Pectobacterium wasabiae WPP163

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|261819457|ref|YP_003257563.1| heavy metal translocating P-type ATPase [Pectobacterium wasabiae WPP163]
    MHSHQHHHSTEKSACCNNSVHHAPRSAKSCCNEHTQHSNHADHSCCSTKHTSDATVQTACGTEQHSSDSGGSADSDDPDG
    GDSDRPRSHQRFSWKISGMD
    CPSCARKIENAVKNLTGIEQAKVLFATEKLVVDAYTDIRPQVQHAVQQAGFTLQDTALPI
    APPDTSTVRRFVHEYGFLILFTLLAAASWGLSLLSERSGQIAFIATTLVGLIPILKKTVQLIRTGTPFAIETLMSVASIG
    ALLIGATTEATVILLLFMLGEYLESYAANRARRGVTALMALLPEDATVVGNGQRRLVPVASLVPGDVIEVAPGERLPADA
    DLLNSDASFDESALTGESVPIERTPGEKIAAGSLCVDRVVQLRVVSQPGNSAIDRILQLIEEAEERRAPIERFLDKFSHY
    YTPAIMLLSLLVILVPPLLLAQPWQEWIYRGLTLLLIGCPCALVISTPAAITSGLAAATRRGALIKGGAALESLGSIKTI
    AFDKTGTLTEGKPQVTDVLPAAGISETALLTRTAAVESGSHHPLAKAIVQHALSSSTFLPLAENRKALAGVGVEGTIGSK
    RIQVSAPSRIATNLLDADWLQRVDMLESEGKTVVVVQEDDRLLGLLALSDTLRHDAREALDALQQLGVRGVMLTGDNPRA
    AAAIAATLGIDYRASLLPADKVTAVSELSQQHPVAMVGDGINDAPAMKAATIGIAMGSGTDVALETADAALTHSRLTGLA
    AMISLSRATQRNIRQNITIALGLKAVFLVTSILGITGLWLAVLADSGATALVTANALRLLRKQD

    >gi|261819550|ref|YP_003257656.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Pectobacterium wasabiae WPP163]
    MTLEHQFDYDAIVIGSGPGGEGAAMGLAKHGAKIAVIERHYNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRI
    IRSSFSDILRHADSVIGQQTRMRQGFYERNQCELFSGEASFIDAHTIAVHYPDNTHETLTAAHIIIATGSRPYHPAEVDF
    NHPRIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNE
    EFESIEGLSDGVIVNLKSGKKMKADCLLYANGRTGNTETLGLENIGLSTDSRGQLKVNSMYQTALAHIYAIGDVIGYPSL
    ASAAYDQGRLAAQAIIKGDASAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|261819574|ref|YP_003257680.1| UBA/THIF-type NAD/FAD binding protein [Pectobacterium wasabiae WPP163]
    MVTHHHPTPAGLSDSEFMRYSRQLMLEDIGPEGQEKLKAARVLLVGLGGLGSPASLYLAAAGVGTLLLADDDSLHISNLQ
    RQILYRTSDTDKPKAVLAQRQLQALNPYSEAIALTERLSGDALHHAVSRVDLVLDCSDNMTTRHAVNAACVGAGKPLISG
    SAVGFSGQLAVFMPPYQSGCYACLYPDTAEPQRN
    CRTAGVLGPIVGVIGTLQALEAIKLLAGMPSALDGKLRMFNGKQQS
    WNTLQLTRSPHCPVCGGVA

    >gi|261819925|ref|YP_003258031.1| UBA/THIF-type NAD/FAD binding protein [Pectobacterium wasabiae WPP163]
    MEQKYLLGKYTRVLLRPNDAIFGAGSKQHIITDRTYWENLVLAASQWTEKKTVAEAYEHVAERMSKEVFDRAFDFLISNY
    FLMPAETSDNIFLNRYSRNHLHYQSYGVDPEVIQNRLSEKKVLILGCGGVGNHVSTIMATSGVGEIILVDNDEVEMTNLT
    RQILFTEGDIGCPKTSVLMRELKKRNSSTVISEIQMTIGAKSDISRLPKADIWIISADEPYYLVPWLNEWCVKNGQAYIN
    AGYVNDIAVFGPLYIPGETGCYACHSTVGDLPETKDKRIEEA
    CRAINNNFKVATFPPVNALTSALCANDVLKFLGGYGQP
    LSVNRRVGIWSDRLFIEERPLTKNAKCIVCGELS

    >gi|261820043|ref|YP_003258149.1| cytochrome c biogenesis protein transmembrane region [Pectobacterium wasabiae WPP163]
    MAQRIFTLIFLLWTAVGTPNVAASSFGQKLFGNSTTSRFLPVDGAFAFEFQQQGNQLNLRWDIHPDYYLYRAQIKIEGND
    ATLGKVELPQGESHNDEFFGQVFILRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETRIVPLSQVLATTSSDAPL
    NPLSDKARPLDQTVPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIASLVLGRKEQLTPRRTLLLSMTYVQGMALTYT
    LLGLVVAAAGLRFQAALQHPAILIGLSVMFAALALSMFGLYTLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICS
    PCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILALPVFLLERILG
    ETWGMRLWSALGIAFFGWALMLTLRSSKGWIRGVQLLLLAGVVISAKPLQDWIFPPAGVAQAHTSALNFAPVANIADLNS
    ALAKSAQPVMLDLYADW
    CVACKEFEKYTFSDPAVQNHLSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDAQGKEI
    PGARVTGFMNAEQFQAHLRKFSP

    >gi|261820182|ref|YP_003258288.1| Disulphide bond isomerase, DsbC/G-like protein [Pectobacterium wasabiae WPP163]
    MKKGLLLLSLLVATATNFAHADDTAIQQTLTRLDMQGAEILPSPMAGMKTVITESGVLYISEDGKHLLQGPLYDVSGTMP
    VNTTNKILIGKMDALQEQMIVYKAAQEKHVITVFTDIT
    CGYCHKLHEQMKDYNALGITVRYLAFPRQGMKSQAAKDMQSI
    WCVADRNKAFDNAMKSEAISPATCKTDIAAHYQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG

    >gi|261820345|ref|YP_003258451.1| transcriptional regulator, AraC family [Pectobacterium wasabiae WPP163]
    MRNDTMLNDTPFQDADSRWQAVVTRNKAADGCFIYAVKTTGIYCSPSCASRQPRRENVVFFATADEAQAEGFRPCKRCRQ
    GMLSRQEQQTQQIARACRMIEQSDRPPTLAMLAQAVGISAFHFHRVFKTTTGLTPKQYASAHRHRQLREQLVDNDEVTAA
    IVAVGYDASGRFYAEAGTHLGMTPTAFQHKGKGMTIHFAVGCCSLGEILVAESEKGICAILLGDEPEPLLNSLQEMFANA
    HLVGGDAAFEQRMAQVVGFVDDPTIGLTLPLDIRGTAFQQRVWQALRAIPTGETLSYSEVAHWIGTPAAVRAVAGACAAN
    RLAVVIP
    CHRVVRHDGTLSGYRWGIERKRALLKREQGKE

    >gi|261820365|ref|YP_003258471.1| Rhodanese domain protein [Pectobacterium wasabiae WPP163]
    MKTSYANGLVSTKWLAAHRTDPNILIFDCTTRLVPDEKTLYRAEPARADFQAGHIPGAQFIDVQADLSDNTHRYKYMLPT
    PESFSAAMTRFGVRPGVHIVVYSSADPWWATRVWWLLRVFGFDNVSVLDGGLQKWRREHLPLESGKSRYRPAGQFVATLR
    PHLIAEKNDVLDAIGNEHICILSARQPTQFSGAEGNNYGRPGRITGSHNLPAASLFDPTSGTYLPLDRLRDAVATLNLNN
    KKVIAY
    CGHGVAASADVFVLTQLGHPDVALYDASLSEWADADDLPMTVG

    >gi|261820421|ref|YP_003258527.1| glutaredoxin, GrxB family [Pectobacterium wasabiae WPP163]
    MKLFIYEHCPFCVRARMIFGLKDLPVEQSVIMEGDVDTPTRMVGRKVVPILQKEDGSFMPESMDIVHYVDSKQVPLIADQ
    PVDADIEAWCKSVSSAVFNLAVPRFTKADFKELSTPEARHAYLLREEKAFGDLDALIAKTPELIEEVKQKLDALEPRLAN
    ISAIFTTDFILFPILLSLTIVKGVQFGPNVHAYLERVSTASKVALLTDKAL

    >gi|261820463|ref|YP_003258569.1| glutaredoxin-like protein NrdH [Pectobacterium wasabiae WPP163]
    MRITIFTKPDCVQCNATCRALDKQGINYQLVDLTEDEQALQQVRALGYQQVPVVMTANDHWSGFRPDKISTLNAALPLQ

    >gi|261820491|ref|YP_003258597.1| iron-sulfur cluster assembly accessory protein [Pectobacterium wasabiae WPP163]
    MSDDIAALPLQFTDAAASKVKNLIADEENPELKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVALVVDPMSLQYL
    VGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV

    >gi|261820561|ref|YP_003258667.1| iron-sulfur cluster assembly protein IscA [Pectobacterium wasabiae WPP163]
    MSISLSESAAQRVSAFIANRGKGLGLRLGVRTSGCSGMAYVLEFVDDLNDGDTVFEDKGVKVIVDGKSLVYLDGTELDFV
    KEGLNEGFKFNNPNITGECGCGESFNV

    >gi|261820568|ref|YP_003258674.1| Rhodanese domain protein [Pectobacterium wasabiae WPP163]
    MSASSSDLPVSHERFVCADWLASHLNDGNITLIDARMLPPGNTHRDIHAEYRDGHLPGAVFFDIETLSDHSTDLPHMMPT
    RKDFAHAMGELGIDNQQHLVIYDEGNLFSAPRAWWMLHTFGATSLSILSGGLAGWKAQTLPLEQGDVIRKPATFNATLDE
    NAIRSRDDVLSISRDKSEQIVDARPAARFHAEVDEPRPGLHRGHIPGSLNVPWTDLVNNGTLKPNAELATILHKHGVDFT
    RPIVAS
    CGSGVTASVVVLALTQLNVPNVTLYDGSWSDWGSRDDVPIARD

    >gi|261820635|ref|YP_003258741.1| peroxiredoxin, Ohr subfamily [Pectobacterium wasabiae WPP163]
    MSIEKVLYVAHAQATGGRDGRAVSSDNAVDIKLTTPRELGGAGGEGTNPEQLFAAGYSACFLGAMKFVGAREKIAVPADT
    TVNGSVGIGAIPTGFGIEVELKISLPGLERAVAEDLVQKAHIV
    CPYSNATRGNIDVTLTIV

    >gi|261820799|ref|YP_003258905.1| NADH-quinone oxidoreductase, chain I [Pectobacterium wasabiae WPP163]
    MTLKELVVGFGTQIRSICMVGSNAFKKRETRMYPEEPVNPPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKA
    ETKDGRWYPEFFRVNFSRCIFCGFCEEACPTTAIQLTPDFEMGDYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDG
    KDKGEAENEAKPIDVKGLLP

    >gi|261820914|ref|YP_003259020.1| hypothetical protein Pecwa_1623 [Pectobacterium wasabiae WPP163]
    MTTIFQIKTLRRLAWPTTIVILTILILLIWRLYAPLPQGPSHPISGHVNSPPAPSVSHWHQGAANARFTLILYADLECPY
    CKDYYPELAHWVAQQHDIRLQWHHLILSSHEPAASHLASMAECAGKSGGHDAYWQMITWIYQHTRGNGEGLPPNTTPPGL
    NQVMRSCMDSEWPHHLIRRQVEQAHQEGVQATPSLRLIDQQTNRAMLLTGPVQGDALLSALDLLSAPQASDEEPKLPPDI
    IDHTPR

    >gi|261821076|ref|YP_003259182.1| Redoxin domain protein [Pectobacterium wasabiae WPP163]
    MKWRNGITALCLLGAVALSGCKEEQVSVGAQAPALAAYDLAGQQVELSRWQGKSVYLNFWSSGCGGCMIEMGALEKLSKE
    YGDKVVVVAVNTDPDGVDITSMLAHHGVTYPVVRDQLGITKERYQVSGTPTSFIIDANGKVTDQHQGARDEAQLTALFQK
    LASRT

    >gi|261821113|ref|YP_003259219.1| Thioredoxin domain protein [Pectobacterium wasabiae WPP163]
    MGHPSVYPTGTTIYNPEKAWGGYTVFQALERGAVLVDMNGTELRLWEGLHGFPNKILPGGYILGHSGERDSRYGMQDMVD
    LIQVDWDGNVVWKFNGYEHITDPDLPPEWMARVHHDYQRSGNPVGYYAPGQEPQSIGGNTLLLAHTNLHNERISDKLLLD
    DTIIEVDWQGNILWEWRCSDHFDELGFDDDAKTALYNNPNLRKSGGGMGDWMHINSMSALGPNPWFDQGDTRFHPDNIIW
    DARESNIIAIIDKQSGNIVWQLGPNYNTPELKHIGWIIGQHHAHMIPAGLPGTGNILVFDNGGWAGYGAPNPASPDGVKN
    AWRDHSRVLEINPVTLDIVWRYSPYEAGIPHPTDAFRFYSPYISNIQRLPNGNTLINEGANGRLFEVTVDHEIVWEFISP
    YWGKTVNTNMLYRAYRVPYEWVPQLPRPQETRVIAPDNTQLRQPGAAAPGFASIVRIDGTRPYKKSGEALCVATDSEDLK
    RSPKLFAVNRERFAPLTADGWPELAAQAGPRLLLVGAER
    CVHCKSLYRQLETILDNEEYRQLSSHYLDADHHITLAEKLA
    VRTLPTLLWLENGEERARLSGAQQPERLRQWLAEQQI

    >gi|261821234|ref|YP_003259340.1| glutaredoxin, GrxA family [Pectobacterium wasabiae WPP163]
    MFAVIFGRPACPYCVRAKELAEKLTEQRDDFSFRYVDIHAEGISKEDLSKTVGKPVETVPQIFLDEKHIGGCTDFEAYAK
    EHLSLFQS

    >gi|261821265|ref|YP_003259371.1| thioredoxin reductase [Pectobacterium wasabiae WPP163]
    MGTVKHHKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDADDLTGPLLMERMHAHATKFNTEV
    IFDHIERVDLQNRPFRLFGDSDEYTCDALIIATGASARYLGLPSEDAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRETFRSEKILIDRLMDKVKNGNIILHTNRTLDEVLGDNMGVTGVRIRDTQSDAAEELELAGVF
    IAIGHSPNTAVFGGQLALENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLTINK


    >gi|261821358|ref|YP_003259464.1| glutaredoxin, GrxB family [Pectobacterium wasabiae WPP163]
    MKLYIYDHCPYCVKARMIFGLKNIPVELQILANDDAATPERLIGQKMVPILQKDDGSYMPESMDIVHFIDNYDRKPLLTG
    STNPAISAWLRKVTEYTPRLIIPRFAQAAFEEFASAPARQYFINKKEAQLGNFADHLSHSQGLIKKLNHDLQDLDPLIAQ
    PNACNGVLSTDDINLFPLLRSLSIVAGVTPPSRVADYRDNMAKQTQVTLLSSLAI

    >gi|261821513|ref|YP_003259619.1| Disulphide bond formation protein DsbB [Pectobacterium wasabiae WPP163]
    MLRFLNRCSRGRGAWLLLAFTALALELTALYFQHVMLLKPCVLCIYQRSALWGVFAAGIVGAMAPSSLLRYPAIALWIYS
    SYEGVRLAWKHTDILLNPSPFNT
    CDFFVSFPSWLPLDKWLPAIFNATGDCSERQWSFLSMEMPQWLLGIFVAYLLISVLV
    LIAQPFRPKRRDLFSR

    >gi|261821533|ref|YP_003259639.1| methionine-R-sulfoxide reductase [Pectobacterium wasabiae WPP163]
    MTNDSASPTSSDNTELTELQRYVTQQRGTEPAFSGKLLHNKRTGAYHCLCCQAPLFYSDSKYDSGCGWPSFDQPVSSEAI
    RYLEDDSHNMRRIEIRCGQCDAHLGHVFPDGPKTTGERY
    CVNSASLSFIDDVDGERVDG

    >gi|261821591|ref|YP_003259697.1| electron transport complex, RnfABCDGE type, E subunit [Pectobacterium wasabiae WPP163]
    MSQTKALFIDGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLTCTNMAVSALRRWVPAEIRIPIYVMIIASVV
    STVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNAVLPSAIDGLAMGLGATSALVVLGSLREILGNGTLFDG
    ADLLLGSWAKVLRIEVVHLDSPFLLAMLPPGAFIGLGLLLAVKYLIDEKMKQRRARVAAAAGKIAPAASAVGESL

    >gi|261821596|ref|YP_003259702.1| electron transport complex, RnfABCDGE type, A subunit [Pectobacterium wasabiae WPP163]
    MTEYALLFVSILLVNNFVLVKFLGLCPFMGVSKKLETAIGMGMATTFVMTVGSMFSWLVNEFILVPLDILYLRTMAFILV
    LAVVVQFSEMFVRKVSPELYRLLGIFLPLITTN
    CAVLGVVLLNINLSHGFLQSTIYGFGGAAGFSLVMVLFAAIRERLAV
    SDIPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|261821667|ref|YP_003259773.1| methylated-DNA/protein-cysteine methyltransferase [Pectobacterium wasabiae WPP163]
    MQIFFQDTMATPLGELLIIADENNHLRAVEWREYEEDLFRSLNRSYRNDPFSLQPRHNPGGLTDSLQRYFDGELAIIDTL
    PVASVGTEFQQQVWRELRKIPCGEITTYGELATLLGRTGAARAVGMANGSNPVSIVVP
    CHRVIGAGGAMTGYAGGVHRKQ
    WLLKHEGYLARQNSLPL

    >gi|261821860|ref|YP_003259966.1| Redoxin domain protein [Pectobacterium wasabiae WPP163]
    MSQNVHFQGNPVPVAGAFPAKGSKAPAFTLVAKDLSDASLSNYAGKRKILNIFPSIDTGVCAASVRKFNQLGSELDNTVV
    LCISSDLPFAQSRFCGAEGLNNVVVLSTLRGSEFKESYGVAIADGALKGLTARAVVVLDENDNVLHSELVNEITTEPDYD
    AALAVLK

    >gi|261821927|ref|YP_003260033.1| glutaredoxin-like protein [Pectobacterium wasabiae WPP163]
    MTTPTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQTVQALSSCGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGE
    LVGGCDIVVEMFQRGELQQLIKETADKYKAQQAEQE

    >gi|261821977|ref|YP_003260083.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Pectobacterium wasabiae WPP163]
    MSRKILLIPLVLFLLLAVALLWQLVRNSGGDDPMRLESALIGKPIPAFRLESLDQPGKVYSQSELSDGKPLLLNVWATWC
    PTCRAEHQFLNTLAAQGIRVVGMNYKDERSKAVEWLKTLGNPYAMSLFDGDGMLGLDLGVYGAPETFLIDGQGIIRYRHA
    GDLNMQVWQETLQPLWDKYSKEGGA

    >gi|261822007|ref|YP_003260113.1| FeS assembly scaffold SufA [Pectobacterium wasabiae WPP163]
    MQAENVGTFSLDENVWQGLTLTDSAVKQIKNLMKQDEAVQGLRLGVKQSGCAGFGYVLDLVQEFETDDLVFERDGAKLYV
    PLKAMPFIDGTELDFVREGLNQIFKFNNPRAQHACGCGESFGI

    >gi|261822020|ref|YP_003260126.1| protein of unknown function UPF0061 [Pectobacterium wasabiae WPP163]
    MQQTPLFKNHYFHQLPGFYTALPPTPLHGARLLYHSEGLAAELGLSSDWFTPAQDNVWGGERLLSGMEPLAQVYSGHQFG
    MWAGQLGDGRGILLGEQQLADGRSVDWHLKGAGLTPYSRMGDGRAVLRSVIREFLASEAMHYLGIPTTRALTIVTSTHLV
    QREQEEKGAMLLRVAESHVRFGHFEHFYYRREPEKVRQLVEYVIARHWPQWENDERRYELWFGDVVERTARLITHWQAVG
    FSHGVMNTDNMSILGLTIDYGPYGFLDAYQPDFICNHSDHRGRYAFDNQPAVGLWNLHRLAQALSGLMDTDTLERALARY
    EPALMQHYGTLMRAKLGLFTASPDDNDVLAGLLRLMQKEGSDYTRTFRLLADSEKQASRASLRDEFIDRAAFDNWFAAYR
    QRLMQEDQGDEERRRLMNATNPKYILRNYLAQMAIERAENDDISVLARLHQALCRPFDEQSDNNDLAALPPDWGKHLEIS
    CSS

    >gi|261822028|ref|YP_003260134.1| Peroxiredoxin [Pectobacterium wasabiae WPP163]
    MSTEIYAIPLTTIDGKATTFEAFKGQVALVVNVASQCGLTKQYDALEKLYETYRDQGLVVLGFPSNEFAGQEPGSEAEIQ
    EFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIRQQPEANGTWKSDFFARLVNKGRKPKDPEDILWNFEKFLVDRDGRVIE
    RFAPDMSPDHDTIVKAIEAALAK

    >gi|261822078|ref|YP_003260184.1| Rhodanese domain protein [Pectobacterium wasabiae WPP163]
    MPVLHNRVSNEELKARMLAENEPRTTVSFYKYFTIDDPKAFRDRLYIQLEQHNVFGRIYIATEGINAQISVPNSQFEAFK
    ATLFSTHPALDQIRLNIALEDDGKSFWVLRMKVRERIVADGIDDPTFNPANVGQYLKADQVNAMADDPDTVFVDMRNHYE
    YEVGHFENALEVPSDTFREQLPMAVDMLDGARDKNIVMY
    CTGGIRCEKASAYMLHHGFKNVYHVEGGIIEYARQAKAKGL
    PLKFIGKNFVFDERMGERISDDVIAHCHQCGTSCDSHTNCRNEGCHLLFIQCPNCAAKYGGCCSSQCQDEMKLPLEEQRA
    IRSGRENGMKIFNKSKGLLQSTLHIPAPVAKDKPE

    >gi|261822123|ref|YP_003260229.1| Rhodanese domain protein [Pectobacterium wasabiae WPP163]
    MSTPLAISPVQASKLLDEGAILIDIRQPEEYAREHIAPARLHPLAPAAGYVLPKEDREGKIIIFHCLSGMRSAQNAEILM
    QSAFPATAFLLDGGMTAWKKAGFPTEINNKQPIDVMRQVQIAAGVLILSGVLLGYSVNSAFFLLSGFVGAGLLFAGVTGF
    CGMARLLMRMPWNRGAKR

    >gi|261822224|ref|YP_003260330.1| molybdopterin synthase sulfurylase MoeB [Pectobacterium wasabiae WPP163]
    MLPELSDDEMLRYNRQIVLRGFDFDGQEKLKASRLLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVSLSNLQRQVLHRD
    TRIGMAKVESARLTLSEMNPHLSLDTVDGNLDDEALKEQVSKHDAVLDCTDNVDIRNRLNRIGFQLKKPLISGAAIRMEG
    QISVFTYQPDEPCYHCLSRLFGANALT
    CVEAGVMSPLVGTIGSLQAMEAIKCLTGYGKLVTGRLLMFDAMTLQFREITLP
    KNPRCEVCGG

    >gi|261822404|ref|YP_003260510.1| arsenate reductase [Pectobacterium wasabiae WPP163]
    MALTMYGIKNCDTIKKARRWLEDQQVAYHFHDYRADGLDAQQLQRFIDQLGFQALLNTRGTTWRKLSEEQREQINSDTSD
    SAEAAKNLMLEQPAVIKRPLLITDDGNALLGFSIDSYQKFIAENK

    >gi|261822424|ref|YP_003260530.1| Peroxiredoxin [Pectobacterium wasabiae WPP163]
    MNTLKAGDIAPKFSLPDQDGEQVNLTDFQGQKVLVYFYPKAMTPGCTVQACGLRDNMDDLKKHGVEVLGISTDKSEKLSR
    FAEKEVLNFTLLSDEDHQVSEGFGVWGEKTFMGKTYDGIHRISFLIDENGKVEKVFDDFKTSNHHDIVLDYLKSA

    >gi|261822426|ref|YP_003260532.1| arsenate reductase [Pectobacterium wasabiae WPP163]
    MTLLSTKASVTIYHNPRCSKSRETLALLQEHKIAPDVVLYLDTPPDAATLAQLIQQLGFSSARELMRTNEESYQQLGLSD
    AALTEAQLIQAMIDNPKLIERPIVVAQGQARIGRPPEQVLEILSL

    >gi|261822438|ref|YP_003260544.1| Thioredoxin domain protein [Pectobacterium wasabiae WPP163]
    MLEQQATIVDVNESNLHQVLEQSATLPVLFYFWSGRSQHCLELEPVLDKLAQEYAGQFVLAKVDCDAEQRVAAQFGLRSI
    PTVYLFKDGQPLDGFQGPQPEEAVRELLKRALPKEEELKVAQAQQLIQEDKLPEAMQLLKDAWQLSQQRSDIGLMLAEVQ
    IQIKRSEDAEAVLATIPLQDQDTRYHSLVAQIELLKQAADTPEIQHLQQQLDADPKNADLAVQLSLQLHQVGRNEEALEL
    LMGFLKKDLAVANGNARKTLMDIMAALGTGDALAARYRRQLYSLLY

    >gi|261822463|ref|YP_003260569.1| copper-translocating P-type ATPase [Pectobacterium wasabiae WPP163]
    MSQTIVLSLQGLTCGHCVQRVKKALDAIPTVEHTDVTQQYAKVSGAVDSQTLIDTIERAGYDAQLATTPDVSLQLSGLSC
    NHCVAATRKVLEAIPGVVATDVTKEQATVYGNVETTVLISAIEEAGYHASVQENVHPKTEPLAQVATMPEALPAAESILP
    AITTRTTRDDDSVQILLQGMS
    CASCVNRVQTALQNVSGVTQARVNLAERSALVNGHAEPEALIAAVEQAGYGAEIIQDEE
    ARRARQQQTSQQAIRRFQWQAALGLLLGIPLMLWGVLGGSMSLTPESQTPWLVIGILTLAVMVFAGSHFYRNAWRSLRNG
    AATMDTLVALGTGAAWLYSITVNLWPDLFPMAARHLYYEASAMIIGLINLGHALEQRARQRSSRALERLLDLTPPTARVV
    TPEGEKSIPLSEVQSGMTLRLTTGDRIPVDGEILQGELWVDEAMLTGEPIPQSKTSGDTVHAGTLVSDGSVLFRADAIGN
    QTTLSRIIRLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWFFVGPQPQIVYTLIIVTTVLIIACPCALGLATP
    MSIISGVGRAAEFGVLVRDADALQQASKLDVLVFDKTGTLTEGKPRVVAIHTFGSVTEEQALTWAASLEQGSHHPLAKAI
    IEHAENLTLTQVDQFRTLRGLGVSGKTMDVDLLLGNPPLLKQHQIDLAEGDTLINEQAQRGITPVLLAANGHLIAVISIH
    DPLRADSISALQRLHQQGYQLVMLTGDNPLTAKSIAKEAGIDQVIAGVLPDGKAEAIKKLQAQGKRVAMIGDGINDAPAL
    AQADVGIAMGGGSDIAIETAAITLMRHSLHGVADALLLSNATLRNMKQNLLGAFIYNSLGIPIAAGVLYPLTGTLLSPVV
    AGAAMALSSITVVSNANRLLRFKPKGQ

    >gi|261822537|ref|YP_003260643.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pectobacterium wasabiae WPP163]
    MVLVTRQAPDFTAAAVLGSGEIVENFNLKKHINGKAAVIFFWPMDFTFVCPSELIAFDHRYAEFKKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVQYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRTVDA
    LQFHEEHGEVCPAQWEKGKSGMGASPDGVAKYLSENADKL

    >gi|261822728|ref|YP_003260834.1| thioredoxin [Pectobacterium wasabiae WPP163]
    MNTVCGSCQTTNRLPEARIDDHAKCGRCGEALFSGDIINATETTLDKLLQDDLPIVVDFWAPWCGPCVNFAPVFENVAQE
    RSGKIRFIKVNTEAEPALSARFRIRSIPTLMIFKQGQMVDILNGALPKAQFEEWLDESL

    >gi|261822813|ref|YP_003260919.1| peptide methionine sulfoxide reductase [Pectobacterium wasabiae WPP163]
    MSSIDKTQRITQSDALPGRSTPMPVARLHVVNEHSMTHVPDHMSVAIFAMGCFWGAERLFWQQQGIYSTAAGYIGGYTPN
    PTYREVCSGQTDHAEAVRVVFDPAVISYGELLQQFWENHDPAQGMRQGGDIGSQYRSAIYTLTPEQEQAAQESLQRFQQA
    MRENGDSRAISTEIEPAGPFYYAEDDHQQYLHKNPNGYCGLGGIGVCLPPPR

    >gi|261822902|ref|YP_003261008.1| alkylhydroperoxidase like protein, AhpD family [Pectobacterium wasabiae WPP163]
    MSTLRLPYQTLSPEAYQGFGMTKKALNKSSLGKQLIELVYLRVSQINGCAFCLEMHASALRADGVPDTKLDSLAGWRVSA
    QFNERERVALAWTESLVDVAHSHAPDEDFEPLKAHFSDAEIADLSFAVALMSAFNRLAIGMRQ

    >gi|261822988|ref|YP_003261094.1| dihydrolipoamide dehydrogenase [Pectobacterium wasabiae WPP163]
    MSTEIKAQVVVLGAGPAGYSAAFRAADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRLWKEKVITQLTSGLAGMAKGRKVKVVNGLGKFTGANTLEVDGENGKTTISFDNAIIAAGSRPIQLPFIPHNDP
    RVWDSTDALELKNVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|261823158|ref|YP_003261264.1| alkyl hydroperoxide reductase, F subunit [Pectobacterium wasabiae WPP163]
    MLDNTMKVQLKAYLEKLTKPVELMATLDDSAKSAEVRTLLTDIAELSDQVNFIEKNDLSVRKPSFLITNPGSQSGPRFAG
    APMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLNGSFHFETYYSLS
    CHNCPDVVQALNLMAVLNPKITHTAIDGGVFQ
    DEIQNRNVMGVPTIFLNGEHFSQGRTSLAEIVAKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
    VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPGKPHQVITVSGATLKARSVII
    ATGARWRNMNVPGEDQYRTRGVTY
    CPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQEKV
    RSLPNVDIILNAQTTEVKGDGQKVTGLSYKDRVTDTVQDLPLEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
    KGIFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA

    >gi|261823159|ref|YP_003261265.1| peroxiredoxin [Pectobacterium wasabiae WPP163]
    MSVINTQVKPFKNMAFKDGQFIEVTEKNIEGKWSVFFFYPADFTFVCPTELGDVADYYDEFQQRGVEIYSVSTDTHFTHK
    AWHSSSETIGKIKYTMIGDPTGQLTRNFENMREAEGLADRGTFIVDPQGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|261823357|ref|YP_003261463.1| Thiosulfate sulfurtransferase [Pectobacterium wasabiae WPP163]
    MEQFEAISIEQAYSRWQEGGVVVDIRDPQSFAVAHVPGATHLTNESLSDFVRDADFDAPVMVICYHGISSRNAAQYLISL
    GFDSVYSIDGGFEAWQHRYPQDVLPPV

    >gi|261823429|ref|YP_003261535.1| thioredoxin [Pectobacterium wasabiae WPP163]
    MSDKIIHLTDDSFDTKVLQADGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLTANL

    >gi|261823557|ref|YP_003261663.1| Rhodanese domain protein [Pectobacterium wasabiae WPP163]
    MQEIMPFVSKNPILSIAWVALLVAVIVLTVKSKLSNVKDVVRGEAIRLINKEDAVIVDIRNRDDYRRGHIASAFNLLPND
    IKNGSVGELEKHKSQPIIVV
    CANGLSSREAAENLHKAGFERVQVLKDGLAGWTGENLPLVRGK

    >gi|261823618|ref|YP_003261724.1| Rhodanese domain protein [Pectobacterium wasabiae WPP163]
    MSYVTDYPFAASDIALSHFARRLSVETDCADVAASLSDTQQDFVLLHVVGSTKHFTARHIPGAIHLPHREITPERMAAWP
    GDTRFVVYCAGPH
    CNGADQAALKLAQLGRPVKMMIGGMTGWEDEGFAFA

    >gi|261823654|ref|YP_003261760.1| uncharacterized peroxidase-related enzyme [Pectobacterium wasabiae WPP163]
    MTHANTSHTHDVLDALADISPDSTLAAARKTREAATRHTQGSYDALFNAAAHDNATLPLSLRFWFATKISGWQQDEQLQH
    FYAERLADFPEPTLTPALQLALDHAERLTKTPVQAAPSHVNMLEQAGWSVDDIVTLSQLIAFVNFQSRLLRGYRLIAGHR
    VSQPHSQAAVAGQWNIQQQTYSGKSAPQTFTQAELSWEPWIASKPLATFNADEQAILARFGHTDSDYFRLLGRNLPVLEQ
    RTLTDKGIFYTSGGLPRKERELIAAVTSKVNGCIY
    CASVHARKASQLSKQDSDVQRLLDVVPGGDLGIGQSPRWQAIIDF
    SARLSATPAQVNANDLKQLQGQGLDTLEIVDVVQSAAFFSWANRLMLTLGEPFWPEH

    >gi|261823664|ref|YP_003261770.1| glutathione-disulfide reductase [Pectobacterium wasabiae WPP163]
    MTKHYDYLAIGGGSGGIASINRAAMHGQKCALIEAKYLGGTCVNVGCVPKKVMWHAAQIAEAIHQYGPDYGFDTTVNQFN
    WGTLVKNRSAYIDRIHQSYDNVLGKNKVDVIHGFARFVDAHTVEVNGEKITADHILIATGGRPVHPDIPGAEYGIDSDGF
    FELDALPKRTAIVGAGYIAVEIAGVLNGLGSETHLFVRKHAPLRSFDPLIVDTLVEVMNTEGPTLHTESIPKAIVKNADG
    SLTLELENGQSQTVDCLIWAIGREPATDNLNLSVTGVGLNDKGYINVDKFQNTNVSGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDEQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGKEE
    KIVGIHGIGFGMDEMLQGFAVAVKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|261823709|ref|YP_003261815.1| DSBA oxidoreductase [Pectobacterium wasabiae WPP163]
    MKKLWLALIGVVLAFSASAAEFSDGKQYVELDKPAAQEPQVLEFFSFYCPHCYQFEQVYHVPDAVKKALPEGTKMTRYHV
    NFLGTLGKNLTQAWAVAMALGVEDKITPLMFDAVQKTQTVQKPEDIRAVFVEAGVTAEEFDSALNSFVVKSLVAQQEKAA
    ADLQLRGVPAMFVNGKYMIKSDGLDTSSMDAYVKQYADVVKFLITKK

    >gi|261823078|ref|YP_003261184.1| hydroxymethylbutenyl pyrophosphate reductase [Pectobacterium wasabiae WPP163]
    MQILLANPRGFCAGVDRAISIVERALELFGTPIYVRHEVVHNRYVVNGLRERGAIFIEQIEDVPDGAILIFSAHGVSQAV
    RNEAKNRDLTVFDAT
    CPLVTKVHMEVARASKKGVEAILIGHAGHPEVEGTMGQYSSEDGGMYLVESPEDVWQLQVKDESN
    LCFMTQTTLSVDDTYAVIDALRERFPQIVGPRKDDICYATTNRQEAVRHLSDKADVVFVVGSKNSSNSNRLAELAQRAGK
    AAYLIDAAEDIQESWVTGVAQVGVTAGASAPDILVQQVIQRLKELGGKVAVEMQGREENIVFEVPKELRVEVKQID