Pedobacter heparinus DSM 2366 uid59111

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|255529977|ref|YP_003090349.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MEKIFNKKNGLNILFIAIFLVLIFVPAAKALMIRGLMEIGLFRPDVAQTEAPLTAAVNDLSGIRFKDAAGKEVDLGSLRG
    KVVFINFWATW
    CPPCLAEMPAVNKLYSQFKEDKGVVFILVDADSDFAKAQQYMDRKGYKMPVYNAASPIPEAIFKGSLPT
    TLVFDKKGRVAYNEVGAANYGSEKFIEFLKKLKASNI

    >gi|255530011|ref|YP_003090383.1| Rhodanese domain protein [Pedobacter heparinus DSM 2366]
    MIKEITVEELKEKIDNKEDFQLIDVRETFEYDTSNLDGLNIPLAGILIEADKIAQDKPVIIHCRSGKRSAAAVMQLEQQL
    GLTNLYNLKGGILAWQEAFDPEMPVY

    >gi|255530180|ref|YP_003090552.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKKIVLIAACLLPVAVMAQEKFTINGKVGNLGAPAKAYLYYGPRANPVVDSAAIVGGKFMFTGPISGITQATVVIRHDLA
    APSRTVAPDGYALFLEPKVLELVSATDSIKHAVVKGSKVNDDNAKFKALTKSVNEKNAALMAEYRSKTETERNDEAYMKT
    VMSRDEANRKEMETLSKQFYTANRDSYIGLLAFQGTVNVDKDLSGAEAELNKFSPAIKATELGKSIAKTIQSAKSTGVGQ
    MAMDFTQNDVNDKPVKLSDFRGKYVLVDFWASW
    CGPCRAENPNVVKAYTTYKDKNFTVLGVSLDQPGKKDAWLQAIEKDG
    LNWTQLSDLKGWSNEVAVQYGVRSIPANYLIDPSGKIIAKNVRGEELQKKLAEVL

    >gi|255530228|ref|YP_003090600.1| methylated-DNA/protein-cysteine methyltransferase [Pedobacter heparinus DSM 2366]
    MAEHVHLSPFHFQRMFQNWASVTPKQFLQYLTTEHVKNMLKTTRMSLFDAAYEAGLSSTSRLHDLFIKVEGMSPGEFKNG
    GEALTINFSFADSPFGEMLVAATAKGVCHMMFVDNGREMALDALKANFPNAKYVQMVDRMQQNALFVFTQDWSRLDEIKL
    HLKGTDFQIKVWETLLKVPTGGFTTYGDLAANTGHDGASRAVGTAVGNNPVAFLIP
    CHRVIKSTGEIGQYHWGSVRKHAI
    IGWEAALQHHI

    >gi|255530390|ref|YP_003090762.1| peptide methionine sulfoxide reductase [Pedobacter heparinus DSM 2366]
    MVLLYNDTIMKYLSIMIIVLLSLNRAEAQSGKLQKATFGMGCFWCSEALFQRLNGVVSVRSGYEGGQVPNPSYEDVCSGT
    TGHAEVIELTYDPLKIKYDELLEVFWKSHDPTTLNRQGADIGTQYRSVVFYHNDEQKQTAEKYKKELNASNAYGKPVVTA
    IEKAAPFYKAENYHQDYFNKNGSQPYCRMVILPKLEKLEKVFKAKLKH

    >gi|255530442|ref|YP_003090814.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MLKKGERAPDFTLYATPDQKIVLSELKGKNVILAFYPADWSPVCSDQMALYNETLKYFSKHDAMLLGISVDSKWCHLAFS
    QSRNLHFPLLADFEPKGEVSKKYGVYDDEEGECKRALFVIDKEGRIAWSYLSPTAINPGADGILDALESLKKK

    >gi|255530443|ref|YP_003090815.1| DSBA oxidoreductase [Pedobacter heparinus DSM 2366]
    MGSLLKPPVGPGDHVIGHADAAVEIVEYGDFQCPHCAAAHPVTKEILKVFGDQVRFVFRNFPLAESHRYATIAAIAAEAA
    GLQHKYWEMHDMIFEHQASLSYDSLFVLAGKLGLNPEQFERDLQNEALRDKVESDFESGIRSGVNGTPSFFVNGNKFDGA
    AGDLFAMLKESSN

    >gi|255530457|ref|YP_003090829.1| beta-lactamase domain protein [Pedobacter heparinus DSM 2366]
    MKIEQIYTGCLAEAAYYIESNGEAAIIDPLREVGPYLKRAAKDNAVIRYIFETHFHADFVSGHIDLAEKSGAEIVYGPTA
    KTSFKSHIAKDGEQFKIGELTITALHTPGHTPESTTYLLTDKHDRPYCIFTGDTLFIGDVGRPDLAQQGNLTMEDMAATL
    YDSLQQKILTLPDEVLVYPAHGAGSACGKSMSKETFDTLGHQKEVNYALKAGSKAQFVKEVTDGILPPPQYFAKNAAMNK
    HGYESVDDVYEKGLKPLNPEEFEALANLTGALILDTRDPQVFAKAFVPSSINIGLNGQFAPWVGALITDLQQPLLLV
    CED
    GKEEETITRLARVGYDNTIGYLAGGTAAWQKANKELDTVKSITANEFEAIANEDPSVQVLDVRKPGEYESEHLEMTLTRP
    LDYINDWTNEIDHDKTYYVH
    CAGGYRSMIAASILKARGIEQVVDIAGGYGALKNTDLKRTDFACPSKAMKP

    >gi|255530502|ref|YP_003090874.1| arsenate reductase and related [Pedobacter heparinus DSM 2366]
    MKLNPNFVNMIIYGIPNCNTVKKARTWLEENGFNAEFHDFKKKGITAEKLNEWCKVFGWEQVLNKKGTTWRSLGPDVQQS
    VKDQPTAVAVMLQHNSAIKRPVIEVEGKALLISFNEDQYAAVLK

    >gi|255530586|ref|YP_003090958.1| OsmC family protein [Pedobacter heparinus DSM 2366]
    MKVDLKRVNDAVHFEASAPSSTVKVQIDGSPEIGGLGLGVRPMEMVLMALASCSSLDLVNILKKQKQDIRDFSVSVEGER
    REQIPTIFTKIHMIFTLTGDIHREKAERAAELAVKKYCSVHDMLVAGGVEITYSISI

    >gi|255530600|ref|YP_003090972.1| methionine-R-sulfoxide reductase [Pedobacter heparinus DSM 2366]
    MKTWIDKTFVLAGLLVLLNLAACGQQPKKEDIKKATNTMEWNKLTKEEEDVIVRKGTEYPGTGKLLNNKEKGTYVCKRCN
    APLYRSESKFESHCGWPSFDDEIKGAVERIPDADGMRTEIVCANCKAHLGHVFLGEGFTAKNTRN
    CVNSISMNFVPDKK

    >gi|255530633|ref|YP_003091005.1| methylated-DNA/protein-cysteine methyltransferase [Pedobacter heparinus DSM 2366]
    MESLNTIDYNRIAAAIEYLKVNFKAQPSLEAIAEQVHLSPFHFQRMFKEWAGVTPKKFLQYLSVEYAKRILKDKQATLFD
    AAYETGLSGTSRLHDLFINIEGMTPGEFKNGGAQLQINYSFAESPFGSVLVASTAKGICYMAFADDETLAVEELKKSFPN
    ARYRQVLDRIQQNALYIFTQDWQRLSEIRLHLKGTPFQLKVWETLIKIPMGKLTTYGAIAGSIDSAKASRAVGTAVGNNP
    VAFLIP
    CHRVIRSTGELGEYHWGNTRKTAMIGWEAAKIG

    >gi|255530634|ref|YP_003091006.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKPFYAFLLLLTVSTLSCNQDAKKSPPIPGESKTSTSPSVTDPSKAGKPVAPARELLTDFMTFWNYYSGNVKLNQDFEAY
    DVKGTLITKEIFLKNLNSGLYFPLRVYTKSAELGYKLQEIPATADTMIPAYMKQFSKQELTYYKMQGKNIPSFNFTAIDG
    NTYTSENTKGKIVLFKCWFIS
    CLPCVQEMPALNDLVKKYKDRKDILFISLAIDGKKELQQFLAKTRFDYATIPDQENYMS
    KKLNVTGYPTHFLIDKAGKLVRALHNETELAEALEKEIAL

    >gi|255530693|ref|YP_003091065.1| methylated-DNA/protein-cysteine methyltransferase [Pedobacter heparinus DSM 2366]
    MKEKKPMKYYHKIIKSPVGELKLVASDQGLAAVLWENDDPKRVPIGDSTASSNNLILQEAEKQLNEYFEKKRTVFTVKLD
    FSGTPFQKKVWEALLNIPFGETRTYGEIARELGDIKAVRAVGAANGKNPISIIAP
    CHRVIGASGKLTGFAGGLDNKARLL
    QMEDSRKNPTLW

    >gi|255530779|ref|YP_003091151.1| thioredoxin [Pedobacter heparinus DSM 2366]
    MALEITDANFEEVVLKSDKPVLVDFWAEWCGPCRMVGPVVDEISKEYEGKALVGKVNVDNNPQISTQFGIRNIPALLYFK
    NGEVVDKQVGAVPKSVLAQKLDKQL

    >gi|255530792|ref|YP_003091164.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MSELKEGQKAPGFSAKDQDGNTVTLAQFAGKKVVLYFYPKDDTPGCTAEACDFRDNYQGLTAKGYVVLGVSTDDEKSHQK
    FITKHNLPFTLLADTDQKIVTDYGVWAEKNMYGKKYMGTVRTTFVIDEQGNIAHIIKKVDTANSTAQVLALA

    >gi|255530819|ref|YP_003091191.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MKKIKLVIALLFSVISMVSIAQEKLSNSHKSEADQYWETKPICYPPASGVTLPDKYNQKDFDRYIESKTEVNIYDELFRR
    TLREWGIRFWTLFPNDQRRFEWLVTSRLYEPAYFANVREGARAKAEKKYVVQLDTLAKNGWKILYCQYLKEFLSSNEVSE
    QRKEILFRQELSFGFFNKKWRNSKQEKFDLQQHVLQSVDFAKRYGAEGPVVNMLGVLYRDRNDFGLDDQDIDKYLALLKA
    TEFSAFHQQARGIESVRKLYKIPLKLQTKSVDGKLVDLEKYKGKLVLVDFWSLG
    CTVCIEKMPEIKQVFDKYNSKGFEVI
    SACISGYINEDKKKIEQIHQKTGANWPLAILDFRPGGLGRKIFDTYGWQGVPQLLLLDEEGKLLSSGSEFRTKGSLEKLV
    KQHLDKN

    >gi|255530820|ref|YP_003091192.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MEFKLENMMNSRCIVILVALLFGISTHNKAQTKDEFILRGELRGLPDKTKLYLITQEKDTVAGTISNGEQFSFKGTLLKN
    GRFHFIRMDTSVSKLFYGEIFIVNGDMTASGVLNQRQLVITGSKGQDDLNYLISKMAFVKIKQIDKQLESMNTQLDNRGK
    NVDSTQIKIEKNRLLVKREQLFEDCKKMALEWLTDNPASLYAPYFIIQCKGLFGSKAMGKLYDQLSAQAKNSYYGDKLKK
    EIMSLNLSLLIQEGALINNFSITTPEGNQLLIHDIAAKSKLTLIDCWASW
    CGPCRQEIPELKKLYNTYNKNGFNIVGISS
    DNKENDWKKALAEDGTPWIHGIDGKNKTVLHMFDIRAIPAYILIDDEGRLIAFDCPLSNVPLFGGRLRGNDLENKIKNLL
    NVKGK

    >gi|255530863|ref|YP_003091235.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MKNQSLHIFLIAVAILLTNIHVNAQRNEAFDLTARGIIVGQDVPHIEISNLHNYFDKDRKQRSTVNISSFRGKLVILDFW
    ATW
    CSPCIGMMPVMDSLQRRFEGKVQFLSITAQPDTIVVPFLKKLFRGKKMDIPFATSDVLVSKVFPHRLLPHYVWIDET
    GKVLAITSHEEVNAKEIESVINKQPTVMRQKKDMAVKYDRNKPLFLAENGGSGKGLIYHSMLTEWGEGLSMGSWINPAMG
    KATVANLGIKEMYAAAFSEKLIIGQHRVINQMKDPGTIHYDGPRAEADSWMKKNMFCYELVLPEGKRETLRSHMIGDLKK
    LFPKIWADTAHVETMCTVLVSTGDNSAMRSKGDKRAIEVNSLGISVTNMGIVALTSRLDIVYLQENPYPIVDNSGIKFPV
    DFKLDCDLGSVTSINKALSQYNLKLVNQRFTTNMLIFKDAQAKVVTHNQ

    >gi|255530984|ref|YP_003091356.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKIQLKFLAAIMVVSMPCFAQNLALRVGQQLPDLEINKILYHISGTAKLSDFKGKLVILDFWSTACGPCIEGMPKMDSLQ
    KEFSDKVVILPVYAFGKTFTVDIIERIDSFWKTNKYTSSTNLPSVLDSAFGSFFPVRVGYQVWIDSNRIVRAVTGPEYVN
    KKEIHKVINGLYPQWESEIKENSLNKTVSEYLSRAEFSGLKDQNYSFFTNYLKRVDTNSDIVKSDSQVLVSYKNCPIISF
    YWKYIRANNLFPTNVVIETKDSVRYFKKGYTNEWLRDHSYCYELKLNHKVADKDVADYIRQDANKYFGLNGRLETKRVSC
    LILKKVKKSAGMPNPGRLSKTPISQFYEELKSKQNSLWQTGKNALPILNEIDQKSISEISYPQALDLTNILELRKVLRSQ
    GYDIVEEKRTLKTFVISEIN

    >gi|255530986|ref|YP_003091358.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MINRNVVFAFFFLGSLLCSFFSYGQQNGLNINLKLKGLSSLNYAVLYKYNGNIADSIAKQKMINGTTVIHASVQIEPGFY
    FLKVGNLKETLPLFIGAGKVDVTGEASLWPKVQVTGAVDHKDYQDYHLLTDSLESAGQALFKVCTALQDSKDTTAQSALQ
    NKIMSNITSYEKKQLDFVSSHLDSYYSPVVINNAKWDWTRKRAAYDRLTPSIKASKYGVFLAENIAKWKKASGLLEIGDT
    VPEFIAKTANNADLSLQKEIADNKLTLIDFWASW
    CVPCRQENPNLVKTFQENKSKGFDIIGISLDEKSAEWKAAISKDGL
    VWRQVSDLKGWASPIAKLYFAGMPFNYIPQNFLVDGKGKILARNLRGDQLSKKVDELLKGNSL

    >gi|255531115|ref|YP_003091487.1| glutathione peroxidase [Pedobacter heparinus DSM 2366]
    MSDQSKSIHQFKVKLINGAEKNLSAYKNKVLLIVNIASACGFAPQLKDLQELREQFGTEHFEVLAFPSNDFGRQEPLEGA
    AIGNFCEANYGVHFPVFEKIMVRGEQAHPLFKFLTQTATPRWNFHKYLVNKEGEVVDYFFPFTKPLSSKVKKKIQRLL

    >gi|255531123|ref|YP_003091495.1| alkylhydroperoxidase like protein, AhpD family [Pedobacter heparinus DSM 2366]
    MEQRINAFEKGQHAMKAMYGIGAYLSKSSIEPKLLHLLYFRVSQINGCAYCLDMHSKDLRAAGETEQRLYVLDAWREAPL
    FSERECAALAWAEAVTRIRDGNVADEVYERARKQFSEEELIDLTLGITTINTYNRINIAFRTVAGSYTVGQHKVQVK

    >gi|255531230|ref|YP_003091602.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MKLSFISILLYVVPVALKFVSVILFLFPIALKAQQDQDTLTKIGDRVPEFSFELEKGKMANISDYKGRLILINLFATWCP
    P
    CNTELPLVQKQIWEKYKDNPKFVFFVFGREEGWDILVPYKQKKGFTFPILPDKDRGIFKKFAIQSIPRNIIVDQDGKII
    YQSVGYTEKEFAEMVTLIERNLKQQDQGK

    >gi|255531232|ref|YP_003091604.1| alkylhydroperoxidase like protein, AhpD family [Pedobacter heparinus DSM 2366]
    MERIKNNEVPQGLMAALRGVQDYIDQCGLNHNLLELMNIRISQINGCAYCLDMHSKKAMHSGETVQRLISVSAWREAPYY
    TPEERAVLEYAELLTRMEEGSDIDHAHHELLKYYTKSEIANFTVAIAQMNSWNRIVKSTGIVAGSYTLTR

    >gi|255531259|ref|YP_003091631.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKKLLTPLLVIICYVSASSQYKFTLDFKTKTFNNAKVYLNVYNNQSFTPISRDSFIVVNGQHIIKGELKQPSNFADFSVS
    YQGKGIGTRFVLDSGENKVSLDTPVLVTKMLTLLSNARGHFVVDELDNLFLEKVALYKEPTRINGNLHIPPKLNEQIRQA
    QLKRLLSYPNDFGSLLYLYRMSRIDANPKTAMDILVILETFSEELKNSTLGKQLYEKETNLINNKKAAGAGNKVPIFKIN
    DLNNDEFSNSSLTGQPYIIVFSATW
    CGPCQEQLPMLKQLYEIYKQKGLKVIYFNDDDNVIRWKEHVSNNKLSWINVSERL
    KPAKSKIPRSFGVYSIPTCLVVNKKGTIIYNSDQSDPGLNHIENFIKKAINN

    >gi|255531306|ref|YP_003091678.1| protein of unknown function DUF1573 [Pedobacter heparinus DSM 2366]
    MKQIFVLALAALSFASCQNTAKKTTEAGHATETVAGAPDAAVPAAADAAVMSFENGNYDFGKISQGEKVYYSYKFKNVGK
    SPLIILNATAT
    CGCTVPEVPKEPIKPGAEGEIKVVFDSNGKSGMQDKVITVTSNAHPNIASLHLTGEIKEQSN

    >gi|255531347|ref|YP_003091719.1| protein of unknown function DUF255 [Pedobacter heparinus DSM 2366]
    MNTEPNSLIKASSPYLLQHAYNPVNWYEWGAEALQKASAENKLILVSIGYSACHWCHVMERESFENHEVAEVMNRHFVCI
    KVDREERPDIDQIYMLAIQLMTGSGGWPLNCICLPDQRPIYGGTYFRKADWVNVLESVAAMWANEPDKAIAYADRLTDGI
    QNAEKIIPQIKVDEYTKAHLTAITEPWKRYFDMAEGGYNRAPKFPLPNNWQFMLRYSHLMQDDATHVSALLTLEKMAMGG
    IYDHVAGGFSRYSVDGDWHVPHFEKMLYDNGQLISLYAEAYQYSRSLLFKEVAEESIEWLEREMMSPEGLFYAALDADSE
    GVEGKFYVWDKPDFEAVLGDDADLLSDYFNVTDEGNWEEEQTNILLRKFTEEEYAEVKGISVVELLQKIKTAKIKLLQER
    SKRIRPGLDDKCLTAWNAMAIKGLAESAEIFDHPHYYEMAKKAASFILAHVNTADGGLYRNFKNDKASIPGFLDDYAFFI
    EALIALYEADFDENWLKEAKRLCDYVLLNFEDEHSPMLFYTSAAGETLIARKHEIMDNVVPASNSVMAQNLHKLGLLFDE
    DVYSIKAEEMLAAVLPQIKTYGSAYSNWAIQLLNQVFGINEIALTGAAVKKQKSAFNAHYIPNKITLGGTKSQLPLLKDK
    QSIETKIYICRNKVCQLPVATVDEALKLIN

    >gi|255531395|ref|YP_003091767.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MRLTIALFLIFLLQKSFAQHTVYTFNSNAVFTETEIKTAFESVSQSLPSSEILVPNIFHTTTKKDTIVNYIEFAIRKRVA
    GEQPIFKFTYKQDSTFLFLNKKLPGFKLKELDGNEVSLSQLSGKPTLINFWATY
    CGPCIAEMPQLSQLKEKYKDKMNFIS
    ITENRVIEDHLVNFMKDKNFNFPVLENGQSYKNELKLQALPRNLFLDKDGVLRYIQVNYPVNANSIPLDLNDKGNYFTKI
    IEELIRN

    >gi|255531412|ref|YP_003091784.1| protein of unknown function DUF1573 [Pedobacter heparinus DSM 2366]
    MKKLILLFTLILGISVAANAQSKPAEFKFDKESHDFGKIPLNKPATIEFKFTNIGDQPLIITKVETTCGCTVPEYTQTPV
    KKGDSGVIKVTYNPTGAALPFSKSITITSNAKTTTKVLYIKGETVAAASK

    >gi|255531464|ref|YP_003091836.1| iron-sulfur cluster assembly accessory protein [Pedobacter heparinus DSM 2366]
    MITITEKAKSKIDQLMEESQMDTTYFLRVSVKGGGCSGLSYNLDFDDEEKAGDQFFEDKGIRIALDMKSFLYLAGTELDF
    SDGLNGKGFNFNNPNASRSCGCGESFSV

    >gi|255531513|ref|YP_003091885.1| cytochrome c biogenesis protein transmembrane region [Pedobacter heparinus DSM 2366]
    MKLNHHHIFMTLRIFILGLFILLGTSSYVHAQEADTSLSGLEFTEIAPDTVSPADTVAAKAAVVPAAGVAGIAAAPGNKA
    PAAEADKTLWGTFIAGLVGGFLAFLMPCIFPMVPLTISYFTKRAGSKGKGIGQALIYGLSIIVIYVGFGLLITVLFGSAG
    LNALSASGLFNFLFFILLVVFAISFFGAFEITLPSAFVNKIDNKADNSKGLAGIFFMAASLALVSFSCTGPIIGTLLVDA
    SSKGELLGPAVGMFGFALALALPFTLSAIFPGFLSSMPKSGGWLNSVKVCLGFLELALALKFLSSADLAWHWEWFDREIF
    LVLWIVIFVLMGIYLLGKIRFSHDSEVPYISVPRLFLAILSFSFALYMVPGLWGAPVSVLSGLAPPMNTQDFILNGNQSS
    ASGSVAADFPAHVKYSGSLKAPVGFHPFFELEEGLAYAKKVNKPVLLDFTGHT
    CVNCRRMEDLVWVDQEVGRLIKEEYVL
    IQLYADDRNIKMEKDKVHYSSVLKRNTDDLGYWNLDFQATKYGSNAQPLYVLAGHDLNPLVKPQGAIFDAKEYAAYLQSG
    LNAFKGK

    >gi|255531516|ref|YP_003091888.1| thioredoxin reductase [Pedobacter heparinus DSM 2366]
    MSQEQEIEHVQCLIIGSGPAGYTAAIYAARADLKPVMYTGMEPGGQLTQTTDVDNFPGYPNGIMGPEMMEDFRKQAERFG
    TDIRFGYVSGVDFSTLPHKVIVDDIKTVTADTVIISTGATAKWLGLPSEQKYNGFGVSA
    CAVCDGFFFRGQDVAIVGAGD
    TAAEEATYLAKLCKKVYMLVRRDEFRASKAMVHRVLNTPNIEVIYNTETREILGNGKNVTAVRVVNNQTGAETDLPVEGF
    FVAIGHKPNTDIFKGWLEMDDTGYLKTIPGSTKTNVEGVFASGDVQDSYYRQAITAAGSGCMAALDAERYLAAKEHEIKV
    IS

    >gi|255531559|ref|YP_003091931.1| hypothetical protein Phep_1657 [Pedobacter heparinus DSM 2366]
    MEGIKILLVLMVYLFSIKDTACAITKIEKKINFQGVIKDSKKRRITEVAISYNLEDGFTGGNGNIPFTVEVKNNGYFKFE
    LPDIGRPLNFNMSIQSPDEFLGTLIDYYAESGDNIEVLWKIGELNKDTVEFSGQGSGKYNLITTLQNQFWRDKKTLGEIN
    ILTFKDSLDLAYKLDCYSKLTKDFEANKVHKLEMVKYVSPIIKNLIQVEFARYYDDWAFIIELLYIKNSNFRRQISQHYL
    EHTNEFFYSPGIIHRMCRLYLYSLADRIKLNMLIGKQANAVNVVSYYNLLKKSFDGVITDRLLGSFTFNKFILVNLEPFS
    PKVMDSLIADAENSVKTSNIKQAISKVLRTKSGTKLLSSSFIDLNNDEIYTNSLEGKVVLIDVWFLG
    CSGCAQFHKMFEN
    EVYPFLKKNKSFVILSVNIDKKLENWKMGIKSNLYTSDDYINVTTGNGLNHPFINYYNIKGGPYLMLIDVNGYIYSRLDP
    IQAVDLKYMSRLVKDAMIRRIISK

    >gi|255531580|ref|YP_003091952.1| thioredoxin [Pedobacter heparinus DSM 2366]
    MASFKEIINSDKPVLVDFSAEWCGPCKMMAPILQQLKGMIGDSATILKVDVDKNPEVSKQFNIQGVPTLILFKNGQTKWR
    QSGVIQAGQLKSIIDGFI

    >gi|255531701|ref|YP_003092073.1| Thioredoxin domain protein [Pedobacter heparinus DSM 2366]
    MKTQFTKLIMLLLCLLCFGGSSFAQDLTGTWRLKNLKTIKGSEYVNALPKQMVINQTPDGVEFKLTSNLGDRDSVISQLL
    SFNSINESKTHSGKKKLVTIQKKADGSWLKHTKVFSNNYPKELLGTDDETYTLDKEGGLTLLRVYDSTDEVKAGIQDYTA
    EASYEKLDPESAAREAAKGKGVNFVQGLNWEQIKAKAKAENKYIFVDCYATW
    CGPCKVMDMEVYPLNMVGEAMNEQFISI
    KIQMDSTKNDSPSVRPLYAAARELEKKYNITGLPSYLFFSPSGEIIHKDMGARNPDEFLNLLKDAINPNKQLYSLIKQIH
    AGEMDVNLIPGFIKHLEDKGEKSLSTELTRYYMKNYLEKLPEKDFLTRKNLDLIFKYPRTLMTQDRIYQAFCNQANIVDS
    LMEYPGFSDAAINWVFSNEFVQPTFDQAKLKGIAPDWKQILATLWSKTTKERANVIILNYKVAWYKGKKDWDNYVKYLFQ
    RTKNENIESPNQSVLGLNSTAWDLFEYSFDKKALELGLKYIDKSIALWAKSEGSAGLLDTKANLLYKLGRNEEAILLQKQ
    AVLINPASKGLKKTLEKMLSKEKTWEFGANENRKVK

    >gi|255531883|ref|YP_003092255.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MRKIIKYALLLLCIVMMKVNAQEKKTLPPDFNFLPSTEVDVPDSVWVFFRKGPLVNNQSGERMKIKPNVDGSFSFSPSFI
    QPVYWFEIYFMYYKSRQRAKPATYYAEPNDQLKVIYAKAADTGKGTIPKMKLTFSGKGAEKYKVVELLGKIKTDLSRSLN
    EDAKKEFGADSKTKDDKIGREGYYKSAELKVYLNSILEKVKGANRQSQDTLLKYKSLIGNNITNYLSYELSSSGYFSSWI
    DYLYRIGNSPNFRQTITDFYFLNRNSVIKEVSDPLVKYSKDYKFNKLLEIKYETGFRNKGKSLPYYKLYDAVKAVKNSGL
    RDILLSYLMYEPVFTNRITNTDSQDSCIRDALAVIKSPELLEPVQEQLLFFRGSQIPDFTFVDQEGKPTSLADLKGKVFM
    IDFYFYG
    CKGCIAYAKRFKEEIYPEFVHNPKFKVLSVSVDKKREHWISAMNSNLYNERDYINLSAGNLSWKHPFLKHFNR
    ASFPFILLVDKNGRLISKIENESSPVIADFIRKSLNEKNSK

    >gi|255531890|ref|YP_003092262.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKRVILMYLLCAGLVSHAQEWTKKINDSDFHNRRSKGLKIGDKMPDISLGSVWNNKTGKTRFSDFKGKLIILDFWSQGCS
    D
    CIAAFPKMEKLQKEFKDEIQIFLFNPWEMVDDVIMHFKKNSEDLKMPDLPCIQKDTKGISEQLLKLLPVMGVTTQVWID
    KDGKITLIGSSRNNTSKKIRDFLDGKEVYKLNNNSLNPNFDPSYPYVKLLGDFKTTPVKYSSTFTGFNNEYQAQNPNRAL
    NILDSAAGTIRNTFVNTFVLDLYSHPFKDIFLAQQKKILYEAISHRGYVIPFNFELPKDTLRYTYFHKYLNGGSDDSIYR
    KPKFCYEQILPINVPVELQKKYMLEDLNRYFSSLYGTYGRLEKRVVPCYELVQLAGSMPVNSKSRNPDNLYSTMKKVNTV
    KDWKKYVRYENYSLSLICQEIFENQYLRNEFLENKKSSKPAILFNETGLEGTAILDLLELPEAAAIKSMEDYRRALNKIG
    FDIKVSSRSLNFLVITDNSGK

    >gi|255532001|ref|YP_003092373.1| hypothetical protein Phep_2106 [Pedobacter heparinus DSM 2366]
    MTIKEEDMKPTITIEYCPKCGWMLRAAYMAQELLTTFIDDINGVLLKPAGIAGVYTISVNEDVLYDRKERGGFPEIKELK
    QLVRDKVNPEKNLGHSDKNA

    >gi|255532030|ref|YP_003092402.1| DSBA oxidoreductase [Pedobacter heparinus DSM 2366]
    MKVDIWSDVRCPFCYIGKRKFEMALAKFEHRNEVVVEWHSFELDPNAETLLNVDAYDYLADRYDRNREWAIERHRALEES
    AAEVGLTFNFDKAVMANSFDAHRLIQMAKVNDTPGDIEELLFKAHFTDGKNIADQQVLIGIGKEGGLDGLAVEMMLKSDD
    FTDDVRHDEKIAQQIRIKGVPFFVIDQKLSISGAQAPEVFLDVMTKVKNGVED

    >gi|255532061|ref|YP_003092433.1| OsmC family protein [Pedobacter heparinus DSM 2366]
    MEKLYTASVTAKGGRNGHIKSSDGTIEFDVRKPREMGGQGGATNPEQLFAAAWGPCYLGALAAVAEHDGIDVSEATVEVH
    ISFNQDGNSFVLSADLDVHIPGIAPDEAQKLADKAHRV
    CPYSKATKGNIEARVTAI

    >gi|255532081|ref|YP_003092453.1| glutathione peroxidase [Pedobacter heparinus DSM 2366]
    MNLLLIILNLFFTPPAKSVYDFSFKTIDGKEVKLSKFKGKKILIVNTASKCGYTPQYEDLEKLHKQYGNKVVLIGFPAGN
    FGGQELATNSEIKEFCTGKYNVDFLLAEKSSVKGNDITPLFKYLTTAENPDFTGDINWNFEKFLINEKGQLVHRFRSKVK
    PLDENITKNL

    >gi|255532149|ref|YP_003092521.1| cytochrome c biogenesis protein transmembrane region [Pedobacter heparinus DSM 2366]
    MTLKNYLTSTKVLVIGCLIFFASAATVHAQEADTSLSGLEFTEIAPDTVSPADTVAAKAAVVPAAGAAGIAAAPGNKAPA
    AEADKTLWGTFIAGLVGGFLAFLMPCIFPMVPLTISYFTKRAGSKGKGIGQALIYGLSIIVIYVGFGLLITVLFGSAGLN
    ALSASGLFNFLFFILLVVFAISFFGAFEITLPSAFVNKIDNKADNSKGLAGIFFMAASLALVSFSCTGPIIGTLLVDASS
    KGELLGPAVGMFGFALALALPFTLSAIFPGFLSSMPKSGGWLNSVKVCLGFLELALALKFLSSADLAWHWEWFDREIFLV
    LWIVIFVLMGIYLLGKIRFSHDSEVPYVSVPRLFLAILSFSFALYMVPGLWGAPVSVLSGLAPPMNTQDFILNGNQSSAS
    GSVAADFPAHVKYSGSLKAPVGFHPFFELEEGLAYAKKVNKPVLLDFTGHT
    CVNCRRMEDLVWVDQEVGRLIKEEYVLIQ
    LYADDRNIKMEKDKVHYSSVLKRNTDDLGYWNLDFQATKYGSNAQPLYVLAGHDLNPLVKPQGAIFDAKEYAAYLQSGLN
    AFKGK

    >gi|255532233|ref|YP_003092605.1| OsmC family protein [Pedobacter heparinus DSM 2366]
    MKRNATAVWNGTIKEGSGHLTTGSKVLDQTQYSFNSRFADGIGTNPEELMAAAHAGCFTMKLSLDLTEAGFTPGSLETTG
    TVTLDNGTITSSNLVLKASIPGISDAQFQEIAAGAKAT
    CPVSRAYSVDITLDASLV

    >gi|255532247|ref|YP_003092619.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MKKLIIIIFLGCFIFKCFGQKEFEATSPNYGNVPILIGEKVPDLTFLHVLNGEKKPLSLSSFKGKAVILDFWGTWCGSCI
    SSFPKMDELQKKYSKYLQILLVDDSMVDTLENTTAFVQQHEQDGEIFTIPIIWDKGFTPILFPHMSFPHYVWIGADRRVK
    AITDGTHFTEANFERFFAGLELNLKLKER

    >gi|255532366|ref|YP_003092738.1| UBA/THIF-type NAD/FAD binding protein [Pedobacter heparinus DSM 2366]
    MKPFGKIGTTVWFKEMENQKRYDRQVILPEIGLDGQQKLKNARVLVIGAGGLGCPLLLYLAAAGIGHMGIADHDVVDESN
    LQRQILYQMADIGGLKAEIAVNKLGLLNPDVDFRAYPFKLGMENAAELIAVYDLIIDGSDNFPTRYLVNDTCVALNKTLV
    FGSIFRFEGQVTVFNHKGGPDYRSLYPEPPAATEMPN
    CAEAGVIGTLPGITGTLMANEAIKIICGFGEVLSGKLLLFNAL
    NNEMQVFGFGSHNVQNRRAVGQKGKMDVPALPGPHEISPGQLAEWKNENIAYQLIDVREAYEYEEYHIGGINIPLYELSQ
    HIPALLQYEKIVFC
    CASGTRSKIALNLMKNNHKAECYTLIVSANQQT

    >gi|255532376|ref|YP_003092748.1| Copper-exporting ATPase [Pedobacter heparinus DSM 2366]
    MFEQKTIATDTQCYHCGEDLPSNPYTLDDRNFCCVGCKGVYQLLSAHNLCNYYAYNDVPGQTQKVQTGHFEYLDEPGIVA
    DLIDYTDEKITVITLYVPAVH
    CSSCIWLLENLHRINPAIVQSRIDFLKKQVAVTFKNQETTLRALVETLAAIGYEPLISL
    QDVVKKQQTDFSERKLLGKIALAGFCFGNVMLLSFPEYFGLSDLEQQFKSFFGWLNLVFALPVVFYCGRDYFSSAYYNLK
    NGVLNLDFPLALGIAVMFIRSAAEIINRTGAGFVDTLCGLVFFLLIGKWMQQRTYHHLSFERDYRSYFPVAVTLITAGKE
    KPIPLNELAPGHRILIRSNEIIPADAILLKGAAEIDFSFVTGESAPVKKVYGEIFYAGGRQLSGAIELEVVKPVSQSYLT
    RLWNNTAFYTPKDPIKTFSQTASKYFSLVLLLIAFSSAAFWGLAGDTSRAVASFTAVLIIACPCALALSSPFTLAAVLSI
    FDKNRFYLKSTAVVEELARIDTFVFDKTGTITNPAASGFSFHGRITDEQKQLLNDLASNSGHPLSRELVKVLHKHKVYAV
    DDYVEKIGRGISGRINGHEVKLGSSAFIGLPLIDSPMRSNIHLMIDAEYLGYVVFEQQWRAGFKDLTFKLGKYADLHLLS
    GDQDHDKQTLIPFFPNASQLQFRQSPQNKLDYITKLQNQDKKVLMLGDGLNDAGALRQSNVGVAVTDNINNFSPDCDAIL
    DGAAFHKLPQFMKQAKDAVKIIHISFGISLVYNIVGLYFAVQGLLSPLFAAILMPISTVTIILFTSIAARLYARKNKLL

    >gi|255532417|ref|YP_003092789.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MMKRIGYIVLLCIVFAACKDKGNFVVEGTFKNAAAGSKVYLFGIQKDQVKPLDSTVFSEKGEFKFIHSTPVVDFFRISSG
    HSEYMIIAQNGDQIKIQADLADKNLGYTISGAVEADKLEELNKTKNQYMVKIGEIQRSFDEAVAAQPDKRDMIMEQMRPA
    YTQEIDGLNKAVLKFAQNNTSSLAGFYAVNLLNPAEYEKELVDYADKIKSNFNNNAAVTEFLVKMAKLKSVQVGQQAPEF
    IINSVDGKPIKLADFKGKYVMLDFWASW
    CMPCRQENPNVVKAYNAYKDKNFTILGISLDKDAEAWKKAIAADNLSWAHAS
    DLKDFESPTALLYGIDAIPSSFIVDPNGKIIAKNLRGAELDAFLNKTLR

    >gi|255532549|ref|YP_003092921.1| OsmC family protein [Pedobacter heparinus DSM 2366]
    MTGNQITAITELDRSHYKTKVYSGGHFIYSDEPEDLGGTDEGMAPAALLLASLGSCTAITIRMYADRKNLKLDHIKIELA
    ICKEEEMNKETTISRKIIFTGDLTEDERKRLLVIADKCPIHKILSNPIKIETS

    >gi|255532745|ref|YP_003093117.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKKILLSLLFLFISYIGAMAQGKENWPKIGKIFPSIKFNDVQYHPSKQLTLTDLRGKWIILDFWNFFCKSCVEEFPKLDS
    LQKHFAKDVKVLLVGYTGSQYSTHDDKHIQPLFERVRKKNQLSLSIAYDSVVFHQLQVYSPLKLIIDPKGVLRAVTYRIT
    DADMRSFIAGKEPRLPKAWFRNENKVTYDPDLPFLLNGNGGNDKDFLYRSVLAEFKDYMNGNNQYEFNIKGNQMQVLGAS
    LAALYRFAYTGAGTIHYGDPLYGRVAMMPILELKNQAPFEVDIDLRTGMYAYGISFPPDKSSKVQVMRMMQQDLQKYFGY
    KVEVENRKMAIWKLVVISKAPPALKLPEDVANYPFDSVRSMLYGITSTYGNDRYVFVDETNSKGKLDIILKCKMDDFQDV
    RRALRENGFDLVQGEKEMQVVVIKDNPDEN

    >gi|255532816|ref|YP_003093188.1| Peroxidase [Pedobacter heparinus DSM 2366]
    MSLRIGDTAPNFKADTSIGEIDFYEFLGDSWGVLFSHPADYTPVCTTELGRTSALKSEFEKRNVKVLALSVDSAESHKGW
    IKDINETQNTEVDFPIIADEDKKVADLYDMIHPNASETLTVRSLFIISPDKKVKLMLTYPASTGRNFNEVLRVIDSLQLT
    AKYSVATPADWEDGQDVVVMNSIKTEDIPAKFPKGHKVIKPYLRTTPQPNK

    >gi|255532885|ref|YP_003093257.1| protein of unknown function DUF395 YeeE/YedE [Pedobacter heparinus DSM 2366]
    MDMIELIKQPWSWYFSGIMIVAIMLMLIFWGKSFGFSSNLRTICSMAGAGKRTGFFNFDWKAQRWNLLFLIGAIIGGWIS
    STLLSSPAGLDLSAATVTDLNALGIGFNGGINPDELFSLQAMGNPKVLFLLVIGGGLVGFGSRYAGG
    CTSGHAISGLSNL
    QLPSLLAVVGFFIGGLVMTWLIMPFIF

    >gi|255532889|ref|YP_003093261.1| dihydrolipoamide dehydrogenase [Pedobacter heparinus DSM 2366]
    MNYDLIVIGSGPGGYVAAIRASQLGLKTAVVERESLGGICLNWGCIPTKALLKSAQVFEYINHAAEYGIKTAEAEADFAA
    VIKRSRGVADGMSKGVQFLMKKNKIDVIMGTGKVKPGNKVEVKAADGSQKEYTATSIILATGGRSRELPNLKQDGKKVIG
    YRQAMVLPEQPKSMVVVGSGAIGVEFAYFYATLGTKVTVVEFMDNVVPVEDEDVSKQLLRSFKKAGIEVMTSSSVESVDT
    SGSGCKVQVKTASGMQTLECDIVLSAAGVVANIENIGLEETGIKTEKGKVVVDEFYNTSVKGVYAIGDIVGGQALAHVAS
    AEGIICVEKIAGHKPEPLDYNNIPGCTYCSPEIASVGYTEKAAKAAGYELKIGKFPFSASGKASAAGAKDGFVKLIFDAK
    YGELLGAHMIGANVTEMIAEIVVARKLETTGHEMIKSVHPHPTMSEAIMEAAADAYGEVIHL

    >gi|255532943|ref|YP_003093315.1| hypothetical protein Phep_3055 [Pedobacter heparinus DSM 2366]
    MNLFRILSVVVLTFLGSAVFAQSKTEKIKVAGNCGMCKKKIETALKVNGISTADWNKTTKVLTVSYDSTKISNDQIQQKV
    AAAGYDTPKFKAPKEAYEKLDDCCQYDRTGKAGETH

    >gi|255532946|ref|YP_003093318.1| copper-translocating P-type ATPase [Pedobacter heparinus DSM 2366]
    MNKNVETISMPVLGMTCAACAVSIESMIAAQEGVDKAAVNYATQTVQVSYHPDVIQPDAMQKAVQSIGYDLIVAQEGAAA
    LQEEAQKNNYTTLKKRMVWSLILTIPVVIIGMFFMDMPNGNYYMLALTTPVLFIFGRNFFINAWKQAKYGKANMDTLVAL
    STGIAYLFSVFNTFYPEFWHSRGLHPHVYFEAAAVVIVFIMLGKLLEEKAKSNTSSAIKKLIGLQPKTVIVITKDGEKEI
    AVADVHVTDQILVRAGEKIPVDGEVYEGGSYVDESMITGEPVAVAKKVGDKVFSGTINQKGSFKFKAEKVGGETMLAQII
    KLVQDAQGSKAPVQKLVDKIAGIFVPIVILIAIISLGAWLLFGGEHAFTQGLLAMVTVLVIACPCALGLATPTAIMVGIG
    KGAEHGILIKDAEALELGHKVNAIILDKTGTITEGKPEVTHLEWADGKDKELLQSVLIALEQASEHPLAEAIVRKLKTDG
    VKGSAVTDFESLTGKGVSAVFEGEKYWAGSHKILKDQQIQVPEALQTKVDELQQLAQTVIYFTNTTQVLAMVAIADQIKS
    GSAKAVKALKGAGIEIYMLTGDNQQTAASVAGQSGIDHFKAEVLPSDKADFVKELQAKGKVVAMIGDGINDSQALAQADV
    SIAMGRGSDIAIDVAKMTLVSSDLQQVPKALRLSKLTVKTIRQNLFWAFIYNLIGIPIAAGLLYPINGFLLNPMIAGAAM
    ALSSVSVVGNSLRLKLAKLI

    >gi|255533039|ref|YP_003093411.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pedobacter heparinus DSM 2366]
    MIIKNFDVIIIGGSYAGLSAALSLGRAIRKVLVIDSGKPCNRHTPHSHNFLTQDGKTPAAIAEIGKEQVLQYPTTQFMDA
    QVTAVKREKAQFLVSTSGHHDLTAKKVLFATGVKDLMPNIESFDDCWGISAIH
    CPYCHGYEYKGQKTGLLANGDIAFEFS
    HLLYNWTDQLTIFTNGPSTITAAQADQLALKHIFIVEKKIRKFQHLKGYIQSVSFNDGSTFQLDAIYAKLLFEQHCLIPE
    HLGCEINEQGYIQIDEFQRTSVPGIYAAGDNTTGMRSVASAVAAGTKAGAFINHDLISGK

    >gi|255533270|ref|YP_003093642.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MKKIVISLFCLLPLLATAQQSKPDERGYIVKVGDKAPDDFKLVLHTGETTSLSKLKGKVVVLQFTASWCVVCREEMPHLE
    QQVWQAYKNKGLMLIGVDRDEPLKVVQKFAKDMKISYPLALDPGAAIFGRFADKKSGVTRNVVIDQQGKIVYLTRLYDEQ
    EFKGMLAAIDKLMK

    >gi|255533490|ref|YP_003093862.1| iron-sulfur cluster assembly accessory protein [Pedobacter heparinus DSM 2366]
    MSTVDTAFAPVTFTETAVKELFKLKNQQEIAEDFGLRVGVEGGGCSGMNYVLGFDQKKEGDQEFIIEGIKVFMHKAHQMY
    LLGMQVDWQDGLNSRGFTFSNPNAASTCGCGTSFSV

    >gi|255533512|ref|YP_003093884.1| Rhodanese domain protein [Pedobacter heparinus DSM 2366]
    MKKFQTLLYYCYSHIAGAEQFADDHLKFCKSLGLVGRIIVADEGLNGTVSGTQEACEAYMAAVKADERFAKTDFKIDDVE
    EPSFIKMHCRYKAEIVHSGLRDPNIIDPNRQTGKHLEPAEFQKMIDQDDVVILDVRSNYEHNLGKFKNALTLDIENFREF
    PDKINELAKYKDKKVLTY
    CTGGIKCEKASALLLHHGFNEVYQLHGGIIKYGKEAGGEDFEGKCYVFDNRIAVDVNTVNPT
    VVSKCFNCGKTTPKMINCANPECNEHITQCDECGEELQGCCSVACTSNPRKRKYDGTGYYVKVPQPVNVAKK

    >gi|255533591|ref|YP_003093963.1| dihydrolipoamide dehydrogenase [Pedobacter heparinus DSM 2366]
    MQYDVVVIGSGPGGYVGAIRCAQLGLKTAVIEKYKTFGGTCLNVGCIPSKALLDSSEHFHNAAHTFQTHGINLKDLKVDM
    PQMIARKNDVVAQNTAGIQYLFKKNKIDAFEGVGSFIDKNTIKITKDGKSETITAKNVIIASGSKPTALPFLPVDKKRII
    TSTEALNITEVPKQMVVIGGGVIGLELGSVYARLGTKVSVIEFMPSIIGTMDAGLGKELQRVLKKSLGMEFFMGHKVTGA
    STKGKKVTVTATNAKGEEVKFEADYCIVAVGRTAYTEGLGLENIGIKPEERGNKIPVNDHLETTVPGVYAIGDVIKGAML
    AHKAEDEGVYVAERIAGQKPHINYNLIPGVVYTWPEVASVGYTEEQLKEKGLSYKTGSFPFKASGRAKASMDTDGFVKVL
    ADAKTDEILGVHMIGPRAADMIAEAVVAMEFRASAEDIARICHAHPTYTEAMKEAAMAATENRAIHI

    >gi|255533665|ref|YP_003094037.1| peptide methionine sulfoxide reductase [Pedobacter heparinus DSM 2366]
    MNTEKAILAGGCFWGVEELIRHYPGVISTVVGYTGGDVLNATYRNHGTHAEGIAVVFDPAKLSYRRLLEYFFQIHDPTTR
    NRQGNDIGTSYRSAIFFMDETQRETAEALIAEMEASGIWPGKIVTEVVPATDFWDAEEEHQDYLQKNPYGYTCHFERPDW
    KL

    >gi|255533868|ref|YP_003094240.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MRFKLLILLAVGILAGGNAFTQTTVVTIGTKIPGHTLTRLINFPRPSVGLTDFKGKILILDFWNRGCTSCIDSWPKLMKL
    QEKFKDNIQILLVNDLDDEATIRALIKRWSKTFEMQMTLPTAYQDKVVNSMFPHQSVPHLVWIDQVGTVKYISMAQFLNH
    ETIENMILGKEMDIRQKNDVQVPVKWSRPLFINGNGGPEEDVLSRTVIRNNILNQMGVFMAGKVKDANASYAVISNTTVV
    DMFRMLYGKGVDRIGNQLRVPYSQVILKAADTTKLVNKVNDAVRPENFYTIQFTAEKVFSTEKLKDILKSDLQRYFELKV
    SREKVKKTCLVVSRSEFPVTAYKEGTQVLNTNDGMLKLNAVTLQELLNALIGRIGYYSGLSYPIVNESGFTDKLGNIEID
    TNIQDWKKLSYALNKHGFIFSLQEREIEALVISDDQ

    >gi|255533873|ref|YP_003094245.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MNIKIIIVALLLLPASFCLAQDKFEISGQLSQAGKDMMVMLSYKNSEGKDTKDSALVKNGKFLISGTTAFGNKAYLTLMP
    VKKDTIRRVGQSDYQEFYLEKGMYKVTGTDSLAKASITGAQAQKDFLLWKSKSQALLAQFREITQRFTKVYYAKVKDTVT
    IKKIQAEARPVHAKIEAALDSFIFSHPDSYVALDLIASEKTAVIDPQVFGAYYNPLSKRVLASFTGQKLTAKFEKAKKIS
    IGKTVDFTQTDDKGNEFKLSSLKGKYVLVDFWASW
    CVPCRAENPHLLKAYNQLKDKGFEIVGISLDETKAAWLNAVKHDG
    MPWIQVSDLKGFKSEIAVQYGISAIPQNFLIDPQGVIIAKNLRGEDVNEQLAKLIR

    >gi|255533874|ref|YP_003094246.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MKKTIFSVLILLPFMAAAQKNYTITGKLPAVKGQAKAYLVLLKNNAWKETDSAEIKDGKFQFTGSVNEPQNAILAVRRNG
    AADSGRQRDALGFFIENSKIEIVGTDLISNAKITGSVANRENEEREAMIKPVTAKIIKLQDEFGKKAADGSYIKSLEERK
    KAGDSIQKLVAMNKDINHRFAETHLNSFMGLYTFNMYVLDNKFDPAKEEPLFNRFSTVLKSSPLGKRTIEKLEIGKRRQT
    GAKATDFTQNDLNGKPFTLSSLRGKYVLVDFWASW
    CGPCRAENPNVVKAYNELKGKNFEIVGVSLDYPGGKAAWAEAVKK
    DGLPWIQVSDLKGWKNEVALMYGINSVPQNLLIDPQGVIIAKNLRGEALTDKLKELIK

    >gi|255533890|ref|YP_003094262.1| Redoxin domain protein [Pedobacter heparinus DSM 2366]
    MFKHALACCLLVLALLQVQAQVVQITPEKPQRGEKVTITYHPGAAGAAIGKDATEVIINFTYSTFYELPWKLPMTRQGND
    WVVSFVLQRYATFATFYLQSGELIDKPAADRHYSVAVYKDDKRVRDGFLHESYSLGAQMPKSPGIHALQLELLRKELANY
    PDNYEAKVREQSVLMAMAKTPAEKLEHRIEARKIIAAQFEKNPTFGGNLNKVTMGYLIIGENSRLDSIRKVVSKRFPKSD
    LAKDYLITAIGKEKDTVKKIAQLEALLKTGNESGENSTDIHRMLFEHYTAAGDAAKAVYHARRSLGAANPYTPLTLKTIA
    GELTKAKLAPDTAITYAEAALKIADRWPIGVIRYFPEYGHILPFVADSTRSRTVAEARSGLYSIIALNKSYLGNRAEALN
    YAAKAEAAGANKESLMNVALVYEQAADPKKAFDVLWHVLLKDPSDTVAIAAAKKNFLKFNTSETEFNAKVKNLEALKMTR
    LKAALKKQLMNKPGPELSGLTDLKGNAVTKAMMQGKIVVLDFWATW
    CVPCMQEMPYLQKVYEQYKHHPNVMFMVINSGAR
    NTIKDALGWEAKNPQYTFPLYFNNDPDIGEKVGFTLIPTIAVIDQQGKMQFRTIGFEGAELEHKLTAQIEVLLEGK

    >gi|255534146|ref|YP_003094518.1| Thioredoxin domain protein [Pedobacter heparinus DSM 2366]
    MFLELTEDNLQQYVADNNKVMVQYAASWCGNCRIMKPKFKKLAAENEDVTFLIVDAEKLPGSRKLANVDNLPTFAAFEGG
    ALVDQVQTNKAEVLNELFDKIRS

    >gi|255534147|ref|YP_003094519.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pedobacter heparinus DSM 2366]
    MAIVGKKFPSVSIDAMSEMGDDLKINVFEEAVSKEKKVLLFWYPKDFTFVCPTELHAFQAALPDFEKRNTIVIGASCDTN
    EVHFAWLNTAKDNGGIEGVTYPILADTHRHLANILGIVDQEVEYDEEGNESFSGSNVTFRATYLIDETGKVFHESVNDMP
    VGRNVKEYLRLIDAYAHVQKHGEVCPANWEEGKEAMSANRTGVAEYLSAN

    >gi|255530429|ref|YP_003090801.1| OsmC family protein [Pedobacter heparinus DSM 2366]
    MSTSKITYNGGLRTTAVHQRSGKEIITDAPVDNKGKGEAFSPTDLLATSLGNCMLTIVGIAANEHDFNIDGTTCDITKVM
    AENPRRVAEIVVNFQFPANDYSNKDKKIIERSANT
    CPVMYSLHPDIKKTVTFNY