Pectobacterium atrosepticum SCRI1043 uid57957

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50118985|ref|YP_048152.1| periplasmic protein disulfide isomerase I [Pectobacterium atrosepticum SCRI1043]
    MKRLWLALIGVVLAFSASAAEFSDGKQYVELDKPATQEPQVLEFFSFYCPHCYQFEQVYHVPDAVKKALPEGTKMTRYHV
    DFLGPLGKNLTQAWAVAMALGVEDKITPLMFDAVQKTQTVQKPEDIRAVFVKAGVSAEEFDGALNSFVVKSLVAQQEKAA
    ADLQLRGVPAMFVNGKYMIKNDGLDTSSMDGYVKQYADVVKFLITKK

    >gi|50119024|ref|YP_048191.1| glutathione reductase [Pectobacterium atrosepticum SCRI1043]
    MTKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKYLGGTCVNVGCVPKKVMWHAAQIAEAIHQYGPDYGFDTTVNQFN
    WGTLVKNRSAYIDRIHQSYDNVLGKNKVDVIHGFARFVDAHTVEVNGEKITADHILIATGGRPVHPNIPGAEYGIDSDGF
    FELDALPKRTAIVGAGYIAVEIAGVLNGLGSETHLFVRKHAPLRSFDPLIVDTLVEVMNTEGPTLHTESIPKAIVKNADG
    SLTLELENGQSQTVDCLIWAIGREPATDNLNLSVTGVGLNDKGYINVDKFQNTTVSGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGKEE
    KIVGIHGIGFGMDEMLQGFAVAVKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|50119028|ref|YP_048195.1| disulfide isomerase/thiol-disulfide oxidase [Pectobacterium atrosepticum SCRI1043]
    MIKRVSLTLTLLTLSASSLAQDALPDAVKSIEKQGITIIKPFTAPGGMQGWLGSYQGVGVTIYLTPDGKHAISGYMYDEH
    GNNLSEALIQQEVYVPAGREMWQKLQQAPFITEGAKDAPRKIIVFADPF
    CPYCKQFWQQAQPWVKAGKVQLQTLLVGVIK
    PESGRYAAAILAASDPAKAWHEYELSNGKTVPPFPESASRDIWNNIQLNQRLMDELGANVTPAIYYLNDKDELQQVVGLP
    DEQQLAEMMGK

    >gi|50119032|ref|YP_048199.1| hypothetical protein ECA0070 [Pectobacterium atrosepticum SCRI1043]
    MTHANTLHTHDVLDALAEIGPDSALAAARKTREAATRHTQGSYDALFNATVHDNATLPLSLRFWFATKISGWQQDEQLQH
    FYTERLADFPEPVLTPALQLALDHAERLTKTPVQAAPSHVNALEQAGWSVDDIVTLSQLIAFVNFQSRLLRGYRLIAGHR
    VSQPHSQAAVAGQWHNTQSQTHSGKSAPQAFTQAELDWEPWIAPKPLAEFNTDEQAILARFGHTDSDYFRLLGRNLPVLE
    QRTLTDKGIFYTSGGLPRKERELIAAVTSKVNGCIY
    CASVHARKASQLSKQDSDVQRLLDVVPGGNLSIGQSPRWQAIID
    FSARLSATPAQVNANDVKQLQEQGLDTLEIVDVVQSAAFFSWANRLMLTLGEPFWPES

    >gi|50119131|ref|YP_048298.1| putative rhodanese-related sulfurtransferase [Pectobacterium atrosepticum SCRI1043]
    MQEIMPFVSKNPILSIAWVALLVAVIVLTVKSKLSNVKEVVRGEAIRLINKEDAVVVDIRNRDDYRRGHIASAFNLLPND
    IKNGSVGELEKHKSQPIIVV
    CANGLSSREAADNLHKAGFERVQVLKDGLAGWSGENLPLVRGK

    >gi|50119191|ref|YP_048358.1| thiamine biosynthesis protein ThiF [Pectobacterium atrosepticum SCRI1043]
    MVTNHPPTPAGLSDSEFMRYSRQLMLEDIGPEGQEKLKAARVLLVGLGGLGSPASLYLAAAGVGTLLLADDDSLHISNLQ
    RQILYRTSETDQPKAVLAQRQLQALNPHSEAIAITERLSGDALHNAVSRVDLVLDCSDNMITRHAVNAACVGAGKPLISG
    SAVGFSGQLTVFTPPYHSGCYACLYPDTAEPQRN
    CRTAGVLGPVVGVIGTLQALEAIKLLAGLPSALDGKLRMFNGKQQS
    WSTLQLTRSPHCPVCGGVA

    >gi|50119568|ref|YP_048735.1| thiol:disulfide interchange protein [Pectobacterium atrosepticum SCRI1043]
    MAQRIFTLIFLLWTAVGTPQVAASSFGQKLFGNSTTSRFLPVDGAFAFEFQQQGNQLNLRWDIHPDYYLYRAQIKIEGNG
    ATLGKVELPQGESHNDEFFGQVFILRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETRTVPLSQVLATANTDSPI
    NTLSGQTAPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIASLVLGRKEQLTPRRTLLLSMTYVQGMALTYTLLGLIV
    AAAGLRFQAALQHPYILIGLSVMFIALALSMFGLYTLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICSPCTTAP
    LSAILLYIAQSGNMLAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILALPVFLLERILGEAWGIR
    LWSALGIAFFGWALMLTLSSKKGWMRGVQLLLLAGVVISAKPLQDWVFPPTGTAQTHTSALNFAPVANIADLNSALAKSP
    QPVMLDLYADW
    CVACKEFEKYTFSDPAVQNHLSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDTQGKEIPGSRVT
    GFMNAEQFQAHLQKFSP

    >gi|50119716|ref|YP_048883.1| thiol:disulfide interchange protein DsbC [Pectobacterium atrosepticum SCRI1043]
    MKKGLLLLSLLVATATNFAHADDAAIKQTLTRLDMQGAEILPSPMAGMKTVITESGVLYISEDGKHLLQGPLYDVSGTMP
    VNTTNQILIGKLNALQEQMIVYKAAQEKHVITVFTDIT
    CGYCHKLHEQMKDYNALGITVRYLAFPRQGMKSPAAKDMQSI
    WCVADRNKAFDNAMKSEAISPATCKTDIAAHYQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG

    >gi|50119850|ref|YP_049017.1| methylated-DNA--protein-cysteine methyltransferase [Pectobacterium atrosepticum SCRI1043]
    MRNDTMLNDTPFQDDDSRWQAVVTRNKAADSCFIYAVKTTSIYCAPSCASRQPRRENVVFFATADEAQAAGFRPCKRCRQ
    GMLSRQEQQAQQIARACRMIEQSDRPPTLAVLAQAVGMSAFHFHRVFKTTTGLTPKQYASAYRHRQLREHLADNGEVTAA
    IVAAGYDASGRFYAEAGTHLGMTPTAFQNRGKGMTIHFAIGRCSLGDVLVAESEKGICAILLGDDPEPLLNTLQEMFAHA
    HLVGGDAAFEQRMSQVVGFVDDPSIGLTLPLDIRGTAFQQRIWQALRAIPVGETLSYREVAERIGSPAAVRAVAGACAAN
    RLAVAIP
    CHRVVRHDGALSGYRWGVERKRALLEKEQVEKKQIVHQPEESPP

    >gi|50120056|ref|YP_049223.1| peroxidase [Pectobacterium atrosepticum SCRI1043]
    MVLVTRQAPDFTAAAVLGSGEIVENFNLKKHINGKAAVIFFWPMDFTFVCPSELIAFDHRYAEFKKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVQYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRTVDA
    LQFHEEHGEVCPAQWEKGKSGMGASPDGVAKYLSENADKL

    >gi|50120132|ref|YP_049299.1| copper exporting ATPase [Pectobacterium atrosepticum SCRI1043]
    MSQTIVLSLQGLTCGHCVQRVKKALDALPAVEQTDVTQQYARVSGDVDSQTLIDTIEQAGYDAQLATTPDVSLQLSGLSC
    NHCVAATRKVLEAIPGVVATDVTKEQAAVYGNVEATTLISAIEDAGYHATVQESVHPKTEPLAQVATTPEALPAAESILP
    ATTRHTTNADDSVQLLLQGMS
    CASCVNRVQTALQNVSGVTQARVNLAERSALVSGHAEPEALIAAVEQAGYGAEIIQDEE
    ARRARQQQTAQQAIRRFQWQAALGLLLGVPLMLWGVLGGSMSLTPENQTPWLVIGILTLAVMVLAGSHFYRNAWRSLKNG
    AATMDTLVALGTGAAWLYSITVNLWPDLFPMAARHLYYEASAMIIGLINLGHALEQRARQRSSRALERLLDLTPPTARIV
    TPEGEKSIPLSEVQSGMTLRLTTGDRIPVDGEILQGEVWVDEAMLTGEPIPQSKTSGDTVHAGTLVSDGSVLFRADAIGN
    QTTLSRIIRLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWFFVGPQPQIVYTLIIVTTVLIIACPCALGLATP
    MSIISGVGRAAEFGVLVRDADALQQASKLDVLVFDKTGTLTEGQPRVVAIHTFGSVTEEQALAWAASLEQGSNHPLAKAI
    LERAENLTLTQVEQFRTLRGLGVSGKIGETDLLLGNPPLLQQYQVDTTEGETLINEQAQRGITPVLLAANGHIIAVFSIH
    DPLRADSVSALQRLHQQGYQLVMLTGDNPLTAKSIAKEAGIYQVIAGVLPDGKAEAIKKLQAQGKRVAMIGDGINDAPAL
    AQADVGIAMGGGSDIAIETAAITLMRHSLHGVADALELSNATLRNMKQNLLGAFIYNSLGIPIAAGVLYPLTGTLLSPVV
    AGAAMALSSITVVSNANRLLRFKPKSQ

    >gi|50120159|ref|YP_049326.1| putative thioredoxin [Pectobacterium atrosepticum SCRI1043]
    MLEQQATIVDVNESNLNQVLEHSATLPVLFYFWSARSQHCVELEPVLDKLAQEYAGQFVLAKVDCDAEQRVAAQFGLRSI
    PTVYLFKDGQPLDGFQGPQPEEAVRELLKRALPKEEELKVAQAQQLIQEDKLPEAMQLLKDAWQLSQQRSDIGLMLAEVQ
    IQIKRSEDAEAVLAAIPLQDQDTRYHSLVAQIELLKQAADTPEIQHLQQQLDADPQNADLAVQLALQLHQVSRNEEALEL
    LMGFLKKDLAVANGSARKTLMDIMAALGTSDALAARYRRQLYSLLY

    >gi|50120197|ref|YP_049364.1| putative arsenate reductase [Pectobacterium atrosepticum SCRI1043]
    MTHPSTKASVTIYHNPRCSKSRETLALLQEHNIAPDVVLYLDTPPDAATLDQLIQQLGFSSARELMRTKEEVYQQLGLSD
    AALTEAQLIQAMVDNPKLIERPIVVAQGQARIGRPPEQVLEIL

    >gi|50120199|ref|YP_049366.1| thioredoxin-dependent thiol peroxidase [Pectobacterium atrosepticum SCRI1043]
    MNTLKAGDIAPKFSLPDQDGEQVNLTDFQGQKVLVYFYPKAMTPGCTVQACGLRDNMDDLKKHGVEVLGISTDKSEKLSR
    FIEKEVLNFTLLSDEDHQVSEGFGVWGEKTFMGKTYDGIHRISFLIDENGKVEKVFDDFKTSNHHDIVLDYLKSA

    >gi|50120206|ref|YP_049373.1| thioredoxin [Pectobacterium atrosepticum SCRI1043]
    MSDAIITASDTSLDALLNNSDKPILLDLWAPWCQPCKTLAPLLNTIADNTPDNLTVAKLDVEQYPAFMQRFGVRGIPTLL
    LFKNGQEISRQIGVKTLAQLRGWLESHEIAIQNTAQPLADTHVTWSTFYGDASLHTFLHQRLRQHAADGNIEHAFSPYWQ
    DNKGSVSAVLAHSADIRIFERVTGLPAALGLLLEKLPSTTPEQVDALFAALAPGKTVDGVALQWLHHWLSHEENQWSDWL
    VDETVDGLRQQWVQAISRLLAGESVAESEWTALHQQAISWEEKAATELGLEKNIATILASLSPPPAASDADSWRSISTTL
    GFALAQILQIKDGWSREERATPDKRFRWFQAQEEATPSKKLTDEQITALREQWLQENSDFSAKEDAFYQRYPQLSEAQKI
    PLQETLWELLRRAPAFKSQLD

    >gi|50120231|ref|YP_049398.1| hypothetical protein ECA1292 [Pectobacterium atrosepticum SCRI1043]
    MALTLYGIKNCDTIKKARRWLEDQQVAYQFHDYRADGLDEQQLQRFIDQLGFQALLNTRGTTWRKLSEEQRERINSNTSD
    SAEAAKNIMLEQPAVIKRPLLIADDGNALLGFSIDSYQKFIAENK

    >gi|50120451|ref|YP_049618.1| putative lipoprotein [Pectobacterium atrosepticum SCRI1043]
    MKWRNGITALCLLGAVALSGCKEEQVSVGAQAPALAAYDLAGQQVDLSRWQGKSVYLNFWSSGCGGCMVEMGALEKLSKE
    YGDKVVVVAVNTDPDGVDITSMLAHHSVTYPVVRDQLGITKERYQVSGTPTSFIIDANGKVTDQHQGVRDEAQLTELFQK
    LASRT

    >gi|50120490|ref|YP_049657.1| hypothetical protein ECA1555 [Pectobacterium atrosepticum SCRI1043]
    MGHPSVYPTGTTIFNPEKAWGGYTVFQALERGAVLVDMNGTELRLWEGLHGFPNKILPGGYILGHSGERDSRYGMQDMVD
    LIQVDWDGNVVWKFNGYEHITDPDLPPEWMARVHHDYQRSGNPVGYYAPGQEPQSIGGNTLLLAHTNLHNERISDKLLLD
    DTIIEVDWQGNILWEWRCSDHFDELGFDDDAKTALYNNPNLRKSGGGMGDWMHINSMSALGPNPWFDQGDTRFHPDNIIW
    DARESNIIAIIDKLSGNIVWQLGPNYNTPELKHIGWIIGQHHAHMIPAGLPGAGNILVFDNGGWAGYGTPNPASPDGVKN
    AWRDHSRVLEINPVTLDIVWRYSPYEADIPHPTDAFRFYSPYISNIQRLPNGNTLINEGANGRLFEVTVDHEIVWEFISP
    YWGKTVNTNMLYRAYRVPYEWVPQLSRPQETPVIAPDNTQLRQPGAAAPGFASVIRIDGTRPYKKSGDALCVATDSEDLK
    RSPKLFAVNRERFAPLTADDWTELATQAGPQLLLIGAER
    CVHCKSLYRQLETILDNEEYRQLPSHYLDADHHIALAEKLA
    VRTLPTLLWLENGEEQARLSGAQQPERLRQWLAEQQA

    >gi|50120521|ref|YP_049688.1| glutathione-S-transferase [Pectobacterium atrosepticum SCRI1043]
    MLNAQLTLISHPLCPFVQRAAIVLLEKNVSFERIDVDLAAKPDWFLALSPMDKVPLLKVELADNSDAILFESAAICEYLN
    ETQAGASLYSSDALSRAQQRAWVEFGVAALSDAWQFLNAKELAVANDKKAAFRDKLQRLESTLEQGPYFSGSAFSMVDAM
    FAPVFRYFDLLSPDVSQPIFDNLPRVSAWRASLANRPSVLAAVRDDYADRFKQHLVKQQVILSDSMCKTT

    >gi|50120536|ref|YP_049703.1| arsenate reductase [Pectobacterium atrosepticum SCRI1043]
    MSNITLYHNPACGTSRNTLEMIRNSGNEPTIIYYLDTPPTRDELIKLISDMGMTVRALLRKNVEPYEQLGLDEDIFSDEK
    LIDFMLKHPILINRPIVVTPLGTRLCRPSEIVLDILPEGQKATFTKEDGEKVIDEDGNRVK

    >gi|50120714|ref|YP_049881.1| hypothetical protein ECA1781 [Pectobacterium atrosepticum SCRI1043]
    MPGDSMCQAMAGNERHMLTSVKTGTYTMPVLHNRVSNEELKARMLAETEPRTTVSFYKYFTIDDPKAFRDRLYIQLEQYK
    VFGRIYIAAEGINAQISVPNNQFDAFKTGLFSAHPALDQIRLNIALEDDGKSFWVLRMKVRERIVADGIDDPTFNPANVG
    QYLKADRVNAMADDPDTVFVDMRNHYEYEVGHFQNALEVPSDTFREQLPMAVDMLDDIRDKNIVMY
    CTGGIRCEKASAYM
    LHHGFKNVYHVEGGIIEYARQAKAQGLPLKFIGKNFVFDERMGERISDDVIAHCHQCGASCDSHTNCRNEGCHLLFIQCP
    SCAAKYEGCCSTQCQDEMKLPLEEQRAIRSGRENGMKIFNKSKGLLQSTLHIPAPAAKDNAE

    >gi|50120763|ref|YP_049930.1| putative glutathione peroxidase [Pectobacterium atrosepticum SCRI1043]
    MSTEIYAIPLTTIDGKATTFEAFKGQVALVVNVASKCGLTKQYDALEKLYETYRDKGLVVLGFPSNEFAGQEPGSEEEIQ
    EFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIRQQPEANGTWKSDFFARLVNKGRKPKNPEDILWNFEKFLVDREGRVIE
    RFAPDMSPDHDTIVKAIEAALAK

    >gi|50120772|ref|YP_049939.1| hypothetical protein ECA1842 [Pectobacterium atrosepticum SCRI1043]
    MQQTPLFKNHYFHQLPGFYTALQPTPLHGARLLYHSEGLASELGLSSDWFTPEQDDVWSGTRLLPGMEPLAQVYSGHQFG
    SWAGQLGDGRGILLGEQQLADGRSMDWHLKGAGLTPYSRMGDGRAVLRSAIREFLASEAMHHLGIPTTRALTIVTSQHPV
    QREQEEKGAMLLRVAESHVRFGHFEHFYYRREPEKVRQLVEYVIARHWPQWENDERRYELWFGDVVERTARLITHWQAVG
    FSHGVMNTDNMSILGLTIDYGPYGFLDAYQPDFICNHSDHRGRYAFDNQPAVGLWNLHRLGQALSGLMDTDTLERALARY
    EPALMQHYGTLMRAKLGLFTASPDDNDVLVGLLRLMQKEGSDYTRTFRLLADSEKQASRSPLRDEFIDRAAFDSWFATYR
    QRLMQEDQDDEERRRLMNATNPKYILRNYLAQMAIERAESDDTSALARLHQALCRPFDEQPDSHDLAALPPDWGKHLEIS
    CSS

    >gi|50120789|ref|YP_049956.1| iron-sulfur cluster assembly scaffold protein [Pectobacterium atrosepticum SCRI1043]
    MQAENVGTFSLDENVWQGLTLTDSAVKQIKNLMTQDEAVQGLRLGVKQSGCAGFGYVLDLVQEFETDDLIFERDGAKLYV
    PLKAMPFIDGTELDFVREGLNQIFKFNNPRAQHACGCGESFGI

    >gi|50120818|ref|YP_049985.1| thiol:disulfide interchange protein [Pectobacterium atrosepticum SCRI1043]
    MSRKILLIPLALFLLLAVALLWQLVRNSDGDDPMRLESALIGKSIPAFRLESLDQPGKIYSQSELSDGKPLLLNVWATWC
    PTCRAEHQFLNTLAAQGIRVVGMNYKDERPKAVEWLKTLGNPYAMSLFDGDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNMQVWQETLQPLWEKYSKEGGA

    >gi|50120857|ref|YP_050024.1| hypothetical protein ECA1927 [Pectobacterium atrosepticum SCRI1043]
    MTTPTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQTVQALSSCGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGE
    LVGGCDIVVEMFQRGELQQLIKETADKYKAQQADQE

    >gi|50120917|ref|YP_050084.1| thiol peroxidase [Pectobacterium atrosepticum SCRI1043]
    MSQNVHFQGNPVPVAGSFPAKGSKAPAFTMVAKDLSDASLSNYAGKRKILNIFPSIDTGVCAASVRKFNQLGSELDNTVV
    LCISSDLPFAQSRFCGAEGLNNVVVLSTLRGGEFKESYGVAIADGALKGLTARAVVVLDENDNVLHSELVNEITTEPDYD
    AALAVLK

    >gi|50121134|ref|YP_050301.1| methylated-DNA--protein-cysteine methyltransferase [Pectobacterium atrosepticum SCRI1043]
    MQTFFQDTMATPLGELLIIADENNHLRAVEWREYEDGLFRSLNRSYRNDPFSLQSRHNPGGLTDSLQRYFDGELAIIDTL
    PVASVGTEFQQQVWRELRRIPCGEITTYGELATLLGRTGAARAVGMANGSNPISIVVP
    CHRVIGTGGALTGYAGGIHRKQ
    WLLAHEGYLPHQNSLPL

    >gi|50121147|ref|YP_050314.1| osmotically inducible protein C [Pectobacterium atrosepticum SCRI1043]
    MTIHKKGQAHWEGDIKQGKGTVSTESGALQQQPYGFNTRFEGKPGTNPEELIGAAHAACFSMALSLMLGEEGHKPESIDT
    TADVSLDKVDGGFAITKIALHSTVTLPGIDEATFDKIIQKAKAG
    CPVSKVLKAEITLDYQLN

    >gi|50121204|ref|YP_050371.1| Na(+)-translocating NADH-quinone reductase subunit E [Pectobacterium atrosepticum SCRI1043]
    MTEYALLFVSILLVNNFVLVKFLGLCPFMGVSKKLETAIGMGMATTFVMTLGSMFSWLINEFILVPLDILYLRTMAFILV
    LAVVVQFSEMFVRKVSPELYRLLGIFLPLITTN
    CAVLGVVLLNINLSHGFLQSTIYGFGGAAGFSLVMVLFAAIRERLAV
    SDIPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|50121209|ref|YP_050376.1| electron transport complex RsxE subunit [Pectobacterium atrosepticum SCRI1043]
    MSQTKALFIDGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLTCTNIAVSALRRWVPAEIRIPIYVMIIASVV
    STVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNAVFPSAIDGLAMGLGATSALVVLGSLREILGNGTLFDG
    ADLLLGSWAKVLRIEVVHLDSPFLLAMLPPGAFIGLGLLLAVKYLIDEKMKQRRARAVAAEGKMVPTAGAVGESL

    >gi|50121271|ref|YP_050438.1| methionine sulfoxide reductase B [Pectobacterium atrosepticum SCRI1043]
    MTNDSASHTPSDNTEMTEMQRYVTQQRGTEPAFSGKLLHNKRTGAYHCLCCQAPLFYSDSKYDSGCGWPSFDQPVSSEAV
    RYLEDESHNMRRIEIRCGQCDAHLGHVFPDGPKTTGERY
    CVNSASLSFIDDVDGERVDG

    >gi|50121290|ref|YP_050457.1| disulfide bond formation protein B [Pectobacterium atrosepticum SCRI1043]
    MLRFLNRCSRGRGAWLLLAFTALALELTALYFQHVMLLKPCVLCIYQRSALWGVFAAGIVGAIAPSSLLRYPAIALWIYS
    SYEGIRLAWKHTDILLNPSPFTT
    CDFFVSFPSWLPLDKWLPAIFNATGDCSERQWSFLSMEMPQWLLGIFAAYLLIAVLV
    LIAQPFRSKRRDLFSR

    >gi|50121380|ref|YP_050547.1| methylated DNA--protein-cysteine methyltransferase [Pectobacterium atrosepticum SCRI1043]
    MFFSQYDSPMGEITIAADGKNLTGLWFVGQKYYAQSLQVELSIGSELPLFSAIRRWLDAYFSGHNPSLDALPLAPSGSDF
    RLAVWQRLCQIPYGEYVTYGTVARDVAAVMGKTSMSAQATGGAVGHNPISIIIP
    CHRVIGTNNSLTGYAGGIAKKIQLLE
    LEGVNTVNMSVPIKGTAL

    >gi|50121450|ref|YP_050617.1| glutaredoxin 2 [Pectobacterium atrosepticum SCRI1043]
    MKLYIYDHCPYCVKARMIFGLKNLPVELQILANDDAATPERLIGQKMVPILQKDDGSYMPESMDIVHFIDSYDRKPLLTG
    STNPAIAAWLRKVTEYTPRLIIPRFAQAAFEEFASAPARQYFVNKKEAQLGNFADHLSHSQGLIKKLNHDLQDLDPLIVQ
    PNACNGVLSTDDFDLFPLLRSLSIVAGVTPPSRVADYRDNMAKQTQVTLLSSLAI

    >gi|50121573|ref|YP_050740.1| thioredoxin reductase [Pectobacterium atrosepticum SCRI1043]
    MGTVKHHKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDADDLTGPLLMERMHAHATKFNTEV
    IFDHIERVDLQNRPFRLFGDSAEYTCDALIIATGASARYLGLPSEDAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRETFRSEKILIDRLMEKVKNGNIILHTNRTLDDVLGDDMGVTGVRIRDTQSDAAEELELAGVF
    IAIGHSPNTAVFGGQLALKNGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLTVK

    >gi|50121605|ref|YP_050772.1| glutaredoxin 1 [Pectobacterium atrosepticum SCRI1043]
    MFAVIFGRPACPYCVRAKELAEKLAEQRDDFSFRYVDIHAEGISKEDLSKTVGKPVETVPQIFLDEKHIGGCTDFEAYAK
    EHLALFQS

    >gi|50121685|ref|YP_050852.1| hypothetical protein ECA2761 [Pectobacterium atrosepticum SCRI1043]
    MSTPLAISPAQAHKLLDEGAILIDIRQPEEYAREHIAQAKSHPLNSSAGYPLTGEDREGKVVIFHCLSGMRSEQNAEILV
    QSVFPATAFLLNGGMTAWKKAGFPTEINNKQPIEIMRQVQIAAGALILSGVLLGYSVNSTFFLLSGFVGVGLLFAGITGF
    CGMAKLLMKMPWNGGAKR

    >gi|50121761|ref|YP_050928.1| molybdopterin biosynthesis protein MoeB [Pectobacterium atrosepticum SCRI1043]
    MLPELSDEEMLRYNRQIVLRGFDFDGQEKLKASRLLIVGLGGLGCAAAQYLTAAGVGHLTLLDFDTVSLSNLQRQVLHRD
    NRIGMAKVESARLTLSDMNPHISFDTVDSDLDDDALSELVSQHDAVLDCTDNVAIRNRLNRIGFQLKKPLISGAAIRMEG
    QISVFTYQPDEPCYHCLSRLFGANALT
    CVEAGVMSPLVGTIGSLQAMEAIKLLTGYGKLTTGRLLMFDAMTLQFREITLP
    KNPRCDVCGG

    >gi|50121944|ref|YP_051111.1| NADH dehydrogenase subunit I [Pectobacterium atrosepticum SCRI1043]
    MTLKELVVGFGTQIRSICMVGSNAFKKRETRMYPEEPVNPPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKA
    ETKDGRWYPEFFRVNFSRCIFCGFCEEACPTTAIQLTPDFEMGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDG
    KDKGEAENEAKPIDVKGLLP

    >gi|50122089|ref|YP_051256.1| organic hydroperoxide resistance protein [Pectobacterium atrosepticum SCRI1043]
    MSIEKVLYVAHAQATGGRDGRAVSSDNAVDIKLTTPRELGGAGGEGTNPEQLFAAGYSACFLGAMKFVGARDKIAVPADT
    TVNGSVGIGAIPTGFGIEVELKISLPGLDRAVAEDLVQKAHIV
    CPYSNATRGNIDVTLTVV

    >gi|50122149|ref|YP_051316.1| 3-mercaptopyruvate sulfurtransferase [Pectobacterium atrosepticum SCRI1043]
    MSASSSDLPVSHERFVSADWLANHLNDSSITLIDARMLPPGNDTRDIHAEYRAAHLPGAVFFDIENLSDHSTDLPHMMPT
    CENFARAMGELGIDNQQHLVIYDEGNLFSAPRAWWMLHTFGATSISILSGGLAGWKAQNLPLEQGYVTRKPVTFHATLDE
    NAIRSRDDVLSISRDKSEQIVDARPASRFHAEVDEPRPGLHRGHIPGSLNVPWTDLVNNGALKPNAELATILHKHGVDFT
    RPIVAS
    CGSGVTASVVVLALTQLNVPNVTLYDGSWSDWGSRDDVPIARD

    >gi|50122157|ref|YP_051324.1| iron-sulfur cluster assembly protein [Pectobacterium atrosepticum SCRI1043]
    MSISLSESAAQRVSAFIANRGKGLGLRLGVRTSGCSGMAYVLEFVDDLNDGDTVFEDKGVKVIVDGKSLVYLDGTELDFV
    KEGLNEGFKFNNPNISGECGCGESFNV

    >gi|50122228|ref|YP_051395.1| hypothetical protein ECA3306 [Pectobacterium atrosepticum SCRI1043]
    MSDDIAALPLQFTDAAASKVKNLIADEENPELKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVALVVDPMSLQYL
    VGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV

    >gi|50122257|ref|YP_051424.1| putative glutaredoxin [Pectobacterium atrosepticum SCRI1043]
    MRITIFTKPDCVQCNATCRALDKQGINYQLVDLTEDEQALQQVRALGYQQVPVVMTANDHWSGFRPDKISTLNAALQLQ

    >gi|50122299|ref|YP_051466.1| glutaredoxin 2 [Pectobacterium atrosepticum SCRI1043]
    MKLFIYEHCPFCVRARMIFGLKNLPVEQSVIMEGDADTPTRMVGRKVVPILRKEDGSFMPESMDIVHYVDSKQAPLIADK
    PVDAEIEAWCKSVSNAVFNLAVPRFTKADFKELSTPEARHAYILREEKAFGDLDGLIAKTPELIAEVEQKLEALESRLAN
    INAISTTDFILFPILLSLTIVKGLQFGPNVHAYLERVSTASKVALLTDKAL

    >gi|50122438|ref|YP_051605.1| thioredoxin 2 [Pectobacterium atrosepticum SCRI1043]
    MNTVCGSCQTTNRLPEERVDDHAKCGRCGETLFSGDVINATEATLDKLLQDDLPIVIDFWAPWCGPCVNFAPVFENVAQE
    RSGKIRFIKVNTEAEPALSARFRIRSIPTLMIFKQGQMVDILNGALPKAQFESWLDESL

    >gi|50122518|ref|YP_051685.1| methionine sulfoxide reductase A [Pectobacterium atrosepticum SCRI1043]
    MNSIDKTQRITQSDALPGRSTPMPVARLHVVHEHSMTHVPDHMSVAIFAMGCFWGAERLFWQQPGIYSTAAGYIGGYTPN
    PTYREVCSGQTDHAEAVRVVFDPATISYSQLLQLFWENHDPAQGMRQGGDIGSQYRSAIYTLTPEQEQAAQASLQRFQQA
    MRENSDGRAISTEIEPAGPFYYAEEDHQQYLHKNPNGYCGLGGIGVCLPPPR

    >gi|50122614|ref|YP_051781.1| hypothetical protein ECA3693 [Pectobacterium atrosepticum SCRI1043]
    MSMLRLPYQTLSAEAYQGFGIAKKALNKSSLGKQLIELVYLRVSQINGCAFCLEMHASALRADGVPDAKLDSLAGWRVSE
    QFNERERVALAWTESLVDVARSHAPDEDFEPLKAHFSDAEIADLSFAVALMSAFNRLAIGMRQ

    >gi|50122709|ref|YP_051876.1| dihydrolipoamide dehydrogenase [Pectobacterium atrosepticum SCRI1043]
    MMSTEIKAQVVVLGAGPAGYSAAFRAADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRLWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVDGENGKTTINFDNAIIAAGSRPIQLPFIPHDD
    PRVWDSTDALELKSVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETAIFPWAASGRAIASDCAEGMTKL
    IFDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|50122861|ref|YP_052028.1| alkyl hydroperoxide reductase subunit F [Pectobacterium atrosepticum SCRI1043]
    MLDNTMKVQLKAYLEKLTKPVELIATLDDSAQSAEVRTLLTEIAELSNQVSFIENNTVVEKNGQPARKPSFLITNPGSQS
    GPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLDGSFHFETYYSLS
    CHNCPDVVQALNLMAVLNPNITHTAI
    DGGVFQDEIQSRNVMGVPTIFLNGEHFSQGRTSLAEIVTKIDTGAGAKQVDKLNQRDVYDVLIIGSGPAGAAAAVYSARK
    GIRTGLVGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPGKPHQVITVSGATLK
    ARSVIIATGARWRNMNVPGEDQYRTRGVTY
    CPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADS
    VLQEKVRSLPNVDIILNAQTTEVKGDGQKVTGLSYKDRITDTVHDLPLEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDA
    KCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA

    >gi|50122862|ref|YP_052029.1| alkyl hydroperoxide reductase subunit C [Pectobacterium atrosepticum SCRI1043]
    MSVINTQVKPFKNMSFKDGQFIEVTEKNIEGKWSVFFFYPADFTFVCPTELGDVADYYDEFQQRGVEIYSVSTDTHFTHK
    AWHSTSETIGKIKYTMIGDPTGQLTRNFENMREAEGLADRGTFIVDPQGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|50123059|ref|YP_052226.1| thiosulfate sulfurtransferase [Pectobacterium atrosepticum SCRI1043]
    MEQFEAISIEQAHSRWQEGGVVVDIRDPQSFAAAHVPGATHLTNETLPDFVRGADFEAPVMVICYHGISSRNAAQYLISQ
    GFDSVYSIDGGFEAWQHRYPQDTQA

    >gi|50123132|ref|YP_052299.1| thioredoxin [Pectobacterium atrosepticum SCRI1043]
    MSDKIIHLTDDSFGTKVLQAEGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLTANL

    >gi|50123162|ref|YP_052329.1| soluble pyridine nucleotide transhydrogenase [Pectobacterium atrosepticum SCRI1043]
    MTLEHQFDYDAIIIGSGPGGEGAAMGLAKHGAKIAVIERHYNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRI
    IRSSFSDILRHADSVIGQQTRMRQGFYERNQCELFSGEASFIDAHTIAVHYPDNTHETLTAANIIIATGSRPYHPAEVDF
    NHPRIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNE
    EFDSIEGLSDGVIVNLKSGKKMKADCLLYANGRTGNTETLGLENIGLSTDSRGQLKVNSMYQTALAHIYAIGDVIGYPSL
    ASAAYDQGRLAAQAIIKGDASAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|50123272|ref|YP_052439.1| zinc/cadmium/mercury/lead-transporting ATPase [Pectobacterium atrosepticum SCRI1043]
    MHSHQHHSTEKSACCNNGVHNAPRSTAHSAKSCCNEHTQHSNHADHSCCSTKHTSDAAVQTACGTEQHSSDSGGSADSDD
    PDGGDSDRPRSHQRFSWKISGMD
    CPSCARKIENAVKNITEIEQAKVLFATEKLVVDAYSDIRPQVQHAVQQAGFTLQDTA
    LPIAPPDTSTIRRFVHEYGFLILFTLLAAASWGLSLLSERGGQIAFIATTIVGLIPILKKTVQLIRTGTPFAIETLMSVA
    SIGALLIGATTEATVILLLFMLGEHLESYAANRARRGVTALMALLPEDATVIGNGQRRLVPVASLVPGDVIEVAPGGRLP
    ADAELLNSDASFDESALTGESVPVERTPGEKIAAGSLCVDRVVQLRVVSQPGNSAIDRILQLIEDAEERRAPIERFLDKF
    SRYYTPAIMLLSLLVILVPPLLLAQPWQEWVYRGLTLLLIGCPCALVISTPAAITSGLAAATRRGALIKGGAALESLANI
    KTIAFDKTGTLTEGKPQVTNVLPVAGISETALLTRTAAVESGSHHPLAKAIVQHALSSSTFLPMAENRKALAGVGVEGTI
    GGKRIQVSAPTRVAPDLLDADWLQRIDALENEGKTVVVVQEDDTLLGLLALSDTLRHDAREALDALQQLGIRGVMLTGDN
    PRAAAAIAATLGIDYRASLLPADKVAAVSELSKQHPVAMVGDGINDAPAMKAATIGIAMGSGTDVALETADAALTHSRLT
    GLAAMISLSRATQRNIRQNITIALGLKAVFLVTSILGITGLWLAVLADSGATALVTANALRLLRKQD