWNTK
    GITARTSTEVTAIDREKRLVTCRNLETNDIDQVPYDKLVIATGATARKPPLPGIDLEGVTTLQSMKDADFLRKIRDDKDI
    TNAVVIGGGLIGIETCEALQLSGIDITVVELLPQILMFLDWELAKILENHVKSKAANVLTDIGVAEFIGKDGKLTAVKLA
    NGTELPCNLAVMAIGVQPNTRLADEAGLKIGPTGGIEVNPFMQTTDPNIYAVGDCVEINHRITGARTRAPFGDLANLQGR
    VTGENVVLGNTAQFPGTIHTGICKVFDFSAGSTGLSEANAKAAGYENIVTVINASLDKPEFMGAKLLISKLVADGRTGKI
    LGVQCVGPGDVSKQIATAAMAILGNLTVHDLVNADLPYAPPFSLPIDHFIASAHLLENKMKGRLNGISSLEMKKLLDSES
    TPFILDVRTPDEYNMMRIGIGETLIPISDLRNRLQDLPQDKDQEIVCY
    CKISLRGYEAQRLLEAHGWKNVKVLEGGVMAW
    PFGREK

    >gi|77919195|ref|YP_357010.1| copper-translocating P-type ATPase [Pelobacter carbinolicus DSM 2380]
    MSTTKRMKARELGIRGMNCASCVGQVEKAIRSVPGVLNVTVNLAMQRAKFELSENPANVAAVIKAIRAAGYEPVLHTVQL
    GIDGMS
    CASCAGRVERALKTVPGVLEATVNMATKIATVNTLFATTPSATFIEAVRTLGFSAEEIGKSPDRVDRERETHER
    EVGTLKRAAIVAAMFTAPLFILEMGSHFVPGLHYWLMDTIGRSNLFYLFFVLATMVQLGPGRRFYSKGWPALQRGAPDMN
    TLVMLGASAAWGYSVVATFFPAALPAGTVHVYFEAAAVIITLILFGRYMEAIARGRTSEAIKRLMCLQAKTARVVRGGEE
    MEIAVEKVCVGDTVLVRPGEKIPVDGEILDGESYVDESMVSGEPIPSLKEKGAAVVGATINKTGSFTFRATKVGADMLLS
    QIVRMVEQAQGSKLPIQALADRVTTWFVPAIIAAALVTFGTWLLLGPAPALTYALVNAVAVLIIACPCAMGLATPTSIMV
    GTGRGADMGILFRRGEALQTMRDAEVIAMDKTGTLTRGRPELTNFAAAEGWESGEVLRLIASAERLSEHPIAEAMVKGAK
    DHGLPLAEAQNFKAHPGLGLSARVEGRRIEIGADRYMKQLGIDLRSFGQTAEQLGDEGKTPLYAAVDDRLAAVLAVADPI
    KDSTAAAIEALHRAGLRVAMITGDNRRTAEAIARRLGIDEVVAEVLPDGKVEAVKGLQKEGRKIVFVGDGINDAPALAQA
    DVGIAIGTGTDIAMESAEVVLMSGDLRNVPNAIALSRATIRNIKQNLFWAFAYNSALIPIAAGALYPAFGVLLSPVIAAI
    AMAASSICVLGNALRLRRFRPPMRAEIRQEAGHG

    >gi|77919363|ref|YP_357178.1| hypothetical protein Pcar_1765 [Pelobacter carbinolicus DSM 2380]
    MTNSQDRENLVSRLSEIDTSLLPPDGGDRYNRLIFESSPYLLQHATNPVDWHPWGQQAFDLAREQNKPVLVSIGYSTCHW
    CHVMEQESFEDREVAEVLNKLFIPIKVDREERPDIDNLYMTACQLVTGGGGWPLNVFLTPDKAPFYAATYMPRRPRGQMP
    GIIAILTKIGAMWQSDRDQLLQTGREIGETLIRLESSAAPVASSLTEAPLTEAFERFKANFDHERGGFGKAPKFPMPHNL
    SLLFHIAQRFGQETAEAMAIKTLQHIRLGGMYDHIGFGMHRYSVDAFWRVPHFEKMLYDQALVTLAALDAYQVTHDTFFE
    SLADQTMSYVLRDLSLPEGGFCSGEDADTEGAEGTFYLWTPQQVEEVLGHQQATIFCTCYEISEAGNFEGSNIPRLEMDL
    KEWAQWFGTDTDELGAVLEDGRRKLLQARKLRVRPHRDDKVLVAWNGLAIAAMARTARLIGHPEYLEGATRAADFILSNM
    RNEEGRLLRRWRRGQAGIPAFLEDYAALILGLIELYQAGFNARYLAEAVQLGRDMQERFGTPDGVYYDTGTDAEEVLVRK
    RTLHDGAMISGNSMAAMALLRLGSLTGEPALEEHAEKILLASSKQWTDAPTASGQLLMALDLALSQREVLVIAAPKDDPE
    GTRMVKAAHTGFRPNLIILWHTPDDNALSEVTPLVRGKTMQNGKATAYLCRGQTCMAPATTVDQLLERLNS

    >gi|77919485|ref|YP_357300.1| hypothetical protein Pcar_1889 [Pelobacter carbinolicus DSM 2380]
    MSLVYSQDMPIGSAMPAFRLKDPYGHLFGSDELFGRKGLLVVFSCNHCPYANAQWPRLVALAAEFKSRGIACVAINSNIH
    PDYPEDAPSAMKRKIAALQIDFPYLVDDTQQVARDFAAQCTPDPYLFDAAGFLVYHGRIDDNWKDEGKVTRHNLRDAMEA
    LVHGAPCLEVQSPSMGCSIKWRH

    >gi|77919550|ref|YP_357365.1| thioredoxin [Pelobacter carbinolicus DSM 2380]
    MSAYYRFLVLSVGMLLLCFAVVLAGGRRDKQSQGQELGIGLEAPNFKLKNQAGEVTTLRQYRGQVVVLAFWATWCPACRE
    ELPSLAGLHRRMAGQGVMVLGINGGESAARVNDFMNRANLDLPVLLDASGEVHGLYQVRQYPTTYIIDRQGKLVERHIGF
    HDWNAPEVAGALRSLAGNGSEVKP

    >gi|77919664|ref|YP_357479.1| protein disulfide isomerase [Pelobacter carbinolicus DSM 2380]
    MWRGYTMKLLVTVVLLFCASTVWAFPKDSCGEKTCIDCHTLSKEEAKYLLDKQADKVLNIEPSQVQALWVVEVEKKGKRY
    PVYIDFTKNFVMRGEVLRLKDGENLTRERIASLNRIDVATIPLADALLLGKASASKKIIVFTDPQ
    CSYCKKLHAEMKKVV
    KLDPDVAFYIKMLPLNIHPEAYMIAKSIVCNRSVAMLEQSFAGRPVPPPVCRAEAVDQTIVLARKSGINSTPTVVLPDGR
    PFSGYRDAATLLKMVGSKVQVPKEVGDTE

    >gi|77919684|ref|YP_357499.1| putative methyltransferase [Pelobacter carbinolicus DSM 2380]
    MEFTLQHWQRLQWRDMPLYLNPEQPSWFVPNATGDRVLCALRQDASVAMETAARCFLQRLPQGDAAVYPGRSHFLKTESL
    RELWFHITNRCNMNCRHCMFGSGPGDAAELDAERIVTLARQASNLGCRVFALTGGEPLVHRRFDYIARELLALPDSRLVV
    LTNGLLLSRLLPCLLNDRQRLHLQISVDGLREGHDRLRGAGSFDRLMGQLDWLQRRDLPFTLSMCVTADNVGDMPGMVAL
    AAEYGGKNVHFMWYFVRGRGHDGAVADNEQLFAHLIKAEEAALRYGVTIDNLQALKTQIFAPPGTVHDGSNNAWESLAVG
    PDGQLYPSAALVGVPELSTPISADLATAWRDSAVLDEIRRASATELSTPWRFLLGGGDLDHSYLASGRFVGGDPYLPLYE
    NLACWLIQQQASKQADEGAAALRLKMGDILESCGAHGSVALLHSNCLLALAGQDSHTAVKDYYRGAATEDREEILNPVCY
    EEGLIAHIPEAYRFRGYGCGSPVLDAQLQPGETVVDLGSGRGVECFIAARQVGAGGKVFGVDMLDPMLSAARRGAEAVAA
    NLGYQNLEFRQGYLEQLPLDDDSVDVVLSNCVMNLSPDKRRAFAEILRALRPGGRLVISDVVCEEEPDAAIRNDETLRGE
    CIGGALTQRDLVGILAEAGFVAVRLIKRFPYRVVAGHPFFSLTYQAVKAAPPEVVRVLWRGPLSAFGPDGAVLVPGAVAT
    LDRQQADLVGEGAFQLDEHGTVVNLDLGESCCCSLPPETRSTASEQGVARYVSGCMVCGAPLRYLDEDRRHSCHFCGETH
    TTRALCTNGHFVCDACHARDARGIIESMCLHTKAVDMLDLFEKITAYPGFPDNGPEYHALVPGVILATARNRGLQVSRET
    LLAGIRRGGQVAGGSCAFWGVCGAATGVGVAFSLLLEANPLKAEARQAVQTVVQQVLAEISSLRAARCCRRDSFLALRKT
    AQLSGDLLPIALLAQAAIGCPARRNKEGCLGASCPLSKKFNLVSGGHIAEETSG

    >gi|77919769|ref|YP_357584.1| NADH oxidase [Pelobacter carbinolicus DSM 2380]
    MKNYPNIFEPLTVKRMTIKNRIVMPPIGTNLAGLDGKFNTEHIAYYVQRAKGGTGLITVENACLDFPLGTNGTTQLRIDN
    DQYIPGLYKLTEALHAYGACVSIQLNHAGASAYPGRLNGMQQVSSSNIPSKTGGSVPRSLTKDEIYAIVRKFGEAAGRAQ
    RAEFDCVEIHAGHSYLLSQFLSPIYNKRTDEFGGSPENRARFARLVIDEVRSVVGPFFPIGLRFSADEFMEGGNTLEDTL
    RNLEYLSEGVDIFNVSAALNDTLQFQIDEMNLADGWRSYMAKAVREKFGKVTITSGNIRDPRVAEKILADGEADLIAMGR
    GLIADPNWVEKVEHGHEHLLRKCISCNIGCADHRIAKSEPIRCTINPDVVSEDAYKQKQVKHPMNVVVIGGGTAGLEAAC
    TAAEVG
    CDVHLFESKDYLGGLAREIARLPDKNRINDFPDYLIERAKTLDNLHIATGTKADVKTIDALQPDIVVNATGAKP
    LLPPIKGLHEEMGRENSKVFSIFDLLGDMDRWNDMVGKNIAVIGGGAVGLDVVEFFVKRGAAKVSIVEMMPMLGKDLDLI
    TRLSMMNMVKEYGVEVHTNTALTEIAADHFKLKHAGVDADMPFAGAEFDLPFDYGFVCLGMRADQSLWPDLLSYKRETGV
    EVVNIGDGKIARRIINGTKEGRDILTTIAKVDQAKDKYTPRAAND

    >gi|77919868|ref|YP_357683.1| rhodanese-related sulfurtransferase [Pelobacter carbinolicus DSM 2380]
    MSILNYFKPVSTWSVQQVRDFLQRKSAKDYNLVDVRQPGEYEAGHLPGAILIPVRQIEERFKELDPEKPTITYCAAGVRS
    RAAAAALKNVGFKEVYSMSGGINAWEGLVAVNEPELGAVWFDPAHTPEDHIAMAWLLEDGTRQFYATLADTRHQAGESEF
    FGRMAAVEEQHKQSLMNLFSGIRGSHEDLPAAVLKERGEQTVLEGGVTLDQALKFVQGKPVQEVLELAISFESNALDRYM
    LLYAHMSDPKSREVFLRLADQERQHLRQLSDRLDQVLAGL

    >gi|77919924|ref|YP_357739.1| bacterioferritin comigratory protein [Pelobacter carbinolicus DSM 2380]
    MTTLEGQKAPDFKLEGSDGNWHALADYAGRTVVIYFYPKDNTAGCTKEACAFRDLHTRFQQQEVVLLGISKDSLASHDRF
    IDKFGLPFVLLSDPETLMMQAYNAFGEKTMYGKKVMGTFRSTVIIGPDGTIVKHWPRVKKAEAHPLEVLEYLNARQD

    >gi|77920082|ref|YP_357897.1| hypothetical protein Pcar_2488 [Pelobacter carbinolicus DSM 2380]
    MEARKPQEMDMKGKQTCINGVDIEQLRQNISNIEKDPSLAHCQFRATNRWQGGGHSQTVIHDFHGAGQEITHRHDFRMDA
    DEPPLLLGEDIGANPVEYVLTALSA
    CLTTSLIYLAAAQGITLREVESDLEGDLDIRGFLGLSEEVRNGYEHIRVNFRIKA
    DAPQEKIEELIRLAVQRSPVFDVVSNPIPVSVKGEKVVETAH

    >gi|77920100|ref|YP_357915.1| putative carboxymuconolactone decarboxylase [Pelobacter carbinolicus DSM 2380]
    MRLLAKFFPEFVELLDKTDELYRQKRFIDEKTYQYICFAVSIKARSKPCVLKHFKGALDAGATVQELAYILALVMREASG
    ADDCWTHDVLEGWAEIVAGDVACGCLT

    >gi|77920116|ref|YP_357931.1| rhodanese-related sulfurtransferase [Pelobacter carbinolicus DSM 2380]
    MSDRLIGADLPKLLRDAVVIVLLATLAGAAINGRLLWQIWSGQAPGAVVPSETLTESDLLPMPMSLSELRELTAGEIILL
    DARSGDLYLQGHLPGARSLPWGEVESLLAVFRAEVPVDVSVVTY
    CSGYSCEDSFLLAQRLMASGFKDVRVFEGGMPEWQD
    AGMPVEEGQP

    >gi|77920128|ref|YP_357943.1| mercuric reductase [Pelobacter carbinolicus DSM 2380]
    MFSGHNRPASTDAERIWIENVRPSDWTNPEPAPRYNLVVVGAGSAGLVTAAGAAGLGARVALIEKLNMGGDCLNFGCVPS
    KGLIRCGRAVSAARNAHRFGATGTDKVKADFTSAMAYMQEVRSAISQHDSARRFQQELGVDVFLGTGTFVSHDTLTVDGK
    PLRFRKAAICTGARASAPPIPGLEETGYLTNETVFSLNKRPSRLAIIGAGPIGCELAQAFARLGSQVTVLEYGSGALPRE
    DRDAAALIEQAMIREGITLYFDCRTKQISRQGNTRNIDMDLPDGPRHIAVDDILVAAGRTPNVTGLGLEKAGVAFDPKTG
    IKVDRRLRTSNRRIFAAGDVCSPYKFTHTADAMARMLLANALFPGRQSTSSMVIPWVTYTSPEVAHVGLYEEQARQKGLA
    VTTLTVPLADTDRGLIDGETAGFARVHLKKNSDKILGATIVAEHAGEMIGEMALAISGGLGLGAIGRTIHPYPTQAEMMR
    KLADAYQRNRLTPRIKKLLNIWFRWQCR

    >gi|77920141|ref|YP_357956.1| hypothetical protein Pcar_2548 [Pelobacter carbinolicus DSM 2380]
    MFSPWRSFMKNLFALSSALLLLFGFFCPALAAPQLVTPQPAFHFGTIAEGDKVHHVFTFTNQGDQPLIINRVRSTCGCTG
    TLLSQKEIPPGESGEIKTVFNSSGMRGPIVKWIHVYSNDPINPKVRLQINGVVQPEIDFTPRRLRLTGMEPGKKHEALVT
    LTNNSEQPIFLSHLTTTPAVLSARLSETRLEPGGTANIKISFEIPAGKTHQNGYISLKTSSPRTPKIRIPVFGVGHAQTR


    >gi|77920204|ref|YP_358019.1| peptide methionine sulfoxide reductase [Pelobacter carbinolicus DSM 2380]
    MKRHWLRTLFFTPLIFMVGIAMAATGPNQGANMTDQDKKQMVATFAGGCFWCVESDFEKIPGVTEVISGYSGGHVANPSY
    KQVSAGGTGHVEAVQVHYHPAEVGYEQLLDVLWRHIDPTDAGGQFVDRGSQYRSVIFYHDEQQRGIAEKSKQALQRSGRF
    DKPIVTEILPFKAFFVAEDYHQDYYKNHPIRYKYYRWNSGRDQFLEKVWSKEIMNKNSGSDNPRYNKPDDASLRDTLTPL
    QYKVTQKEGTEPPFKNAYWDNKEAGIYVDIVSGEPLFSSLDKYTSGTGWPSFVRPLVSENIVEREDRKLFSVRTEVRSRY
    GDSHLGHVFNDGPPPTGLRY
    CINSAALRFIPVEQLEKQGYGEFLERFK

    >gi|77920433|ref|YP_358248.1| osmotically inducible protein [Pelobacter carbinolicus DSM 2380]
    MQKRISRAEWKGTLNKGSGTMSLASGAYEGAYSFASRFESAPGTNPEELIGAAIAGCYSMFLSALLSNDGFEPTRITTSA
    AVVLDEGPAITSITLETEGVVPNLTEQVFMEKAEEAKKN
    CPVSKALAGTEIKLVAKFAK

    >gi|77920446|ref|YP_358261.1| hypothetical protein Pcar_2856 [Pelobacter carbinolicus DSM 2380]
    MKQNDQGSWNPYLAGSLTGIVSVLSVWVAGKYFGASTSFVRTAGMIEKLFAPERVEKMDYFIQKAPVIEWQWMFVVGIFV
    GALIAAFTSGSFRLQAVPDMWAAHFGAQTTGKRAVVAFIGGIILMFGARLAGG
    CPSGHGLSGTMQLSVSGYIALVCFFAG
    GLFVARQLYKGGANS

    >gi|77920526|ref|YP_358341.1| hypothetical protein Pcar_2936 [Pelobacter carbinolicus DSM 2380]
    MRIDILCKPDCGGRCYTTLSNVRQALDQMRLDAEVHLYQDPRKLIDNRVYVTPALILDDVVRISGRVPEVVEIKALVAER
    ARFIRRLRDAV

    >gi|77920533|ref|YP_358348.1| thioredoxin reductase [Pelobacter carbinolicus DSM 2380]
    MPVRENIHDQIILGSGPAGYTAAIYTARSNCCPLLISGLEPGGQLTGTTLVENFPGFPDGVDGPELMESMRRQAEKFGTV
    FVSGEVSRVELSEHPYKIWVGDDLYRCRSLIVCTGASPRMLGLPNEKELYGRGVSV
    CATCDGFFYRGKEVVVVGGGDTAM
    EDALFLARFAAKVTVVHRRNALRASAALQQRAQANAKIHFVWDTVVTAILGDKQQGVRGVRLQHLPTAKEEDCPCDGIFV
    AIGHVPNTTLFKGQLDLDDWGYILTRNGTETNLPGVFAAGDVQDPFFRQAISAAGTGCMAAMQSQRFLECLEDADCKKCQ
    ALQKRHPVAAQED

    >gi|77920590|ref|YP_358405.1| methylated DNA-protein cysteine methyltransferase [Pelobacter carbinolicus DSM 2380]
    MLHTCTIDTPLGIMTAAADDGKLAILRFCGPKGLFTDTANCAERPDNPVLVALRAWLDDYFDGKRPRPNLPLEPRGTPFQ
    KAVWEILKQVPYGATITYGEVAKKLAAARGLASMSAQAVGGAAGRNPIAILIP
    CHRVIGADGRLTGYAGGLDKKQALLQL
    EGASFHEHPTIRSIPEHP

    >gi|77920658|ref|YP_358473.1| thioredoxin [Pelobacter carbinolicus DSM 2380]
    MASDKIVHLSDNSFDADVLKSSEPVLVDFWASWCGPCKAIAPAIDELAEQFDGQVKIGKINVDENPATPSNYGVRGIPTL
    ILFKDGQVVDQVVGAVPKGQLEALIKKAL

    >gi|77920709|ref|YP_358524.1| peroxiredoxin [Pelobacter carbinolicus DSM 2380]
    MKKLLAHAIIASFFIASLASPALCQLPAGTIAPDFTLHNLNDKSVRLSDLEGHPVVLVIGTTWCPGCKAQLSELQTIRQF
    FDDHKIPLIDIFIQEPAATVGNYLKGKKLPATFEALLDDGQVHRAYRVYPIPRVLILDGSRRIVQDSLGLDATEITDTIQ
    RLLDRQADTEKTSNE

    >gi|77917894|ref|YP_355709.1| tRNA 2-selenouridine synthase [Pelobacter carbinolicus DSM 2380]
    MSQRPYTPELFLQQATRHPVFDVRTPSEFRKGHIPGARNLPLFSDEERHEIGLLYKQQGREPAVLRGLEMVGPRLTEYIR
    QVQAVTDSRQVLVH
    CWRGGMRSASLAWLLGQVGYRVGLLQGGYKAYRKCVLADYEKPLQLLVLGGMTGSGKTEILHSLQQ
    RGQQVLDLEGLACHRGSAFGALDDVEQPTTEQFENDVHAVLQTLQPEQPIWVEDESRRIGSVIVNDGLFRQMRNAPLVCI
    HVSREARVERLCNDYGSVSPEKLAGAVSNISKRLGGEKTRLALQAIADGDYATATHAVLDYYDKTYLYGISKRNPDRVMD
    LDPTPESPGAIAAALGKIARDVQL