Pectobacterium carotovorum PC1 uid59295

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|253686501|ref|YP_003015691.1| heavy metal translocating P-type ATPase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MHSHQHHSAEKSACCNNGVHHAPRSTAHSTKSCCNEHAQHSNHADHSCCSTKHTSDAAVQSACGTEQHSSDSGGSADSDD
    PDGGDSDRPRSNQRFSWKISGMD
    CPSCARKIENAVKNLTGIEQAKVLFATEKLVVDAYIDIRPQVQHAVQQAGFTLQDTA
    LPVVPPNTSTVRRFVHEYGFLLLFTLLAAASWGLSLLSERGGQIAFIATTIVGLIPILKKAIQLIRTGTPFAIETLMSVA
    SIGALLIGATTEATVILLLFMLGEYLESYAANRARRGVTALMALLPEDATAIVNGQRRLVPVASLVPGDVIEVAPGGRLP
    ADAELLNSDASFDESALTGESVPVERTPGEKIAAGSLCVDRVVQLRVVSQPGNSAIDRILQLIEEAEERRAPIERFLDKF
    SRYYTPAIMLLSLLVILVPPLLLAQPWQEWIYRGLTLLLIGCPCALVISTPAAITSGLAAATRRGALIKGGAALESLGSI
    KTIAFDKTGTLTEGKPQVTDVLPAAGISETALLTRTAAVESGSHHPLAKAIVQHALSSSTFLPLAENRKALAGVGVEGTI
    GGKRIQVSAPTRVASDLLDADWLQQIDALENEGKTVVVVQEDDRLLGLLALSDTLRHDAREALDALQQLGIRGVMLTGDN
    PRAAAAIAARLGIDYRASLLPADKVTAVSDLSKQHPVAMVGDGINDAPAMKAATIGIAMGSGTDVALETADAALTHSRLT
    GLAAMISLSRATQRNIRQNITIALGLKAVFLVTSILGITGLWLAVLADSGATALVTANALRLLRKQD

    >gi|253686581|ref|YP_003015771.1| periplasmic binding protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKITLLSGLLALTSCWAHASDFPVTVDSCGQPLTFTQPPQRAVIHDLNMTEMAFALGLQKSIVGLTGITGWYKAPPDFIK
    QQGTIPELAAKYPTLENLLAVHPDFFFAGWNYGMKVGGEVTPQALKKYGIQTLVLSES
    CVFTEPQQQRPRASMDLLYGDM
    LKLGKIFGKQELAQKQIDDWKQHIATLQTRIGDRPKQTVFLYDSGDDKPFTSGKFAMPTAIIEAAGGKNVMDDMATSWAS
    TSWENVAAREPDFIILLDYQTGNGADALRRFLESHPLMKFTPAVQQHRYLKLQYAELTPGPANIAAVDKLAHALYPDAFK


    >gi|253686594|ref|YP_003015784.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTLEHQFDYDAIVIGSGPGGEGAAMGLAKHGAKIAVIERHYNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRI
    IRSSFSDILRHADSVIGQQTRMRQGFYERNQCELFSGEASFIDAHTIAVHYPDNTHETLTAANIIIATGSRPYHPAEVDF
    NHPRIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNE
    EFESIEGLSDGVIVNLKSGKKMKADCLLYANGRTGNTETLGLENIGLSTDSRGQLKVNSMYQTALAHIYAIGDVIGYPSL
    ASAAYDQGRLAAQAIIKGDASAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|253686620|ref|YP_003015810.1| UBA/THIF-type NAD/FAD binding protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MATHHHSTPAGLSDSEFMRYSRQLMLEDIGPEGQDKLKAASVLLVGLGGLGAPASLYLAAAGIGTLLLADDDALHISNLQ
    RQILYRTSDTDKPKAVLAQRQLQALNPHSEAIALTERLSGETLDNAVSRVDLVLDCSDNMATRHAVNAACFRAGKPLISG
    SAVGFSGQLAVFTPPYHSGCYACLYPDTTEPQRN
    CRTAGMLGPVVGVIGTLQALEAIKLLAGMPSALDGKLRMFNGKQQS
    WNTLQLTRAPHCSVCGGAA

    >gi|253686640|ref|YP_003015830.1| methylated-DNA/protein-cysteine methyltransferase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKVLDNDQCDVWYQALLERDSGYTGVFFVGVITTGVFCISVCRARKPKRENVEFYKDVKSALDAGFRPCKVCRPTENAHS
    APLLIEQALELVRANPKTRISDTELRKHDISPERVRRWFLQNHGITFQAFQRMQRVNVALQELKGGRNATEVAFDSGYES
    LSGFGYTYKRLTGVSPTEQSQVIMIHRFTTPLGPMFVCATERGVCLLEFTDRRMLETEFRDLQRLLNARIMSGENIHTRQ
    TEKEISEYFSGTRQQFTLLLDTPGSDFQRTVWQELRAVPYGHTSHYQALSGLIGKPNAVRAVAAANGANRVAIVIP
    CHRI
    IGKDGTMTGYGGGIARKKWLIEHEKTMLNHPTES

    >gi|253686904|ref|YP_003016094.1| cytochrome c biogenesis protein transmembrane region [Pectobacterium carotovorum subsp. carotovorum PC1]
    MAQRIFTLIFLLWTAFGTPNVAASSFGQKLFGNSTTSRFLPVDSAFAFEFQQQNNQLNLRWDIHPDYYLYRAQIKIEGNG
    ATLGKIELPPGESHNDEFFGQVFILRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETRVVPLSQVLASTGTDAAP
    NTPSGKATPSDQTAPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIASLVLGRKEQLTPRRTLLLSMTYVQGMALTYT
    LLGLVVAAAGLRFQAALQHPYILIGLSVMFVALALSMFGLYTLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICS
    PCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILALPVFLLERILG
    EVWGMRLWSALGIAFFGWALMLTLRSGKGWMRGVQLLLLAGVVISAKPLQDWVFPPAGVAQSHTSALNFAPVANIADLNS
    ALAKSAQPVMLDLYADW
    CVACKEFEKYTFSDPAVQDHLSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDAQGKEI
    PGSRVTGFMNAEQFQAHLQKFSP

    >gi|253687047|ref|YP_003016237.1| thiol:disulfide interchange protein DsbC [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKKGLLLLSLLVATATNFAHADDAAIKQTLTRLDMQGAEILPSPMAGMKTVITDSGVLYISEDGKHLLQGPLYDVSGTMP
    VNTTNKILIGKMDALQEQMIVYKAAQEKHVITVFTDIT
    CGYCHKLHEQMKDYNALGITVRYLAFPRQGMKSPAAKDMQSI
    WCVADRNKAFDSAMKGDAISPATCKTDIAAHYQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG

    >gi|253687183|ref|YP_003016373.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKDIVIIGAGFAARQLIRQLRKLDAHCPIRLITADSGDEYNKPDLSHVMSLQQHADDLTKMQATAFAEENRITLLANTRV
    TAIDRHTQQVVCGTERYDYHKLVFATGASAMVPPIRGCEHMLTLNSQQEYRTHESRLWQAERILVLGAGLIGTELAMDLG
    RAGKQVTLVDCASSILPALMPPEVSARLQFTLTQQGVSLHLNTTLQQLEKIETGVRATFTDGRTIDVDDVLSAIGLQPNT
    QLAEAAGLAVQKGIQTNAQLQTSDPQIYALGDCAEIGGKLLPFLQPIQLSAMTLAKNLLGASEALALPPMLVKIKTPLFP
    LQMAGDTTSGDLHWQQEWNEQGMVAKALDSQQVLRAFVVGGERMKEAFPLLRQLSTVTSTTA

    >gi|253687193|ref|YP_003016383.1| transcriptional regulator, AraC family [Pectobacterium carotovorum subsp. carotovorum PC1]
    MRNDMMLGDTPFQDADSRWQAVVTRNSAADGCFIYAVKTTGIYCAPSCASRQPRRENVVFFATADEAQAAGFRPCKRCRQ
    GTLSRQEQQAQQIAHACRIIEQSEYPPTLAVLAQAVGISAFHFHRVFKNLTGLTPKQYASGHRHRQLREQLVEKSAVTAA
    ITAAGYDASGRFYAESGAHLGMTPTAFQNKGKGMTIRFAIGRCSLGEVLVAESEKGICAILLGDDPESLLNSLQEMFTHA
    QLIGGDAAFEQRVAQVVGFVDDPAIGLTLPLDIRGTAFQQRVWQALRAIPAGETLSYREVAERIGAPAAVRAVAGACAAN
    RLAVAIP
    CHRVVRQDGALSGYRWGVVRKRALLEKEQLDKERVEKEQGTHPQGEPLS

    >gi|253687410|ref|YP_003016600.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pectobacterium carotovorum subsp. carotovorum PC1]
    MVLVTRQAPDFTAAAVLGSGEIVENFNLKKHINGKAAVIFFWPMDFTFVCPSELIAFDHRYAEFKKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVQYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRTVDA
    LQFHEEHGEVCPAQWEKGKSGMGASPDGVAKYLSENADKL

    >gi|253687491|ref|YP_003016681.1| copper-translocating P-type ATPase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSQTIVLSLQGLTCGHCVQRVKKALDALPAVEQTTVTQQYASVSGDVDSQTLIDTIEQAGYEAQPATTPDVSLQLSGLSC
    NHCVAATRKVLEVIPGVVATDVTTEQAAVYGNVEATVLISAIEEAGYHASVQESAHPKTEPLAQVATTPEALPAAENTLP
    VTTTLATNDDDSVQLLLQGMS
    CASCVSRVQTALQSVSGVTQARVNLAERSALVSGHAEPEALIAAVEQAGYGAEIIQDEE
    ARRARQQQTSQQAIRRFQWQAALGLLLGVPLMLWGVLGGSMSLTPENQTPWLIIGILTLAVMVLAGSHFYRNAWRSLKNG
    AATMDTLVALGTGAAWLYSITVNLWPELFPMAARHLYYEASAMIIGLINLGHALEQRARQRSSRALERLLDLTPPTARVV
    TAEGEKSIPLSDVQSGMTLRLTTGDRIPVDGEILQGEMWVDEAMLTGEPIPQSKTTGDNVHAGTLVSDGSVLFRADAIGN
    QTTLSRIIRLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWFFVGPQPQIVYTLIIVTTVLIIACPCALGLATP
    MSIISGVGRAAEFGVLVRDADALQQASKLDVLVFDKTGTLTEGQPRVVAVHTFGDVTETQALAWAASLEQGSNHPLAKAI
    LERAENLPLTPAEQFRTLRGLGVSGKIGDTNLLLGNPALLKQHQVDITEGEALINEQAQRGITPVLLAANGHIIAVLSIH
    DPLRADSVSALQRLHRQGYQLVMLTGDNPLTAKSIATEAGIDQVIAGVLPDGKADAIKKLQAQGKRVAMIGDGINDAPAL
    AQADVGIAMGGGSDIAIETAAITLMRHSLHGVADALALSNATLRNMKQNLLGAFIYNSLGIPIAAGVLYPLTGALLSPVV
    AGAAMALSSITVVSNANRLLRFKPKSE

    >gi|253687514|ref|YP_003016704.1| Thioredoxin domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MLEQQATIIDVNESNLRQVLDHSMTLPVLFYFWSARSQHCLELEPVLDRLAQEYAGQFVLAKVDCDAEQRVAAQFGLRSI
    PTVYLVKDAQPMDGFQGPQPEEAIRELLKRALPKEEELKVAQAQLLIQEDKLPEAMQLLKDAWQLSQQRSDIGLMLAEVQ
    IQIKRSEEAEAVLATIPLQDQDTRYHSLVAQIELLKQAADTPEIQHLQQKLDADPQNAELAVQLALQLHQVGRNEEALEL
    LMGFLKKDLAVANGNARKTLMDIMAALGTSDALAARYRRQLYSLLY

    >gi|253687527|ref|YP_003016717.1| arsenate reductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTQSSTQTSVTIYHNPRCSKSRETLALLQEHNVTPDVVLYLDTPPDAATLAQLIQQLGFNSARELMRTKEERYQQLGLSD
    TALTETQLIQAMVDNPKLIERPIVVAHGQARIGRPPEQVLEIL

    >gi|253687529|ref|YP_003016719.1| Peroxiredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MNTLKAGDIAPKFSLPDQDGEQVNLTDFQGQKVLVYFYPKAMTPGCTVQACGLRDNMDDLKKYGVEVLGISTDKSEKLSR
    FVEKEVLNFTLLSDEDHQVSEGFGVWGEKTFMGKTYDGIHRISFLIDENGKVEKVFDDFKTSNHHDIVLDYLKNA

    >gi|253687538|ref|YP_003016728.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSDTIITASDTSLDALLTTSDKPILLDLWAPWCQPCKTLAPLLNTIADNTPDNLTVAKLDVEQYPAFMQRFGVRGIPTLL
    LFKNGQEISRQIGVKTLAQLRGWLESHQIAIQNTVQPLADSRVTWGSFYGDASLHAFLHQRLRQHAADDDIKHAFAPYWQ
    DNKGSVSAVLAHNADIRIFERVTGLPAALGLLLEKLPSTTPEQVDALFTALTPGKAVDGVALQWLHHWLSHEENPWSDWL
    ADKTVDNLRQQWTHAISRLLASEVVAESEWTALHQQAISWEEKASDELGLEKNIATILASLSPPPAASDADSWRSISITL
    GFALAQTLQIKDGWSREERATPDKRFRWFQAQEDATPSKKLTDEQITALREQWLQENPVFSAKEDAFYQRYPQLLEAQKV
    PLQETLWALLHRAPPFKSQLD

    >gi|253687564|ref|YP_003016754.1| arsenate reductase related protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MALTMYGIKNCDTIKKARRWLEDQQVAYRFHDYRADGLDEQLLQRFIDQLGFQALLNTRGTTWRKLSEELRERLNSDNHD
    SAEAAKNLMLEQPAVIKRPLLIADDGNALLGFSIDSYQKFIAEKK

    >gi|253687783|ref|YP_003016973.1| Redoxin domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKWRNGITAFCLLGVVALSGCKEEQVSVGAQAPALAAYDLAGQQVDLSRWQGKSVYLNFWSSGCGGCMVEMGALEKLSQE
    YGDKVVVVAVNTDPDGVDITSMLAHHNVTYPVVRDQLGITKERYQVSGTPTSFIIDANGKVTDQHQGARDEAQLTALFQK
    LASRT

    >gi|253687878|ref|YP_003017068.1| molybdopterin synthase sulfurylase MoeB [Pectobacterium carotovorum subsp. carotovorum PC1]
    MLPELSDEEMLRYNRQIVLRGFDFDGQEKLKASRLLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVSLSNLQRQVLHRD
    DRIGMAKVESARLTLSDMNPHLSLDTVDGDLDDEALSQLVSKHDAVLDCTDNVAIRNRLNRIGFQLRKPLISGAAIRMEG
    QISVFTYQPDEPCYQCLSRLFGANALT
    CVEAGVMSPLVGTIGSLQAMEAIKLLTGYGKLATGRLLMFDAMTLQFREMMLP
    KSQHCDVCGG

    >gi|253687979|ref|YP_003017169.1| Rhodanese domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MPTPLAISPAQARKLLDEGAILIDIRQPEEYAREHIAQARLQPLNSSAGYVLPDDGREGQTVIFHCLSGMRSEQNAGLLA
    QAASPATVFLLEGGMAAWKKAGFPTEVDRKQPIELMRQVQIAAGALILSGVLLGYSVSSAFFLLSGFVGVGLLFAGVTGF
    CGMARLLMKMPWNRDAKR

    >gi|253688075|ref|YP_003017265.1| glutaredoxin, GrxA family [Pectobacterium carotovorum subsp. carotovorum PC1]
    MFAVIFGRPACPYCVRAKELAEKLAEQRDDFSFRYVDIHAEGISKEDLSKTVGKPVETVPQIFLDEKHIGGCTDFEAYAK
    EHLALFQS

    >gi|253688104|ref|YP_003017294.1| thioredoxin reductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MGTVKHHKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDADDLTGPLLMERMHAHATKFNTEV
    IFDHIERVDLQNRPFRLFGDSDEYTCDALIIATGASARYLGLPSEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRETFRSEKILIDRLMDKVKNGNIILHTNRTLDEVLGDDMGVTGVRIRDTQSDAAEELELAGVF
    IAIGHSPNTAVFGGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLTVNK


    >gi|253688188|ref|YP_003017378.1| glutaredoxin, GrxB family [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKLYIYDHCPYCVKARMIFGLKNLPVELQILANDDAATPERLIGQKMVPILQKDDGSHMPESMDIVHFIDNYDRKPLLTG
    STNPAITAWLRKVTEYTPRLIIPRFAQAAFEEFASASARQYFINKKEAQLGNFADHLSHSQGLIKKLNNDLQDLDPLIVQ
    PNACNGELSTDDIDLFPLLRSLSIVAGVTPPSRVAAYRDNMAKQTQVTLLSSLAI

    >gi|253688245|ref|YP_003017435.1| methylated-DNA/protein-cysteine methyltransferase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MFFSQYDSPMGEITVAADGVNLTGLWFVGQKYYAGSFQVEPSISPELPLFSVTKRWLDAYFSGKNPSLDALPLAPSGSDF
    RLAVWQRLCQIPYGEYVTYGTVARDVAAVMGKTSMSAQATGGAVGHNPISIIIP
    CHRVIGTNNSLTGYAGGIAKKIQLLE
    LEGVNTVNMSVPIKGTAL

    >gi|253688333|ref|YP_003017523.1| Disulphide bond formation protein DsbB [Pectobacterium carotovorum subsp. carotovorum PC1]
    MLRFLNRCSRGRGAWLLLAFTALALELTALYFQHVMLLKPCVLCIYQRCALWGVFAAGIVGAIAPSTALRYPAIALWIYS
    SYEGVRLAWKHTDILLNPSPFTT
    CDFFVSFPSWLPLDKWLPAIFNATGDCSVRQWEFLSLEMPQWLLGIFVAYLVVAVLV
    LIAQPFRPKRRDLFSR

    >gi|253688353|ref|YP_003017543.1| methionine-R-sulfoxide reductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTNDSASRTPSDNTELTEMQRYVTQQRGTEPAFSGKLLHNKRTGVYHCLCCQAPLFYSDSKYDSGCGWPSFDQPVSSEAV
    RYLEDDSHNMRRIEIRCGQCDAHLGHVFPDGPKTTGERY
    CVNSASLSFIDDVDGERVDG

    >gi|253688407|ref|YP_003017597.1| electron transport complex, RnfABCDGE type, E subunit [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSQTKALFIEGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLTCTNMAVSALRRWVPAEIRIPIYVMIIASVV
    STVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNAVFPSAIDGLAMGLGATSALVVLGSLREILGNGTLFDG
    ADLLLGSWAKSLRIEVVHLDSPFLLAMLPPGAFIGLGLLLAAKYLIDEKMKQRRARAAATEEKAAPATGTVGESL

    >gi|253688412|ref|YP_003017602.1| electron transport complex, RnfABCDGE type, A subunit [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTEYALLFVSILLVNNFVLVKFLGLCPFMGVSKKLETAIGMGMATTFVMTVGSMFSWLVNEFILVPLDILYLRTMAFILV
    LAVVVQFSEMFVRKVSPELYRLLGIFLPLITTN
    CAVLGVVLLNINLSHGFLKSTIYGFGGAAGFSLVMVLFAAIRERLAV
    SDIPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|253688477|ref|YP_003017667.1| Peroxiredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTIHKKGHAHWEGDIKQGKGTVSTESGALQQQPYGFNTRFEGKPGTNPEELIGAAHAACFSMALSLMLGEEGHKPESIDT
    TADVSLDKVDGGFAITKIALHSKVKLAGIDDATFDSIIQKAKAG
    CPVSKVLKADITLDYQLN

    >gi|253688490|ref|YP_003017680.1| methylated-DNA/protein-cysteine methyltransferase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MQTFFQDTMATPLGELLIIADENNHLRAVEWREYEDDLFRSLNRSYRNDPFSLQARHNPGGLTDGLQRYFEGELTIIDTL
    PVASVGTEFQQQVWRELRRIPCGEITTYGELATLLGRTGAARAVGMANGSNPVSIVVP
    CHRVIGTGGALTGYAGGIHRKQ
    WLLAHEGYLPQQLFTLD

    >gi|253688699|ref|YP_003017889.1| Redoxin domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSQNVHFQGNPVPVSGSFPAKGSKAPAFTLVAKDLSDTPLSNYAGKRKILNIFPSIDTGVCAASVRKFNQLGSELDNTVV
    LCISSDLPFAQSRFCGAEGLNNVVVLSTLRGGEFKENYGVAIADGALKGLTARAVVVLDENDNVLHSELVNEITTEPDYD
    AALAVLK

    >gi|253688763|ref|YP_003017953.1| glutaredoxin-like protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTTPTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQTVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGE
    LIGGCDIVVEMFQRGELQPLIKETADKYKSQQADQE

    >gi|253688795|ref|YP_003017985.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSRKILLIPLVLFLLLAVALLWQLVRNSDGDDPMRLESALIGKPIPEFRLESLDQPGKIYNQSELSDGKPLLLNVWATWC
    PTCRAEHQFLNTLAAQGIRVVGMNYKDERPKAVEWLKTLGNPYAMSLFDGDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNMQVWQETLQPLWEKYSKEGGA

    >gi|253688827|ref|YP_003018017.1| FeS assembly scaffold SufA [Pectobacterium carotovorum subsp. carotovorum PC1]
    MQAENVGTFSLDENVWQGLTLTESAVKQIKNLMKQDEAVQGLRLSVKQSGCAGFGYVLDLVQEFETDDLVFERDGAKLYV
    PLKAMPFIDGTELDFVREGLNQIFKFNNPRAQHACGCGESFGI

    >gi|253688840|ref|YP_003018030.1| hypothetical protein PC1_2463 [Pectobacterium carotovorum subsp. carotovorum PC1]
    MQQTPLFKNHYFHQLPEFYTALQPKPLHGARLLYHSEGLAAELGLSSDWFTPEQDAVWSGERLLPGMEPLAQVYSGHQFG
    MWAGQLGDGRGILLGEQQLADGRSMDWHLKGAGLTPYSRMGDGRAVLRSVIREFLASEAMHHLGIPTTRALTIVTSTHPV
    QREQEEKGAMLMRVAESHVRFGHFEHFYYRREPEKVRQLVEYVIARHWPQWENDERRYELWFGDVVERTARLITHWQAVG
    FSHGVMNTDNMSILGLTIDYGPYGFLDAYQPNFICNHSDHRGRYAFDNQPAVGLWNLHRLAQALSGLMDTDTLERALARY
    EPALMQHYGTLMRAKLGLFTASAEDNDVLVGLLRLMQQEGSDYTHTFRLLADSEKQASRAPLRDEFIDRAAFDSWFATYR
    QRLMQEEQGDEERRRLMNTTNPKFILRNYLAQMAIERAENDDISVLARLHQALCQPFDEQPDKNDLAALPPEWGKHLEIS
    CSS

    >gi|253688845|ref|YP_003018035.1| Peroxiredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSTEIYAIPLTTIDGKATTFEAFKGQVALVVNVASQCGLTKQYDALEKLYETYRDKGLVVLGFPSNEFAGQEPGSEAEIQ
    AFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIREQPEANGTWKSDFFARLVNKGRKPKNPEDILWNFEKFLVDREGHVID
    RFAPDMAPDHDTIVKAIDDALAK

    >gi|253688896|ref|YP_003018086.1| Rhodanese domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTIDDPKAFRDRLYIQLEQCKVLGRIYIATEGINAQISVPNNQFDAFK
    AVLFSAHPALDQIRLNIALEDDGKSFWVLRMKVRERIVADGIDDPTFNPANVGQYLKADQVNAMADDPDTVFVDMRNHYE
    YEVGHFENALEVPSDTFREQLPMAVEMLDEARDKNIVMY
    CTGGIRCEKASAYMLHHGFKNVYHVEGGIIEYARQAKAQGL
    PLKFIGKNFVFDERMGERISDDVIAHCHQCGASCDSHTNCRNEGCHLLFIQCPTCAAKYEGCCSTQCLDEMKLPLEEQRA
    IRSGRENGMKIFNKSKGLLQSTLHIPAPEVKDKAE

    >gi|253689141|ref|YP_003018331.1| NADH-quinone oxidoreductase, chain I [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTLKDLVVGFGTQIRSICMVGSNAFKKRETRMYPEEPVNPPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKA
    ETKDGRWYPEFFRVNFSRCIFCGFCEEACPTTAIQLTPDFEMGDYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDG
    KDKGEAENEAKPIDVKGLLP

    >gi|253689318|ref|YP_003018508.1| OsmC family protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSIEKVLYVAHAQATGGRDGRAVSSDNAVDIKLTTPRELGGAGGEGTNPEQLFAAGYSACFLGAMKFVGAREKIAVPANT
    TVNGSVGIGAIPTGFGIEVELKISLPGLDRAVAEDLVQKAHIV
    CPYSNATRGNIGVTLTIV

    >gi|253689390|ref|YP_003018580.1| Rhodanese domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSASSSDLPVSHERFVSADWLASHLNDSSITLIDARMLPPGNTTRDVHAEYRAGHLPGAVFFDIEALSDHSTDLPHMMPT
    REDFARAMGELGINNQQHLVIYDEGNLFSAPRAWWMLQTFGATSVSILSGGLAGWTAQNLPLEQGDVTPKPTAFHATLDE
    NAIRSRDDVLSISRDKSEQIVDARPAPRFHAEVDEPRPGLHRGHIPGSLNVPWTDLVHNGALKSNAELATILHKHGVDFT
    RPIVAS
    CGSGVTASVVVLALTQLNVPNVTLYDGSWSDWGSRDDVPIARD

    >gi|253689398|ref|YP_003018588.1| iron-sulfur cluster assembly protein IscA [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSISLSESAAQRVSAFIANRGKGLGLRLGVRTSGCSGMAYVLEFVDDLNDGDTVFEDKGIKVIVDGKSLVYLDGTELDFV
    KEGLNEGFKFNNPNSSGECGCGESFNV

    >gi|253689470|ref|YP_003018660.1| iron-sulfur cluster assembly accessory protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSDDIAALPLQFTDAAASKVKNLIADEENPELKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVSLVVDPMSLQYL
    VGGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSV

    >gi|253689500|ref|YP_003018690.1| glutaredoxin-like protein NrdH [Pectobacterium carotovorum subsp. carotovorum PC1]
    MRITIFTKPDCVQCNATCRALDKQGIQYQLVDLTEDEQALQQVRALGYQQVPVVMTADDHWSGFRPDKISTLNAALQLQ

    >gi|253689590|ref|YP_003018780.1| glutaredoxin, GrxB family [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKLFIYEHCPFCVRARMIFGLKDLPVEQSVIMEGDVDTPTRMVGRKVVPILQKEDGSFMPESMDIVHYVDSKQAPLIADK
    AVDAEIETWCKSVSSAVFNLAVPRFTKADFKELSTPEARHAYILREEKAFGDLDALLAKTPELIAEVEQKLNKLEPRLAN
    INAISTTDFILFPILLSLTIVKGVQFGPSVQAYLERVSTASKVALLTDKAL

    >gi|253689697|ref|YP_003018887.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MNTVCGSCQTTNRLPEARIDDHAKCGRCGETLFSGDVINATEATLDKLLQDDLPVVVDFWAPWCGPCVNFAPVFENVAQE
    RNGKIRFIKVNTEAEPALSARFRIRSIPTLMIFKQGQMVDILNGALPKAQFEDWLDESL

    >gi|253689779|ref|YP_003018969.1| peptide methionine sulfoxide reductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSSIDKTQRITQSDALPGRSTPMPVARLHVVHEHSMTHVPDHMSVAIFAMGCFWGVERLFWQQPGIYSTAAGYIGGYTPN
    PTYREVCSGQTDHAEAVRVVFDPAVISYDQLLQLFWENHDPAQGMRQGGDIGSQYRSAIYTLTPEQEQAAQESLQRFQQA
    MREKGDVRAISTEIVPAGPFYYAEDDHQQYLYKNPNGYCGLGGIGVCLPPPR

    >gi|253689879|ref|YP_003019069.1| alkylhydroperoxidase like protein, AhpD family [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSTLRLPYQTLSPEAYQGFGIAKKALNKSSLGKPLIELVYLRVSQINGCAFCLEMHASALRTDGVPDAKLDSLAGWRVSA
    QFNERERAALAWTESLVDVAHSHAPDEDFEPLKAHFSDAEIADLSFAVALMSAFNRLAIGMRQ

    >gi|253689927|ref|YP_003019117.1| dihydrolipoamide dehydrogenase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSTEIKAQVVVLGAGPAGYSAAFRAADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRLWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVDGENGKTTINFDNAIIAAGSRPIQLPFIPHDDP
    RVWDSTDALELKNVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIIKVFTKRISKQFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|253690011|ref|YP_003019201.1| hydroxymethylbutenyl pyrophosphate reductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MQILLANPRGFCAGVDRAISIVERALELFGTPIYVRHEVVHNRYVVNGLRERGAIFIEQIEDVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASKKGIEAILIGHAGHPEVEGTMGQYSNADGGMYLVESPEDVWQLQVKDESN
    LCFMTQTTLSVDDTYAVIDALRERFPQIVGPRKDDICYATTNRQEAVRHLSDKADVVFVVGSKNSSNSNRLAELAQRAGK
    AAYLIDSAEDIQESWVEGASHVGVTAGASAPDILVQQVIQRLKALGGKVAVEMQGREENIVFEVPKELRVEVKQVD

    >gi|253690090|ref|YP_003019280.1| alkyl hydroperoxide reductase, F subunit [Pectobacterium carotovorum subsp. carotovorum PC1]
    MLDNTMKVQLKAYLEKLTKPVELIATLDDSAKSAEVRTLLTEIAELSERVSFVEKNELAVRKPSFLITNPGSQSGPRFAG
    APMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLDGAFHFETYYSLS
    CHNCPDVVQALNLMAVLNPNITHTAIDGGVFQ
    DEIQSRNVMGVPTVFLNGEHFSQGRTSLAEIVTKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
    VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPGKPHQVITVSGATLKARSVII
    ATGARWRNMNVPGEDQYRTRGVTY
    CPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKV
    RSLPNVDIILNAQTTEVKGDGQKVTGLSYKDRITDTVHDLALEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA

    >gi|253690091|ref|YP_003019281.1| peroxiredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSVINTQVKPFKNMAFKDGQFIEVTEKNIEGKWSVFFFYPADFTFVCPTELGDVADYYDEFQQRGVEIYSVSTDTHFTHK
    AWHSSSETIGKIKYTMIGDPTGQLTRNFENMREAEGLADRGTFIVDPQGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|253690292|ref|YP_003019482.1| Thiosulfate sulfurtransferase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MEQFEAISIEQAHSRWQEGGVVVDIRDPQSFAAAHVPGATHLTNETLSDFVRGADFEAPVMVICYHGISSRNAAQYLISL
    GFDSVYSIDGGFEAWQNRYPQDTQAQA

    >gi|253690373|ref|YP_003019563.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
    MSDKIIHLTDDSFGTKVLQAEGAILVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLTANL

    >gi|253690444|ref|YP_003019634.1| Rhodanese domain protein [Pectobacterium carotovorum subsp. carotovorum PC1]
    MQEIMPFVSKNPILSIAWVALLVAVIVLTVKSKLSNVKEVVRGEAIRLINKEDAVVVDIRNRDDYRRGHIASAFNLLPND
    IKNGSVGELEKHKSQPIIVV
    CANGLSSREAAENLHKAGFERVQVLKDGLAGWSGENLPLVRGK

    >gi|253690539|ref|YP_003019729.1| uncharacterized peroxidase-related enzyme [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTHANTLHTPDVLDTLAEISPDSALAAARKTRDAATRHTQGSYEALFNANAADDATLPLSLRFWFATKISGWQQDEQLQR
    FYAERLSDFPEPALTPALQLALDHAERLTKTPVHASASHVSALEQAGWSVDDIVTLSQLIAFVNFQSRLLRGYRLIASHR
    VGQPHSQAAVAGQWHTQPQTHSGKSAPQAFTQAELGWEPWIAPKPLAEFNADEQAILARFGHTDSDYFRLLGRNLPVLEQ
    RTLTDKGIFYTAGGLPRKERELIAAVTSKVNGCIY
    CASVHARKASQLSKQDSDVQRLLDVVPGGDLGIGQSPRWQAIIDF
    SARLSATPAQVNANDLKQLQEQGLDTLEIVDVVQSAAFFSWANRLMLTLGEPFWPEH

    >gi|253690542|ref|YP_003019732.1| disulfide isomerase/thiol-disulfide oxidase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MIKRVFLTLSLLTLSASSLAQDALPDAVKSIEKQGITIIKPFTAPGGVQGWLGSYQGVGVTIYLTPDGKHAISGYMYDEH
    GNNLSEALIQQEVYVPAGREMWQKLQQASFITEGSKDAPRKIIVFADPF
    CPYCKQFWQQAQPWVKAGKVQLQTLLVGVIK
    PESGRYAAAILAASDPAKAWHEYELSNGKTVPPFPESSSRDIWNNIQHNQRLMDELGANVTPAIYYLNDKSELQQVVGLP
    DEKQLAEMMGK

    >gi|253690546|ref|YP_003019736.1| glutathione-disulfide reductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MTKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKYLGGTCVNVGCVPKKVMWHAAQIAEAIHQYGPDYGFDTTVNQFN
    WGTLVKNRSAYIDRIHQSYDNVLGKNKVDVIHGFARFVDAHTVEVNGEKITADHILIATGGRPVHPTIPGAEYGIDSDGF
    FELDALPKRTAIVGAGYIAVEIAGVLNGLGSETHLFVRKHAPLRSFDPLIVDTLVEVMNTEGPTLHTESIPKAIVKNTDG
    SLTLELENGQSQTVDCLIWAIGREPATDNLNLSVTGVELNDKGYINVDKFQNTNVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGKEE
    KIVGIHGIGFGMDEMLQGFAVAVKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|253690588|ref|YP_003019778.1| DSBA oxidoreductase [Pectobacterium carotovorum subsp. carotovorum PC1]
    MKRLWLALIGMVLAFSASAAEFSDGKQYVELDKPATQEPQVLEFFSFYCPHCYQFEQVYHVPDAVKKALPEGTKMTRYHV
    DFLGPLGKNLTQAWAVAMALGVEDKITPLMFDAVQKTQTVQKPEDIRDVFVKAGVSAEEFDGALNSFVVKSLVAQQEKAA
    ADLQLRGVPAMFVNGKYMIKNDGLDTSSMDGYVKQYAEVVKFLVTKK