Pediococcus pentosaceus ATCC 25745 uid57981

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116491852|ref|YP_803587.1| NAD(FAD)-dependent dehydrogenase [Pediococcus pentosaceus ATCC 25745]
    MTEKIIVVGCTHAGIAAVNEILKYHPQADVTVFERHDTISYLSCATYLTLGKTISNLDEAMYADPDYYRAQGIDMRLRHD
    VIDINVEEHTVFAQDLETKEFTTESFDKLIMATGSLTSIPTIQGVENPKVKL
    CKTYEEARDLCDEAQNDERIAIIGGGYI
    GVELAEGYNKSNHEVILFHKKETPLDRHIEPEIADKITNLLEDKGIQVKTGTIVKSFEDGANDTLIVKTADEAFEVDMAV
    ICTGLLPQADLLQGKVDQLTNGAIVVNDYMETSNPDIFAAGDAASVKHNGLQTDVYMPLASQAVRQGALAGINVLDKRLR
    SIGTQSTTGMLIFGRTLACSGVTLAMALDAGINATKVAYKGSYRPDFMPNAHKVEIELVYDRNSRKVLGVQLWSKHDVSQ
    AADTISALMHYHGTIDELSFIDMLFSPNFDQPFNYLNLVGQLAVKQENGYLRT

    >gi|116491919|ref|YP_803654.1| Thiol-disulfide isomerase and thioredoxin [Pediococcus pentosaceus ATCC 25745]
    MSTQANLTNEEIFEAMNSGKKMLFFTAGWCPDCAFIKPAMPDIMKKYDQYDWITVDRDDNLEVAQHFGVMGIPSFIALED
    GKELGRFGKGERRTPQEVEEFIQGIA

    >gi|116491967|ref|YP_803702.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, related enzyme [Pediococcus pentosaceus ATCC 25745]
    MTESYQFDVLYLGAGHGAFDGAVPLANSGKKVAIVEADKIGGTCPNRGCNAKITLDNPVQLLRHQERLDGIVNGDLKLDW
    TANVEHEHEVIDGLPDMITGLLDSVDIEIIHGRGKFVDAHTIEVDQQRYTADKIVIATGLRPHHLDVMGSELTHDSTDFM
    NLKHLPENIVIIGAGYIGMEFATIANAAGANVTVLLRHNRALRKFNQDYVKQVIADLEKRGVKFIYNAQVDRFEEDGSHF
    TVSYNDHETLTTDWILDATGRIPNIENIGLDEVGVSYNANGIEVNDHLQTNIDNIYASGDVLDKEQPKLTPTAIFESSYL
    TQLFTGKTTDAINYPAIPTIVFTSPQIAQVGMSVEEAQQNPDYTIKTNHLPDGWFRQVDKETIGNNTLIYDQDHHLVGAA
    EVSEHAADAINVLLPAIEFQYTAEQLGRIVPLFPTLGADVWSQI

    >gi|116492048|ref|YP_803783.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, related enzyme [Pediococcus pentosaceus ATCC 25745]
    MKKYDVVIIGAGPGGLGLAYPLKEAGLEVAVVEENLWGGTCPNRGCDPKKVLLAAIEAKKQNQYLLGNGIKNETQIDWPA
    LMQFEKTFTDPVSRSSRSGLTDAQIDVYDGHAEFIDHHTLKIDQTTITSEKFVIATGQRPSRLTNIENQEMMQTSTDFLK
    MDHLPNELALVGGGYIAFELAMIASGAGAKVHIIHHNQRPLKAFPKAYVDDLVDQLKTQGVEVHLGIDLKRVEPKDERFE
    LSDGQGFKQIVDQVFVTAGRKPNDDSLNLEKIGVQTDRGGIVVNEYLETSVDNIYAMGDVVSKALPKLTPVSGFEARYLA
    KKLTNATQAAIDYPAIPTVVYGMPKLAKVGVELDEAQQHPEQYEIKTAEMTEWFTYRRLQDPFAKISVIHEKSSGKIVGA
    ITMSSEAEHLINDLTMIINQGGLVDQINNQILAYPTEASDLGYM

    >gi|116492089|ref|YP_803824.1| NAD(FAD)-dependent dehydrogenase [Pediococcus pentosaceus ATCC 25745]
    MKIAIVGCTHAGTFSAQQILTEHPDYEVTVYERNNNLSFLSCGIALWVGNHVSDPNKMFYSSPEALTKLGATMNMEHDVL
    SIDPDNKTLEVKDLKTGEIKTDTYDKLVVTTGSAPIIPPIDGIDNKRVKL
    CKNWAHAAELKRIDDDINSVIVIGAGYIGA
    ELAEQYALTGREVTLIDGLPSVLAKNFDPEISDRVAKDYTDHGVKLAMNEMVQGFSGDDQITVKTDKGSYTADYAVLCVG
    FRPHTELLKGKVDMLKNGAIITNEYMQTSNLDIFAAGDSSVVHYNPTGKDDYIPLATNAVRQGILIGHNIEKPTMKYLGT
    QASSAVALFGKTMASSGLTVGAAKARGVEVDSVTLEQDYRPEFMLSTTPILMRLVWDPETRVVLGGSFYSEYDCAQSANV
    ISLAIQNKMTIDDLSMVDMFFQPNYDQPLNYINALAMTAVAQADAK

    >gi|116492176|ref|YP_803911.1| Thiol-disulfide isomerase and thioredoxin [Pediococcus pentosaceus ATCC 25745]
    MAVTINQDNLTDVTQSGLTIVDFWAPWCGPCKMMEPALESLEKTYGDQIQFAKMNVDNNQAVAESFKIMSIPALVLFKDG
    KAIEKVTGYYPEAKLAKYLEKKISENEPK

    >gi|116492212|ref|YP_803947.1| copper chaperone [Pediococcus pentosaceus ATCC 25745]
    MTKIIMKLDTLTCPSCMTKIEGALNKMDGVKGVKVLFNASKIKAEVEPEIKGEALKQTVENLGYTVKDLKTKVSEG

    >gi|116492248|ref|YP_803983.1| thioredoxin reductase [Pediococcus pentosaceus ATCC 25745]
    MTKQYDVVIIGAGPAGMTAALYASRANLSVVMLDRGIYGGQMNNTADIENFPGFKSVLGPDLSKDMYESSTQFGAEYAYG
    SVESIRDDGATKLVKTDMGDEFEAKVVIIGTGSEYKKLGVPGEEDFSGRGVSY
    CAVCDGAFFKGTDVVVVGGGDSAIEEG
    LYLTQLASKVTVIHRRDQLRAQKIIQDRAFANPKMEFVWNSNVTEVVGEGKVTGVKVNNNQTGEDSFIEAAGIFIYVGVK
    PMTAAFADLGILDEQGWIPTDDHMHTKVPGILAVGDVRKKDLRQITTAVGDGGVAGQQAYEYIQALND

    >gi|116492325|ref|YP_804060.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, related enzyme [Pediococcus pentosaceus ATCC 25745]
    MIKAKNVYIGFGKAAKTLAFRQAQRGESVVVIEESDQMYGGTCINIACIPSKLLYELSDKPQVGGLKDNYKMAITKKRSV
    IGKLRYSNFHKLADQKTVKVLNGSASFIDQHTLNVKYLNGATEEVVGERIFINTGATSTIPDIPGLKESSRTVTSTDLLD
    QDHFPQSLAIIGGGYIGMEFATTYSQFGSKVTMINRNAEFMRGMDQDVSQAVKQNFDKAGIEVLQSAEVIRVQDQGSHAV
    LTVASDGSESQIMVDMILVATGRKPNIQGLNLEQAGIRYTEAGVAVDDHLRTNVQNIWAMGDVRGGAQFTFLSLDDYRIV
    YNQLYASGTKTTEEQVIVPKTIFLMPPLSQIGMSEREALDKKIEYRTGKVAVAGMPKAHILGHPNGFYKVLIDKEDHILG
    ATIYAPEAHEIINIISLAMHANLPYQMLRDQIYSHPTMAEGLNDLFETIGMN

    >gi|116492716|ref|YP_804451.1| peptide methionine sulfoxide reductase [Pediococcus pentosaceus ATCC 25745]
    MEETAIFAGGCFWCMVEPFETQPGIINVVSGYTGGHVANPTYEQVTSHTTGHTEAVKITYDPEIISYRQLVQIYWQQTDP
    TDAMGQFQDRGDNYRPVIFVNSAEQREIAEKSREQLAKSEMFDDPIVTKIEDAQPFYPAEEEHQEFYKKNPLRYQIQEAG
    GRSEFQKKYWK

    >gi|116492717|ref|YP_804452.1| peptide methionine sulfoxide reductase domain-containing protein [Pediococcus pentosaceus ATCC 25745]
    MNSNNWSKAELKKKLSPEEYEVTQNAATEHPFTGKYDNFYQKGIYVDVVSGEPLFSSTDKYDAHCGWPSFTKPIDPKLVV
    NHRDSSYGMERVEVRSKDANSHLGHVFDDGPLDQGGNRY
    CINSAALKFIAYDDLEAHNLGYLKKLFN

    >gi|116492823|ref|YP_804558.1| arsenate reductase [Pediococcus pentosaceus ATCC 25745]
    MTTFYCYSKCSTCKKAEKWLQEHDVSYGKIDLVEQPPTKEQMLNIFSKSNQKLRYFFNTSGIDYRKMGLKDKVEMMTKEQ
    AATLMSKNGKLIKRPLMVDDTKVTCGFNVGVYEENWI

    >gi|116492968|ref|YP_804703.1| arsenate reductase [Pediococcus pentosaceus ATCC 25745]
    MVILYTSPSCTSCRKAKAWLKEHRIDFTERNIFSEPLSAEEIKRVLRMTENGTEEIISRRSKVFQELNVDLDDLPLQQLI
    NLIEENPGLLRRPIIMDDKRLQVGYNEDEIRRFLPRKVRQLELAKAQSIANL

    >gi|116493006|ref|YP_804741.1| Thiol-disulfide isomerase and thioredoxin [Pediococcus pentosaceus ATCC 25745]
    MVEAITDANFEEKTNTGVTLTDFWATWCGPCRMQSPVVEQLADEMGDKVSFSKMDVDQNPETARNFGIMSIPTLLVKKDG
    AVVDSIVGYHSKEQLAKILDQYI

    >gi|116493040|ref|YP_804775.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Pediococcus pentosaceus ATCC 25745]
    MEVLRGGEKVELVGNPPMIGEQLPKFKVFTGDGEKVKTRDLLGKPLLISVVPDLNTPVCSMQTKKFNQETDQYSDIRFVT
    ISNNMPKDQVAWCANEGVKNMEVLSDHELSFGYEMNLYIPNAGYLARSIFIVDADGKIIYREIVPEIHDEPDYQAALDFI
    NKM

    >gi|116493090|ref|YP_804825.1| rhodanese-related sulfurtransferase [Pediococcus pentosaceus ATCC 25745]
    MINSIENDDFYQKMQNEKLTVLDVREKVEFIDGHVPMAQNWPLSELAEKYSKLDTSTSYYVICRSGARSANACAFLQDKG
    LNVTNVTGGMLAWKGEVI

    >gi|116493225|ref|YP_804960.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Pediococcus pentosaceus ATCC 25745]
    MRKIIVYTKNNCIQCKMTKRFLSENGVTFEERNINANPEYIDALKAKGFQAVPVVQFSEEKAVAGFRPDLLKKLAI

    >gi|116493347|ref|YP_805082.1| NAD(FAD)-dependent dehydrogenase [Pediococcus pentosaceus ATCC 25745]
    MDKVKVIIVGASHGGHESAIELLDKYDNVDVTIYEMGDFVSFMSCGMQLYLEDQVTDVNDVRNFRPEDITSKGGKIYNNH
    QVTAIDVDQKQVTVKDLKAGSEEQVAYDKLILSSGVTPKNLPVPGTDLKNVYLMRGYDWATKIKAALTDDSIKNVAVIGS
    GYIGIEAAEVFAKKGKHVTLFDFIDRPLGNYLNHEMTEIIDKTLTDNGIQVEMSQSITAFKGDDKVASVETKKGSYPADL
    VIQAAGVQPNTEWLKGVVDLTDRGFINVDGYLRTNVPDVFAIGDAILPLSIPAGKPSPIALATTARREAQYVVNHIFEKK
    PTQIFKGVVGSSALHVFDEHFASTGVNEFTAERSNVEIVNSHYVDHIRPAYVPKAEGNVRVDVDITFDPHTHIVLGGAVL
    STADMTAQGNVLALAVEHRLTVEDLAEADFFFQPGYDRQWSLINLAAQHALGYARF

    >gi|116493369|ref|YP_805104.1| NAD(FAD)-dependent dehydrogenase [Pediococcus pentosaceus ATCC 25745]
    MKVAIIGCTHAGTAAVREILRQNPDTEVDIYERNNNISFLSCGIALYLNGRVKRLEDMMYDDAEDLRSEKIRVNLRHDVL
    KIDRNQKEILVQNMEDYSIRREHYDKLVMCTGSAVTLPPIKGINHKRVML
    CKNYEQAQTLHQVLKPHQRVALIGGGYVNA
    ELAESLSDLGCQVTLYHSHDVILNNYVDVQLSKMLVEILEDHGVKVKLNSKVASFTDQKDSLLVTTIHDQNEEVDVAIVS
    KGFIPVTNLLEGQVKMSRNGAILTNEYGQTSDPDIYAAGDARTVHYNPTDTDSYIPLATNAIRQGKLVGINIFGNRWPEI
    GSQGTSGLQLFGYTLATTGLTYQRALDAGLKVKYISYEDNYRPEFMPTTEKINSIIVYEQDSLKVLGAQFFSEHNVSQLA
    NTMSLAIQNQNTLKDLAFVDMLFQPYYDRPFNFINLVAQAGLQQEGLI

    >gi|116493446|ref|YP_805181.1| methylated DNA-protein cysteine methyltransferase [Pediococcus pentosaceus ATCC 25745]
    MKLYYSKFQVKDATYYVASTKKGLGFVGSPNQTLNEVNQFYQAIELIGDEKSNIEAVRQIKEYLENRRQEFNLAIDLSNG
    TQFQQKIWKTLTKITYGRGVNYTELEELAETPKAIRAVASAVARNPILLVIP
    CHRVIRKDGKIGNYRAGVELKEKLLKME
    GFLKD

    >gi|116493498|ref|YP_805233.1| dihydrolipoamide dehydrogenase [Pediococcus pentosaceus ATCC 25745]
    MVVGTQAINVDTLIIGSGPGGYVAAIRAAELGQKVVIVERDYIGGVCLNVGCIPSKALIQAGHLYSTLQHGNPFGVSVSE
    SKIDFTKTQEWKQNQVVNKLTGGVELLLKKHKVAIVRGEAYFNDNETVNVINGDDSHVYRFKRALIATGSRPVEIPHFKF
    SGRVIDSTGALNLKDVPEHLIIIGGGVIGAELAGAYMNLGSKITIIEGLDHILNGFDGELIQPVLNNFKKNGVEIVTEAT
    AVEANQTDKDVTVTYEADGTTKTVNGDYCLVSVGRRPNTDQLGLNNTNIKLSKRGLIEVNDSMQTSVKHIYAIGDVVAGP
    ALAHKASFEAKVAAAAMGGEDAHDTHYVLPAVAYTNIELATVGETPQSIAEKKLDAKSSKFPFAASGRAMTMDQTEGFIR
    LITDNPTGGIIGAQIVGPEASNLISELTLAIENGLTIKDIELTIHPHPTLGEEIMDAAELAAGLPIHV