Parvularcula bermudensis HTCC2503 uid51641

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|304319719|ref|YP_003853362.1| putative protein-disulfide isomerase [Parvularcula bermudensis HTCC2503]
    MGSLRHNLSVGGVMIAAVTLASPSLAQETPDVQGKVAKRFTDTAVDAVDCEGFGPLCQVIAGRTVFYVDEAVRHAFIGRV
    YDLEAKVDLTERTLAVIAPSADIEGAPAVGLRWADLPWDSAIIRNEGGALKVAVFSDLH
    CGYCQRLSAALHDAPDIEAHE
    FLVGMAQSEGPSRAIGCAEDPEAALAAYYAARSLPAGSCDRDIVAPAREAAQRIGLTGTPTFLRPDGAVTAGFRDIDTLR
    AWIAEGQAEETVQ

    >gi|304319732|ref|YP_003853375.1| hypothetical protein PB2503_00767 [Parvularcula bermudensis HTCC2503]
    MTASAREEIDSAIKSNDIMLFMKGTPQFPQCGFSSAVVQILDYLGADYGSMNVLEDQEIRQGIKDYSDWPTIPQLYVKGE
    FVGGCDIIREMFEQGELRPFLAEKGLITAEA

    >gi|304319786|ref|YP_003853429.1| bacterioferritin comigratory protein [Parvularcula bermudensis HTCC2503]
    MMSEALAHSDVVILSGPPRYSIVVIFSLLGWRITTAQALRRITNAMVVAKHPRATGMVMPSPPRKWRIIMVEIGNAAPSF
    ELPSENGNVSLSDFKGKWLVLYFYPKDDTSG
    CTKEAIGFSEQLDAFREAGAEVLGVSKDSVAKHQKFREKHDLTVPLASD
    EGGDIIDLYGVWVEKSMYGKTYMGIERATFLIDPEGVVREIWRKVRVPGHVDKVLKALTDHAG

    >gi|304319818|ref|YP_003853461.1| hypothetical protein PB2503_01202 [Parvularcula bermudensis HTCC2503]
    MLLHPGRKAPSLDIPTLKGDHWSLDRRTPDAMTIILVYRGLHCPACKEQLEKLNKMIGRFADLGAEIFALSMDSRERAQQ
    TAEEWAIDDVPLGYGLSAERATDWGLFLSTAIKEEEPAIFAEPGIFMIKPDGTLFAAYLQSVPFARPTLDDLLSGLEFVI
    DNDYPARGIER

    >gi|304319822|ref|YP_003853465.1| Glutathione peroxidase [Parvularcula bermudensis HTCC2503]
    MTDRPFDSIPLRTIAGDPLSLADFAGKVILIVNVASKCGLTPQYAALQALYEAKKDQGLVILGVPANDFAGQEPGTDEEI
    QTFCATTYDVDFPLLSKAVVTGPSKHPLYAALTDAQPVKTGDADGFRAKLRSFGSEPTEDPEVLWNFEKFLIGKEGKVIG
    RFVPTTAPDDPALISAIDAALAA

    >gi|304319925|ref|YP_003853568.1| DSBA-like thioredoxin family protein [Parvularcula bermudensis HTCC2503]
    MNRPLVKLIGLYELAIFAVTSGRQPLRPLVSTPRPQLTIDVVLDLVCPWCFIGFRGLDWAAMALSFEFDLGVRFRPYQLD
    PTTPVAGRDRESVWQEKFPDSEIRARVVSALHEAMADVGLSFALDRPDRLPNTLDAHRVVRWAGLEGGGREMVAALFEAY
    WTEGADISRHDVLAAAAETAGLGGADIEARLASDEDRADIAQEMSELRAGGVTGVPTFIVNEKAGFPGALPKAELLAALR
    QLAEETTGGEG

    >gi|304319960|ref|YP_003853603.1| hypothetical protein PB2503_01917 [Parvularcula bermudensis HTCC2503]
    MMIMNQLTRRSVLLGGSAALTVACTGRDSKAQEAAMSPSSPSEINDDTDWAELSEAAWKDRLTAEEFRVLRKEGTERAGT
    SPLNAEKREGTYVCAGCALPLFLSSHKFESGTGWPSFFDVIDGAVDTKTDFKLIVPRTEYHCSRCGGHQGHVFKDGPQPT
    GLRY
    CNNGVALDFVPAESA

    >gi|304319999|ref|YP_003853642.1| twin-arginine translocation signal domain protein [Parvularcula bermudensis HTCC2503]
    MYRLVGVWVVLLAGVLSGCGGGAQENATAEGETSASQSQTLAAPEGSLAGATMALGSEEAPLTIIEYASVTCPACAAFHA
    QYFPEIKEKYIDTGKVRFIYREFPTAPQNLAYAGFYTARCAATDRGPVAYFAMLDTLYARQREWAYGDNPGDVLENIAAQ
    AGIDRQELETCFRREDIRSAVKANVLEGVEAHGVNSTPTFIVDDEELDWNRGSETMSEAIERALAARQG

    >gi|304320040|ref|YP_003853683.1| thiol:disulfide interchange protein DsbE [Parvularcula bermudensis HTCC2503]
    MVNERHRVLSASGLSPLGRIALGEESRHIGVMKRLILILPLIAFAGLAFYLLPGLKLDPSAPPSALEGKEIPELVLTKMP
    GRASFTEKDLTGQVTLVNVFGSW
    CAPCKVEHPLLVTISQEGKVPIYGINWLDTPERGAAWLDTEGDPYTKVGNDQGGRTV
    IALGVTGAPETFVIDKQGRIRHRHAGPITTHTWEQTFEPLIASLQLEE

    >gi|304320181|ref|YP_003853824.1| thioredoxin [Parvularcula bermudensis HTCC2503]
    MATKTVTDASFEQDVLKGTGLVLVDFWATWCGPCRQIAPALEEIADEMGDDLTVAKLDIDENPTTMMQYGVRGVPTLMLF
    KEGQLVSTKVGADAKGAILAWVKETASAA

    >gi|304320233|ref|YP_003853876.1| hypothetical protein PB2503_03292 [Parvularcula bermudensis HTCC2503]
    MLTAFALSALALLAGPRIGETAPDFTARTTTGETITLSDLSDKRVILEWSNHLCPFVQKHYSSGNMQTLQKRSRADDTVW
    ITVVSSAPGKQGFVTAEEANALTKSRGANPSYVILDSEGDIGRLYEAKTTPHMFVIAAGEQQALRYAGAIDSIPSADKND
    LARADNYVEQAMRSLDNDRQIVVPQTKPYGCSVKYGD

    >gi|304320234|ref|YP_003853877.1| thio:disulfide interchange protein [Parvularcula bermudensis HTCC2503]
    MFTLHLSALFPLVPVLILRRLLGAVGLIFLWAGLASGALAQSSETVRSGHAASRLVAGQTAGVPGETMTLALIQDLDAHW
    HVYWRNPGDSGLPLRLTWQVPDGFVAGEPAYPLPQRLPVPPLVNYGHEGRVVFLIPFRIPEAAIPGTTVDITVKADFLIC
    KIQCVPETATLTLPLPIAAMSTGGVEAAVTIERARRALPQPAPFDAAYYDGDRGPVLVMEGAPMGQATFFPYAPSLIEPA
    GEVYRASRNGRDYYGFEAGFAYRARLPESLSGVVVIEGENGRRGYRISATQLAPPEDPPRLTPPHTTLSEGGQAGDTSDQ
    MVSAAPSLADAPGRPSLLAGMVLGLLGGVVLNLMPCVFPIVFLKALGFAALSREERPTIRRHGLLYTAGVLTTFGGLAAL
    LFGLRAAGEGLGWGFHLQSPLAVGIFAVILFLVALNLLGVYEMGTSVQGTGDQLTKKPGAAGAFFTGVLAVAVAAPCIGP
    FLGGATGLALAADPVIGLVIFLSIGLGLALPYLGLSFVPKAVRVLPRPGPWMVILRQLFSFALFAALVWLIWLLSVQTGP
    TGVLLLGLALLASGLAAYLFGLSQSQTHAGSRWRALAAFSALLAVVPLARIPAVSAAPASGGAETMTAIPWSPDTVAGLI
    AEGRPVFVDFTAAW
    CITCQVNKLTVLDTARVKSAFAAANVAYVVADWTRADPQITAELERLGLGGIPVYLYYDQRGESRM
    LPQILSVDLVVATVAAPGT

    >gi|304320258|ref|YP_003853901.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Malallergen [Parvularcula bermudensis HTCC2503]
    MGGMPRVIDDLNIAEGTGARIDEAAPLFEAQSTAGLVRLADYRGQWVMLFAHPADFTPVCTSEFVALARAQASFDRLGCA
    LIGLSIDSVYAHLAWVERIEADFGVRPTFPLIEDPSLAIARAYGMIHPGASSTTVVRSVFVIDPAGIVRASSTYPMSVGR
    SVSELLRLVEALQVTDGGGGVAPEGWESGEPLLDPAPRTSDDLSGLNNSLWYAGGTK

    >gi|304320323|ref|YP_003853966.1| thioredoxin [Parvularcula bermudensis HTCC2503]
    MTDPIAPAAQNNALIKDATIETFQADVLQASMSVPVVVDFWASWCGPCRQLGPLLEAQITARGGKILMVKVDTDQNQLLA
    QQLRIQSLPTVMAFVGGQPVDGFQGALPDSQIGQFLDRVEQIAAQAGLGGGQGETDPEAMLDDAEALLDQGDVATAMQIF
    AGVADATEAGSDAQARALAGLARCALSAGNKDQASDMLKAIPEEKQSLPAVSRAQALLELGGNAPDSAALTAARDRAQQS
    PEDPAALFALGEAEIDNGSVDAGMDALLKSIALDKDWDEGAARQKLLKLFDALPPTHPSVKTGRRRLSSLLFA

    >gi|304320487|ref|YP_003854130.1| molybdenum cofactor biosynthesis protein MoeB [Parvularcula bermudensis HTCC2503]
    MSFSAEERERYKRHLLLPEIGGQGQQKLKAARVTMVGVGGLGCPILAYLAAAGVGTLRLIDGDHVELSNLQRQILFEIGD
    LGQLKVDAAARRLRALNPEISIEPHPIMLTEATADRLLSQSDLIIEGLDRFAPRYLVNRAARRARIPLLSAALGRFDGQI
    LSLRSAPEGPCYRCLVPRPPEDEAL
    CETQGVLGVTAGVVGTLTALEAIKHLLSLRGELIDELLILDTLGGVTRRARLRAD
    PACPDCGAPAIS

    >gi|304320527|ref|YP_003854170.1| dihydrolipoamide dehydrogenase [Parvularcula bermudensis HTCC2503]
    MTPRHPVYVLDGNHFAGRIMGPDLHCDVAIIGAGTAGISAERSARRQGAQTLLIDPHFAGTVCARIGCMPSKLLIAAAQA
    AHGARTAGPFGIRGGEVRVDGAAVMRRVRALRDEFVAGVKDSFEALPDGTTVKAAAHFTGPNYMTLDDGRRLSARAFVLA
    TGSHPAVPDAFAALGDRLETNQTIFERETLPESLAVVGGGPLGLELAQAMARLGVEVTVLEASDRLAGIADRQLATNFYD
    RLSTEMTIHLKAEVTPRRVDDGVVLEWAGGSLKAERVLLAIGRPPSLEGLHLAAAGLTLKENGVPDYDPRTLRCGKSAIF
    IAGDMTGERPLLHEASAEGTIAGANAADPDHTAPSHRLVPFSMAFTHPGVVSIGEVADRADARTVVGYADFGTQGRARVE
    NLNVGGALLYAEPQTGRLIGALLVAPMAEHLGHLLAWAIEAGETAPTLLDRPFYHPTYEEGLKSALRDICQALENGVPKD
    RDDWDRPGDHSDG

    >gi|304320560|ref|YP_003854203.1| osmotically inducible protein OsmC [Parvularcula bermudensis HTCC2503]
    MSKSQGSAVWNGDLKTGTGMMNTESGALSNARYGFNSRFTGGEGSNPEEVIGAAHAGCFSMALSLELGERGVTADSIHTT
    STVFLDEVDGGFAVTRSHLNVTVKAPGADKAKMQEATESAKVN
    CPISKLLKADITMDATYEV

    >gi|304320564|ref|YP_003854207.1| putative arsenate reductase [Parvularcula bermudensis HTCC2503]
    MAMIVIYHNSRCGTSRVTLSLIKSTGADPVIVDYLKAGWTEGHLLGLFAAAGLTPREALRAKEAKAKELGLHEEGVPAAD
    ILAAMVAHPVLVNRPFVCTKKGVRLCRPSETVLTLLDGPFKGPVTRENGEMLIDGDGRPVV

    >gi|304320626|ref|YP_003854269.1| putative methylated-DNA--protein-cysteine methyltransferase [Parvularcula bermudensis HTCC2503]
    METDPDTLYDALLARDHGYEGRAWVGVQTTGIFCRFDCPARKPKRENVTFFDSVAACLDAGFRPCKRCCPLEPSTVQDPV
    VQTLLAALQADPLHRWTEDDLRARGIDPSTARRAFRRAFGATFLEIARLRRLRAGVEARAQGARVIDAQLEAGFESASGF
    REAFSRLMGRAPGTLSGAERLKADFIDTPLGPMIVVADEAQVWLLEFAGRKALATELKAVQREAKDPIGLGRTQATAHLA
    EDLARYFEGGSPSFTVPTAPYGSAFSNAVWAALRQIPPGTTCSYKDLAKAIDRPEAVRAVARANGANRLALIVP
    CHRVIG
    ADGGLGGYGGGVWRKRWLIAHEREAGRGVAA

    >gi|304320816|ref|YP_003854459.1| AhpD, alkyl hydroperoxide reductase D [Parvularcula bermudensis HTCC2503]
    MSIEALRDQLPDYAKDIRLNLGSLAADGPLNDQQKWGTFVASALASRHEGTIKAIVAEAEGKLSEEAMTAAKAAATIMGM
    NNVYYRFVHLVSEKTYSTMPANLRMTVIGKPGVDKIDFELWCLAVSAINGCGM
    CIDSHDAVVRKSGITTEQVQTAVRIAS
    VVHAAAATLDGEAALS

    >gi|304320817|ref|YP_003854460.1| AhpC, alkyl hydroperoxide reductase C [Parvularcula bermudensis HTCC2503]
    MLGIGDKLPEFKVVGVKPGFNNIEEGGESAFEDLTQDSFSGKWKVIYFYPKDFTFVCPTEIAEFGRLAKEFEDRDAVVLG
    GSTDNEFCKLAWRRDHPDLDKHPAWQFADTLGHLVDGLGIRSDEGVALRATFIVDPHNVIQHVYVNNLSVGRNPQDTLRV
    LDALQTDELCPCNRPLGGDTL

    >gi|304320986|ref|YP_003854629.1| hypothetical protein PB2503_07107 [Parvularcula bermudensis HTCC2503]
    MMADGTDMPQIVLTDRAASRIATILAKEAEGAMLRIAVLGGGCSGFQYDFQITDKAEGDDLVLEKAGATVLIDKISQEYM
    PGAVIDYAEELIGAAFKIDNPLATANCGCGTSFSI

    >gi|304321017|ref|YP_003854660.1| methionine sulfoxide reductase A [Parvularcula bermudensis HTCC2503]
    MTSDTATRTERALLAGGCFWGMQDLLRKVPGVLRTRVGYTGGAYDNPTYNDVKTGRTGHAEAIEIIFDPDVVSYEKMLHW
    FFKIHDPTTRNRQGNDIGPQYRSAIWFTSDAQKATAEAVMADVDRSGKWPGPLVTELAPAGVFTEAEAEHQDYLERYPHG
    YTCHFVRPDWHLDAA

    >gi|304321199|ref|YP_003854842.1| thioredoxin reductase [Parvularcula bermudensis HTCC2503]
    MADRLHTKLLIIGSGPAGYTAAIYAARAMLEPVIVHGLQPGGQLTITTDVENYPGFADPIQGPWLMEQMQKQAENVGTKM
    VSDIITEVDTASRPFSFKGDSGTIYTADAVIVATGAQAKWLGLPSEKKFQGFGVSA
    CATCDGFFYRGRTVGVVGGGNTAV
    EEALFLTNFADKVYLIHRRDSLRCEAILRQRALDHPKIELLWNRQVDEVLGSDNPLGVEGVRLASTVGEDSMELAIHGLF
    IAIGHAPATQIFEGHLEMKPNGYIVTAPDSTATSVPGVYAAGDVTDETYRQAVTAAGMGCMAALEAEKFLAGMAIAEAAE


    >gi|304321263|ref|YP_003854906.1| putative glutathione reductase [Parvularcula bermudensis HTCC2503]
    MAYDYDLFVIGAGSGGVRAANRSAKFGAKVAIAEQADVGGTCVIRGCVPKKLMVYASEFNDMIGDAAGYGWEIPDARFDW
    ATLRDRIQTELGRLSSLYIKGLEGNGVTLFQCRAIVKDPHTVHLASENRDVTAEKILVAAGGVPFRDDEADPDRLGIVSD
    DVFHLDKRPDRLVVAGGGYIAIEFAHIFARLGTEVTLVYRGHRLLRAFDREISERVEQDLIASGIRYIPNTIFARIDRDG
    DDKTVELTTGEVLRTDEILWAIGRRPRTSGLGLEDCGVEKTANGAVIVDQDYRTACPSIFSLGDVTDRINLTPVAIREAM
    AFASTQFGGEPKRMDYRHVPKAVFCQPPVGSVGMTEDECLDEGHRIDVFEADFRPMKNVLAGNDKRMLMKLIVDAETDRV
    LGCHMVGEAAPEMVQIAAIAVKAGLTKAQFDETCALHPTSAEELVTLSSSRPGKAST

    >gi|304321311|ref|YP_003854954.1| hypothetical protein PB2503_08784 [Parvularcula bermudensis HTCC2503]
    MSIRPIRTTFTGATGAQLSARIDLPAGTIEGFALFAHCFTCSKDIFAARNIAQALTAQGIGVMRFDFTGLGESEGEFGRT
    SFSLNLDDLTRAADFLREAYQAPSLLIGHSLGGAAVLAVRPRIPEVKAVVTINAPASVEHVAGHFGDKLATIIAEGQADV
    SLADRVFTIEKQFVDDLGRHDIPAAAAALDAALLVMHSPIDQVVGIDNATDLFIAAKHPKSFVSLDQADHLLSQKADSAY
    VAGVIAAWARRYLPKAPAKDEKTAAANNVVVKETALGQFQCFVQVGAHRLIADEPTAMGGLDSGPSPYDFLATALGT
    CTV
    MTLRMYAERKQLPLERASCVVSHAKVHAKEADPDEGPMQKIDEFTRRIRLDGDLSDEARGRLLEIADKCPVHRTLEAGAR
    VKTEEDR

    >gi|304321326|ref|YP_003854969.1| dihydrolipoamide dehydrogenase [Parvularcula bermudensis HTCC2503]
    MGENTYDVVVIGGGPGGYVAAIRARQLGLSVALVEKEHLGGVCLNWGCIPTKALLRTAEIYTAMSHAAAYGLKADNIGFD
    LDAVVKRSRKIAGQLSSGVRYLMKKNDVTVYNGTARFVSAGDGAAVLHITDNEGGGEEIRGTHTIIATGARARTVPQAGL
    APDGDKVWTAKEAMVPDQFPDRLLVVGSGAIGIEFASFYNALGAEVTVVERLDRILPVEDEEVSAFARKSFEGRGMRIHT
    GANVTGLEKSDAAVTVSLQTKDGDTVTETVDRVIVAIGIIGNTEDIGLEDIGVEVANGHIVVDPYLRTSVEGVYAIGDVV
    GPPWLAHKASHEGIICVEALAGEEEVHALDVSAIPGCTYCQPQIASIGLTEAKAREEGYDIKVGKFPFQGNGKAIALGEP
    EGFVKTIFDSVTGELLGAHLVGAEVTELIQGFGIAKTLEATEQELFHTVFPHPTLSEMMHESALDAFDRVIHT

    >gi|304321339|ref|YP_003854982.1| 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase [Parvularcula bermudensis HTCC2503]
    MSQSFDVVVIGGGPGGYNAAIRAAQLGLSVACIEKRPSGRFGGTCLNVGCIPSKAMLHASEAYAHAKSHLKELGVKVSGV
    ELDLPAMLGQKDDAVQGLTDGIAYLFKKNKVTGLKGHGRIEGPGKVILTDEDGKEEPLSASTIVIATGSSVMSLPNVEID
    EDVIVSSTGALELKKVPDHMVVVGGGYIGLEMGSVWRRLGAKVTVVEYLDRITPGMDGEVSKQFMRILKKQGMEFKLGTK
    VTGIEKTKQGATLSLEPAAGGEKETLEADVVLIAIGRKPHTEGLGLDTVGIKTNDRGFIPVDDHYQTGVDGIYAIGDVTP
    GPMLAHKAEDEAVAVAEIIAGKGGHVNYDVIPGVVYTDPEVAMVGKTEEQLKDEGVAYKVGKFPFTANSRAKTNHETDGF
    VKVLADAETDKVLGVHMIGTGVGEMIAEACLVMEFGGSSEDIARTCHPHPTRTEALRQAAMGVEGWTMQA

    >gi|304321376|ref|YP_003855019.1| hypothetical protein PB2503_09119 [Parvularcula bermudensis HTCC2503]
    MNQELVRDYYGKTLQASEDLKTDACCTVEDIPRWHKELLSNISDEVMAKYYGCGLIAPLALEGARILDLGSGSGRDVYAL
    AQMVGATGEVIGVDMTDEQLAVAEAGKDWHAEKFGFRNVSFYKGTLETLDQIGLAPGRFDVIVSNCVINLCTDKLAVLRH
    VKSLLKPGGEFYFSDVYADRRLSDAVRNDPVLYGE
    CLGGALYWNDFISMAKAAGFADPRLCTSRPLTVENDVLQDRLGQA
    RFWSATYRLFNLEGLEPACEDYGQAVIYRGTVKHAPDVFVLDDHHRIETGKMFPV
    CGNTYDMLALSRFAEHFEFFGNRNT
    HYGIFPDCGTPVPFSAEEAAEGSGGCC

    >gi|304321508|ref|YP_003855151.1| hypothetical protein PB2503_09784 [Parvularcula bermudensis HTCC2503]
    MVMLVRPTQPLLAVLGAVVLSASCSAQSPEEADSPSPASQVTVDADFAAKVEAYLLENPEIIIESVERYRIDQERLAAAM
    AQESARDLVPALLTTQAGHIMPAEGEAEVIVVEFFDYN
    CGFCRRATDFVFTLKEETPEMTLVLQELPVTHPDSRGSAKVA
    LNYAGTADYVPLHRALMGESGVIDAQRALDIAHSLDLATPSSTGEDGSAATDSFDEPLDQSLSIAEQLGVDGTPAFLIAS
    PDGSFVRTVSGFDPDAVRTAIATALETNG

    >gi|304321538|ref|YP_003855181.1| HesB/YadR/YfhF [Parvularcula bermudensis HTCC2503]
    MPRPRPKALTLTDAAAERMREIMAAADDAFIGVKIGVKNGGCAGMEYTMDYATDRAPLDEVVEDRGITILIDPKAILFLL
    GTEVDYVTEKLSSRFVFNNPNQTDACGCGESVTIVPARNEA

    >gi|304321608|ref|YP_003855251.1| putative peptide methionine sulfoxide reductase protein [Parvularcula bermudensis HTCC2503]
    MPETFSPPQSKNDQAANLPCPRLDVRRPAMSILSFRPLLVSSLFLLGACSNTDAPSTSTGGPSAETIPGTAESLVVAGGC
    FWCVEHDMEAVPGVYEAVSGYGGGEKREATYRDHEGHREVVEIYYDPRETTYAELVHIFLRTIDPLDDGGQFCDRGYSYT
    TAIHYRTDAERRAAEAAIAAAEKALSREIVTPVEPISFVVEAEGYHQDYADQNPLRYKFYRTRCGRDQRVEEVWGQRAAS
    AP

    >gi|304321870|ref|YP_003855513.1| hypothetical protein PB2503_11629 [Parvularcula bermudensis HTCC2503]
    MVADPTPFTPGTALLGGILIGVSSTLLMASLGRIAGISGIVGAALGPAGADRQWRRAFLLGLLLPGAVLSLASARPAIDF
    TAGPMTLLIAGLLVGFGTRLGSG
    CTSGHGVCGLARLSPRSLVAVLTFMAAGALTVLVLRHLMGGAQ

    >gi|304322004|ref|YP_003855647.1| copper/silver efflux P-type ATPase [Parvularcula bermudensis HTCC2503]
    MTNDTSHAHSGHACHHNDQAAPEKPDDAYDKVPIGYAGTVWTCPMHPQVRETANTGCPICGMALEPETVTAEQDTSELDD
    MTRRFWVALVFSAPLLAFVMGEMIPGSPLRHWIDPTWSVWLQALIATPVVVWAGWPFFVRGWQSVKRRNLNMFTLIAMGV
    GVAYIYSLVATFAPGIFPDSFRGHGGAVAVYYEAAAVIVTLVLLGQVLELRARNATSGAIRALLELAPATARRIADDGSE
    QDVDLADVKSGDKLRVRPGEKIPVDGEVVDGHGSVDESMVTGEPLPVEKTIGARVTGGTVNGTGSLVMKATHVGEDTLLS
    QIVRMVAAAQRSRAPIQRLADLVAAWFVPAVIGIAILTFVVWAVFGPDPAMAFAIVNAVAVLIIACPCALGLATPMSIMV
    GTGKGASNGILIKNAEALETLEKVDTIVVDKTGTLTLGRPELVRVQPGEGFDEASLLSLVAAVERLSEHPLADAIVRGAK
    GKGAPHKDAHGFESVTGEGAQASVDGQTVAIGNRKMMQRIGGWSDDLGTRADQYRTEGQTVMFAAVDGKPAGIVSVADPI
    KETTPEAIRRLHAEGLKIVMLTGDNETTARAVADKVGIDEVHADVSPEDKHRIVSELQKNGARVAMCGDGINDAPALAQA
    DVGIAMGTGTDVAMESAGVTLVKGDLIGVAKARELSHATMRNIRQNLFFAFFYNTLGVPVAAGILYPFFGLLLSPMIAAA
    AMSFSSVSVIGNALRLRTLKL

    >gi|304322009|ref|YP_003855652.1| hydrolase [Parvularcula bermudensis HTCC2503]
    MRLEKIKTQGLAHLSYFLSADGEAAVIDPRRDIDIYLDLAREEGSVIKHVFETHRNEDLLSGAPVLKEETGAKVWHGPNP
    EKPIQYAAETREGDTFEIGGALLKVLETPGHTEDSLSYVLYDKSFEEGPVGVFTGDALFIGDVGRTDFYPDRKREVAGLL
    YDSLEKLLGLGDQCLVYPAHGAGSVCGSGMADREFSSIGHEKLNNPRLQIGDREAFIDAKVAENHYIPPYFRRMEEGNME
    GTEAAPPAPRPASPARLLDPGDAVCLDVRGIFDFAGGHRTGSLCIPDDMLAAFAGWLLPGDKPVLLVARDDDQAVDAATT
    LQRIGFDNVSGFVSGAMPVAVQNGPLDTLDFVDTETVAARVDNPPAGWTLLDVRAIDEYESGHIKDSKHAYVGKLPDAAS
    DLDPDKPVTTM
    CGSGARATIAASQLMRKGFSNVDVYIGSMKAWSAAGNAIE

    >gi|304322019|ref|YP_003855662.1| mercuric reductase [Parvularcula bermudensis HTCC2503]
    MNQTVKTGDCCSVNKNGDDSYDLIVIGAGSAGFSASISAAEAGRRVAMVGHGTIGGTCVNVGCVPSKAMIRAGEAVHAGT
    AAARFPGIEPCAHSVDWSAVVKGTADLVDEMRQKKYIDLLPSYEYVTYIEEGAARLVEGGIEVGGRIIAAPKVLIATGSR
    PFLPEIDGIETVEALDSWDLLSLPDQPESILVLGGGYIGCELAQMASRLGVKVTLVTRSRLLPGVEPEVAKALTDALKAE
    GVAVETGLSYRSVRRSDGGVTLTIERGGKPVTLSAQRLVATTGRVANSEDLGLREFGIETDARGSIKVGADMATTRPGVW
    AAGDVTDRDQFVYMAAYGAKVAVNNALGLQDLRYDNAAMPWVVFTDPQVAGVGLSEVQAKAAGHDVKTSVLTLDHVARAA
    AARDTRGVIKLVADAKTDRLLGGQIAAPEGSDAIQTLAMALKFGMTSKALGETIFPYLTTVEGLKLAAQTFDKDVAKLSC
    CAG

    >gi|304322020|ref|YP_003855663.1| regulatory protein [Parvularcula bermudensis HTCC2503]
    MKDAYDLIVIGGGTGGNGVARMAAKAGWNVASIDSLPYGGTCALRGCDPKKMLVAVTEGVDWADRMKGNGLKMQPSVDWP
    EMIAFKRTFTDAMPPRIEAGMEKAGIDVLHGEARFTGADSIELNGEILRAKHFHIATGARPITLNIPGEAYLTTSTEFLE
    LTERPDRIAFVGGGFIAMEFAHIARRAGASEVTVLEMAERPLGTFDDDLVEILVEGTEELGIDLRTKAKVLAIEKQGEEF
    IVTVEGAGGAETLTCDLVVHGTGRVPNIDGLNLEAAGVEYTRRGIQVNASMRTSNPAVFAAGDCADSGPNLTPVSAFEGR
    VAGKNLLAGKDERQVKYPPIPSVVFTLPMVATVGLSEAAARKQGLKFDIHFEKTHDWYSSMRVGAKRTAYKVLVEQDTGK
    ILGAHLIGPGAEEQINLFAMAMRAGQTANQIKAMIFAYPSYASDIGSMV

    >gi|304322022|ref|YP_003855665.1| Mercuric transport protein periplasmic component [Parvularcula bermudensis HTCC2503]
    MKRTWMIAGLAGLALAGGLAVAGAQNAPDASVEVEQATARFTIGNMTCATCPIAVRKAMMRVEGVKSVDIDYAARTAEVV
    YDTAATTPVLIAAASTDVGYPASVTDG

    >gi|304322023|ref|YP_003855666.1| putative mercuric transport protein [Parvularcula bermudensis HTCC2503]
    MLGAFLASSCCIVPLVLISLGVSGAWIGQLTALEPYKPLFLLVAIGFLAAGFWDVYFRKTSVCEDGSYCARPQSSVVKQV
    ALWSGALVVLAALTIDVWAPLFY

    >gi|304322116|ref|YP_003855759.1| glutaredoxin 3 [Parvularcula bermudensis HTCC2503]
    MSDMQSVIMYTTPMCPYCARARRLLEEKGATIEEKRAGLNVDLKNEMIEKSGGARTFPQIFIGDTHVGGCDDLMALNEEG
    KLDRQLAGDR

    >gi|304322169|ref|YP_003855812.1| putative mercuric reductase protein [Parvularcula bermudensis HTCC2503]
    MTKLLKTDLCIIGAGSGGLSVAAGAAQLGRDVVLIERHKMGGDCLNFGCVPSKALLAAGAVAQTIRTASKFGIKAADPLI
    DYGAVHDHVHGVIAAIEPNDSQDRFEALGCTVLREDARFTGRREVTAGDTVVRAKHFVIATGSAPFVPPIEGLKTVPYLT
    NETLFDLKECPDHLIVVGGGPIGIEMAQAHRRLGAKVTVLERGGDILPKDDPELVAILAEELRGEGLTLETQTEVHEVAK
    GAEGHIIVKGAKAGAPYEVTGSHLLIAVGRQPPLASLDLQTAGVATHPKGITVDQFMRTSNPRIYAIGDCTGGRQFTHVA
    GYHASLVVQNILFKTPRLTFGIKGGKNHEEEAPWVTYTDPELAHVGLTAQMAEARGESYSTALWDYEENDRAQAERATRG
    KIKVVIGKGGRLLGASIVGKKAGDLIGPWQLAVANGLKIGAFTKAIMPYPTLSEVSKRAAGAYYTPSLFSDRTRMLVRLL
    ASFD