Aster yellows witches broom phytoplasma AYWB uid58297

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|85057419|ref|YP_456335.1| dihydrolipoamide dehydrogenase [Aster yellows witches'-broom phytoplasma AYWB]
    MKNYDVLVIGGGPGGYVAAIKAAQIGAKVALVEKHKLGGICLNYGCIPTKAYLKSAKIYKDIKRCSDFGIKVQNGISFDW
    SSILSRKNKIVAQLTTGISFLLKKNKIDFYHGFASVLSPCEVQVETNLLYTKKLIIATGSTAFVPPIPGAQEAYQKGILK
    TSKELLKLESYPSKVTIVGGGVIGVEFATIFNSFGSEVTILERKDTILNGMDQDVVVAYTKKLQADGIQIMTQVEVNKIN
    ENRTTYTQKGTDKTITSDVILMAVGTKANLAGLEKLNLVLNRNSVQTDNFCQTSIPGVYAIGDVNGKYMLAHVASHEGIV
    AATHALEQKVNPINYDRVPACIYGFPEIASIGMTEQQAKDKQIDYKVSKISLGAVGKSLAEGEKEGFAKLIVCKKHLEIL
    GMHIYAYNATELISEMAVGMELEGTAYELSQAIHPHPTLSELTFEALLGAVDKPIHS

    >gi|85057604|ref|YP_456520.1| NADH oxidase H2O2-forming [Aster yellows witches'-broom phytoplasma AYWB]
    MKVIVVGCTHAGTAAVKTIKKNNPQADVVVYERNDNISFLSCGIALYVGGVIKDSLGLFYSNPDELVSMDVCTKLKHEVL
    KLDFDKKEVLVQSLETGKQFKEKYDKLVIATGSWPVIPPIKGIDCKNVLMSKNFDHAKDIINYSKNVNKITIVGAGYIGI
    ELAESFAVQKKEVVLVDAEDRIMFKYLDKEFTDVAQKTLTDHGVTLALGQKIAGFKTKDGLVTHVKTDKNTFETEMVIMC
    ISFKPNTQLFAHHLETSFNGALVVNEYMQTSDPDVYACGDCVNVYYNPTQEVKYMPLATNAIRMGTLVGLNIKKPCIKYL
    GTQGTSGIKIIDLSISSTGITENVAKNLGKNYGTVTIKDANRPEFMPDYDAVMLKLVFDKDTRKILGGQIVSRVDLTEKM
    NTLSVCIQNQMTVEQLAFVDFFFQPHFNKPWGLLNLAGLKALEVKSQ

    >gi|85057707|ref|YP_456623.1| hypothetical protein AYWB_427 [Aster yellows witches'-broom phytoplasma AYWB]
    MIIFKTIAYFNPHLDDLCFFEEKEGITKKLVSALEPSNKQSGPVDLFCLCWAICFYKTSKKILAEQDYTNKDLKVKVTLE
    MQKDDKGFYFKPTAILGIQDMTLEQTEIIANATHKR
    CPISRLISADENVSVKVVNYNELITE

    >gi|85057765|ref|YP_456681.1| thioredoxin [Aster yellows witches'-broom phytoplasma AYWB]
    MMSNLMNYQGQDFETITATPQLVVVDFFATWCPPCQRLLPVLEEVCTLEQDILFYKVDVDFFRQLALEKDVSGFPTLILY
    KNKKELARHSGFLNKEDLLKFLHSYK

    >gi|85057910|ref|YP_456826.1| hypothetical protein AYWB_630 [Aster yellows witches'-broom phytoplasma AYWB]
    MHAISIEKRHNYFMTKTSNSSYLVILYYQYVPIKDPQTFRNQHFKYCESLGLLGRIIVAQEGINGTLSGPKEQIHKYIDQ
    LKQDVRFCNTVFKIENVDAQVFPRLSIKVKPELVNLSLEEKVDLTKDKGAYLAPQEFLQALQEKDVLILDARNDYEYDLG
    HFRNAVNPNIRHFRDLPNWVKQNTHLLKNKKIVTY
    CTGGVRCEKFSTFLKKEGFVDVYQLEGGIISYGKHPETQGVLWDG
    QMYVFDQRIAVTVNQKEHVIVGKDYFDGTPCERYINCSNPQCNKQILCHEHNEHKYLGACSDKCSAHPQNRYLKKHNNKT
    S