Parvibaculum lavamentivorans DS 1 uid58739

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|154250499|ref|YP_001411323.1| methylated-DNA--protein-cysteine methyltransferase [Parvibaculum lavamentivorans DS-1]
    MKLPDDTSLATDILDTPIGRLRLAATEAGLAMVVFPNQKDIGFPKRDGSATARKHLAAGLKALDRYFEGKQKSFSEIVLA
    PSGTAFQMSVWQALARIPFGETRSYADIAREIGNPKGMRAVGLANGRNPIPVIVP
    CHRVIGANGALTGFGGGLPTKKWLL
    DFEGIGTARLI

    >gi|154250505|ref|YP_001411329.1| OsmC family protein [Parvibaculum lavamentivorans DS-1]
    MAIRSTKVVFNGAQGDELAALLDLPASAPKAYAVFAHCFTCSKDIFAAQRIAGALAERGIGVLRFDFTGLGMSGGEFANT
    NFSSNIADLLQAVDFLRREYEAPSILIGHSLGGAAVLAAAGEVPEAKAVATIGAPADTEHVIHNFHADLSRIEETGEAEV
    TLAGRTFSIRKQFLDDVRAQNIAARVASLRKALLIFHAPLDQTVGIENAARIFDAAKHPKSFVSLDTASHLLAKRSDALY
    VAEVLGAWATRYIGASEEARDADSTEDVTVSETGKGKFQQRVSSGPHRLIADEPESYGGMGSGPTPYDFLSIALGA
    CTSM
    TLRMYADRKGLDLGRISVTVEHDKVHAKDCKECAEGRDGHVDRFQRTIHIEGGADPALREKIVEIAGKCPVHRTLERGAA
    VVTKLA

    >gi|154250589|ref|YP_001411413.1| alkylhydroperoxidase [Parvibaculum lavamentivorans DS-1]
    MSSHLTPRMNPWKASPAAYKPLLELQAYTDKCGLEHSLLELVKTRASQINGCAFCLEMHTREARAAGESEARLYLLNAWH
    ESPLYTDRERAALEWTEAVTLISETGIPDTAWEAVRKEFSDQEIVDLTVAIGMINVWNRLAVGFRTLHPVTEEQQRKAG

    >gi|154250595|ref|YP_001411419.1| thioredoxin [Parvibaculum lavamentivorans DS-1]
    MATNKVTDASFEADVLDAAGPVLVDFWAEWCGPCKQIGPALEEIAKDYGGKLTIAKINIDENPNVPTKYGVRGIPTLMIF
    KDGQVAATKVGALPKGKIVEWIDNSL

    >gi|154250726|ref|YP_001411550.1| glutathione peroxidase [Parvibaculum lavamentivorans DS-1]
    MSAYEFEFRTIKGEALPLSRFSGKPILIVNTASRCGFTPQYRELEGLWERYRARGLTIIGVPSNDFGAQEPGTEEEIVEF
    CEVNYSITFPLTAKQQVVGAEAHPFYLWVSEVAGEDARPRWNFHKYLVGPDGALAGIYPSKVSPLDKILVDEIERLLA

    >gi|154250760|ref|YP_001411584.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Parvibaculum lavamentivorans DS-1]
    MAKRIKADICVIGAGSGGLSVAAGAAQMGARTVLIERDAMGGDCLNTGCVPSKALLAAAKQAYGMGAGEPFGIAPAKAQV
    DFGKVQDHVHSVIAAIAPNDSVARFEALGVTVIKDHGRFRDASTVIAGNAEITARRFVVATGSRAAVPPIPGLDKVPFYT
    NENLFENRDCPSHLIIVGGGPIGMEMAQAHCRLGARVTVLEGQRAFTRDDPELSAIVIDRLRRDGVEILEGVKVLSVSGE
    AGKISVTIEDKDETRTIEGSHILIATGRRANVEGLDLEKAGIEYDARGLKLDDRLRTTNKRVFGVGDVAGGLQFTHVAGY
    HAGIVIRNALFRVPARADHSAVPWVTFTDPELAHVGETEASARDRNMKINVLRWHLGENDRAQAERQTEGVIKVITDTHA
    RVLGATIVGPHAGELILPWVLAKSQALKLSAMASVIAPYPTLSEISKRVAGSYYTPTLFSPKTRMLVRFLGLFG

    >gi|154250812|ref|YP_001411636.1| rhodanese domain-containing protein [Parvibaculum lavamentivorans DS-1]
    MATCFGELDTFEPVSRAELKRCLRNDSVLVLDVRPRDEFEAGHMPGAVNVPPSELDARLSSLPVDREILVYCRGPYCVLA
    FEAVALLRAGGFHVRRLEDRFPEWKAVGLKVEAA

    >gi|154250841|ref|YP_001411665.1| heavy metal translocating P-type ATPase [Parvibaculum lavamentivorans DS-1]
    MNTENAPASCCHTHGHAHAHTPKPAAPGSKYTCPMHPEIVADGPGSCPICGMALEPMTVSRDKPENEELKDMTRRFWVAA
    ILAAPLFAMEMGSHLLGLHIPLSPAASGWLQLALATPVVLWAGWPFFVRGLASLRTMNLNMFTLIAMGTGAAYVYSLAAI
    LAPGIFPPAFRDAHGAVPLYFEAAAIITVLVLLGQVLELRARERTGDALRALLDLAPRTARRVVNGADEEVPLEEIAKGD
    TLRVRPGERVPVDGELIEGRSAVDESMITGEPLPVEKEPGARLIAGTLNGSGSFLMRAEGIGEETMLARIVALVAEAGRS
    RAPIQGLADKVAAIFVPAVIAVAILAFAAWSLFGPAPALAHALVAAVSVLIIACPCALGLATPMSIMVATGRGASLGVLI
    RNAAALERLEKVDTLVIDKTGTITEGKPVLKALEPAPGFTRAELLHLAASLERGSEHPLAAAIVSAAEAEGLKLTDTEDF
    DAPSGKGVVGTVEGRRVALGNPVLMRELNLDTSPLAPRADALRDTGATVVFLAVDGALAGLAAVADPIKPTSAQALAGLR
    ALGIRIVMLTGDGRRTAEAVAREIGIAEVEAEILPEQKSETVKRLQAEGRIVAMAGDGINDAPALAAADVGIAMGTGTDI
    AMESAGVTLVKGDLTGILRARELSQATMRNIRQNLFFAFAYNAAGVPIAAGLLYPVFGLLLSPVFAAAAMSLSSVSVIGN
    ALRLRRVRL

    >gi|154250894|ref|YP_001411718.1| arsenate reductase [Parvibaculum lavamentivorans DS-1]
    MPKPTIYHNPRCSKSRQTLALLEENGHAPLIVDYLKAPPSAAELQSILKKLKMKPRDLMRKGEAAYKDLGLDNEKLTVEK
    LIRAMVENPILIERPIVVMGAKAKIGRPPESVLEIL

    >gi|154251139|ref|YP_001411963.1| redoxin domain-containing protein [Parvibaculum lavamentivorans DS-1]
    MTINVGDKIPEATLMQMTDKGPAPVKTGEFFKGRKVVVFALPGAFTPTCSNQHLPGFIKNADTIKGKGVDEIVCLSVNDA
    FVMGAWGKQQGADSKVTMLADGNGDFTKALGLEFDGSNFGMGVRSSRYSMLVDDGVVKSLNKEPAGGKAEVSGAENILQQ
    LS

    >gi|154251142|ref|YP_001411966.1| hydroxymethylbutenyl pyrophosphate reductase [Parvibaculum lavamentivorans DS-1]
    MSETISKPPLTLLLASPRGFCAGVDRAIQIVELAIEKYGPPVYVRHEIVHNRYVVEELERKGAIFVEELDEVPSGAKVIF
    SAHGVPKAVPADAQSRELFYLDAT
    CPLVSKVHVEAERLYSRGHEILLIGHAGHPEVIGTMGQLPEGSVRLIETAADAEAF
    QPQDPEKVAFVTQTTLSVDDTAAIVAILRRRFPAIAGPRKEDICYATTNRQEAVKAIAPLVDAMLVIGAPNSSNSMRLVE
    VAERAGCRYAALLQRATDIDWAALGSPAIVGLTAGASAPEVLVEEVIDAFRQRFEVTVEESPVRRESVQFKLPRALAG

    >gi|154251156|ref|YP_001411980.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
    MNQNRAIIIGFAAVVLIALAYGAYLFFGSSNGATPGRAGGSAFEQELLVAGPLGDMTLGDPDAPVTVIDYASLTCSHCAA
    FEINTLPQLKEKYIETGKVHYILRDFPFDPVATAGFMLAHCAGPERYFGFVGVLFRQQAQWAFTQTPMEDLKALARQGGI
    SEERFDACMKDEKVFNHVKEVATRGAKTFGVRSTPTFFINGEKIEGALPWREFEPLIEKALAGQRISDVPADGASTPAAP
    AEE

    >gi|154251301|ref|YP_001412125.1| methionine-R-sulfoxide reductase [Parvibaculum lavamentivorans DS-1]
    MADTKQKLDKADDEWRSKLTPEQYAVTRQAGTERAFTGPWVNEHRDGTYKCICCGEELFRSDTKYESGSGWPSFYAPIQP
    GAVEEHNDDSHNMRRTEVVCAKCDAHLGHVFPDGPQPTGLRY
    CMNGTALDFKPDDTPEK

    >gi|154251549|ref|YP_001412373.1| glutathione-disulfide reductase [Parvibaculum lavamentivorans DS-1]
    MAKYDYDLFVIGAGSGGVRAARIAANYGAKVAVAEEYRVGGTCVIRGCVPKKLFVYASHFSEDFEDAKGFGWTVGETSFD
    WKTLVANKDKEIDRLNGIYIRNLEKAGVEIINSRATLKDAHTLHLVGENRDVTADKILIAVGASPFLPDIPGIEHAITSN
    EAFHLEELPESIIVVGGGYIAVEFAGIFNGLGVKTQQLYRGSLFMRGFDNDLRELLQEEMVKKGVDLRMNSDIAAIEKKD
    GELHVKLVNGDELKAGAVMYATGRNPNTKNLGLEEAGVQLGMAGEVIVDDYSKTCVDNIYAVGDVTDRANLTPVAIREGH
    AFADTVYGGKDVKVDHSIIPTAIFSQPEMGTVGLTEAQAREQYDEVDIYKTGFRGLKNTLSGSQEKTFMKLVVDAKSDKM
    LGVHLMGPASGELIQAIGIAVTMGATKAQFDATIAVHPTAAEELVTMKERWQAPVVKAAD

    >gi|154251723|ref|YP_001412547.1| hypothetical protein Plav_1270 [Parvibaculum lavamentivorans DS-1]
    MSRNFLDAETSPYLLQHADNPVHWRPWGEAALDAAKKEKKPILLSVGYAACHWCHVMAHESFEDESVAAVMNEHFVNIKV
    DREERPDIDAIYMSALHLLGQQGGWPLTMFLTPEGEPFWGGTYFPKEPNYGRPGFVQVLEEVARIFREEPAKVYKNRTAL
    VKALEEQSATARPGEPTPQVPIVVAEKLREIMDPVHGGIRGAPKFPQVPLLTLLWRAHLRTGREDLAAPVSRALDHMSEG
    GIYDHLGGGYARYSVDEFWLAPHFEKMLYDNALLIDLLTLVWQETRKPLYERRIRETVEWLAREMVTEGGGFAASLDADS
    EGVEGKFYVWSEAEIDNLLTPGEAELFKQVYNVSGEGNWEETNILNRLARADAPFTAEEEAALEPLKARLFLERDLRVHP
    GFDDKVLADWNGLMIAALARAGAAFGEAGWTEMAAAAFRFVMTEMRKDGRLHHAWRAGKLQHIAMADDLANMADAALALY
    EATGEAEYLQAAESLAAELGAHYRDETNGGYFFTADDAPALIVRRRTVADDATPAANGTMPGVLARLALMTGKQDYLARA
    DELIRAFAGELQQNIFPLGSYIASLDTRLKPVQIVLIGSKAETAELARAAFGTSLPARVLMRVADGSALPEGHPAHGKTA
    LDGKPTAYVCAGETCSLPVTEAAALEAELRRARLSA

    >gi|154251765|ref|YP_001412589.1| thioredoxin [Parvibaculum lavamentivorans DS-1]
    MEPIIGNDAALGADDLIVDTTTQTFARDVIEASRDVPVIVDFWAPWCGPCKQLTPVLENAVRAARGAVKLVKMNIDDHPA
    VAQQLRIQSIPAVYAFRNGQPVDGFMGALPESQIKAFIARLAGDVGPSPAEELIEIGREAREAGDLSQAAQAFAQAAQEE
    PGNPAAVAGLARCYIEAGDLDRAKQTLALVRPDARNDPEIAAAEAALSLAEKAGDLGDVGELQAKVEANPKDHQARFDLA
    LALNARGDKEGALDQLLISIEYDRNWNDQAARKQLVEFFDAYGPKDEATLSGRRRLSSILFS

    >gi|154251861|ref|YP_001412685.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Parvibaculum lavamentivorans DS-1]
    MNPRFRLAALVPVVIFLVLAALFFTAIYRGDPSRVPSALIGRYVPDFDLRPVEGLDLPGVAAADFGKGVPVIVNVWASWC
    VPCRDEMPLLVELRRIAGVPMFGLNYKDDPAAARRFLTELGNPFDRIGRDDTGRAAIEWGVYGVPETYVVDGNGRIAFKH
    IGPLTPEAVADQILPALQTARHPER

    >gi|154251909|ref|YP_001412733.1| dihydrolipoamide dehydrogenase [Parvibaculum lavamentivorans DS-1]
    MADSFDLVVIGAGPGGYECAIKSAQLGLSVAVVEKRDRLGGTCLNVGCIPSKALLHASELFHEASASFPGMGIEVGTPKL
    NLGQMLSFKDEAVDGNTKGVEFLFKKNKIEWVKGEGRIEAKGKVKVGDRVLEAKNIVIATGSDVARLPGIEIDEKTIVSS
    TGALTLEKVPGKLLVIGGGVIGLELGSVWSRLGAEVTVVEFLDNILPGMDGEVVKNFTRILKKQGFAFKLGAKVSKVEKQ
    KSGLKVSVEPAKGGDAETLDADVVLVSIGRTAYTQGLGLDKLGVKTDKRGRVEIDAGFKTNVDGIYAIGDCVAGPMLAHK
    AMEEGVALAEQLAGHYGAVNYDVIPGVVYTSPEVASVGKTEEQLKEAGIDYNAGKFPFTANGRAKANKTTEGFVKILADK
    KTDRILGIHIIGVGAGEMIAQAVTAMEFSSSSEDIARMCIAHPTMSEAIKEAALAVTGLPIHM

    >gi|154251974|ref|YP_001412798.1| methionine-R-sulfoxide reductase [Parvibaculum lavamentivorans DS-1]
    MMSRRMFFGSTAIAGVLAAAGLMARGGNGNASENGSFEVTKTADEWKAALTPEQYYVLREHGTERAGTSPLNKEKRAGTY
    TCAGCDLPVFSSETKYESGTGWPSFYAPLDNSIGTSEDRSLFITRTEVHCRRCGGHLGHVFDDGPPPTGKRY
    CMNGVAML
    FKAAGAA

    >gi|154251975|ref|YP_001412799.1| peptide methionine sulfoxide reductase [Parvibaculum lavamentivorans DS-1]
    MELDVNRFVFLLGLVLLVLTGFGAAHAQETSNKEAVAIFAGGCFWCMEPPFDKTEGVISTTSGYTGGMKANPTYKEVSAG
    GTGHAEAVKVVYDPSKVSYEQLLHVFWQNIDPIRKDAQFCDVGSQYRSAIFYLDEEQRQLAEKSKAELDASGRIPKPVVT
    EITKAGPFYPAETYHQDYYLKNPVRYAYYRWGCGRDARLEQLWGDEAGRHEE

    >gi|154251978|ref|YP_001412802.1| heavy metal translocating P-type ATPase [Parvibaculum lavamentivorans DS-1]
    MSDTATRAMEAPRADPALFVRKTPEGRDRLDLVVAGMHCAGCLRKVERGLTELPGVEYARANLSTKRVTVRWDPALLKAS
    AITGKLGEIGFNAVPFDQKLTSAMDEGEGRSLLRALGVAGFAAANVMLVSVAVWSGLVTDMDETTRAFFHWVSALIALPA
    IAYAGQPFFRSALRALRGRAMNMDVPIALAVILATTMSLVQTIVNARHVYFDASVTLLFFLLIGRYLDVQARAKACSAAQ
    NLLGLRAIAATLIAPDGSQRSVAIENLEPAMRVIVASGGRIPADGEVMSGIGDVDTSLVTGESVPEAVKPGSTVFAGTLN
    LGAPLVIRVTKRDDDSLLAEIVRLMESAEQGRARYVRIADRAARLYSPAVHIMAFGTLALWFALGAHWETALTHAIAVLI
    VTCPCALGLAVPVVQVVATGRLTRQGVLVKAADGLERLAQADTIVFDKTGTLTLGRPRLMNAKEIPAADLALAMALAGKS
    RHPLSVALAGCGRTLPLPLLDDIREEPGMGLEAKLGGETIRLGNAGFVEVSGNGPDHAGSELWLRCGAKPAVCFRFEDTP
    RPDAKEAVAALRARGFAIELLSGDREPAVRKLADELGIKEWRAAARPDAKIARLEELAALGRKVAMIGDGLNDAPALRAA
    HVSISPSDAADVSQTAADFIFQGARLSPVIEAVDVARQARRLVFENFGLALAYNAVAVPLAVAGFVTPLVAAVAMSSSSI
    TVTLNSLRLNFGGRKEAR

    >gi|154252055|ref|YP_001412879.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Parvibaculum lavamentivorans DS-1]
    MVQMKPKLIAMLAGAALLAAGAVYLIGRGGGNPDDEAALSGSAAALDAAATGEVANFRAGAPLALPEVRFVDGEGRDRTL
    ADFRGKLVLLNLWATW
    CAPCREEMPALDALQAEMGSERFEVVALSVERNGLELARAFLKEVGAAHLGLYTDTSGKANFTL
    KAFGLPTTLLLSPEGEEIGRMVGPAHWDSEDAKALIEAALAAY

    >gi|154252072|ref|YP_001412896.1| rhodanese domain-containing protein [Parvibaculum lavamentivorans DS-1]
    MSLRTLTPEEAKAMAARGAVIVDIREPDEFAREHIPGAVNEPLSKLGGHPAAAGAGIVVYHCKSGMRTKANAAKLAAPES
    CEAYILEGGIDAWKAAKLPVAADAAQPLELMRQVQIAAGSLVLLGVALGAGVHPGFYALSAFVGAGLVFAGVSGFCGMAR
    FLTAMPWNRALRA

    >gi|154252094|ref|YP_001412918.1| arsenate reductase and related [Parvibaculum lavamentivorans DS-1]
    MLTVYGLKNCDTCRKALKWLDAEGVPHRFHDLRADGIKASDIKRFAAAAGWDVLLNKSSTTWRSLPKSESENVGEAKALA
    LMAAHPALIKRPVFELENGAVVVGFREEQKTALKAAGRK

    >gi|154252189|ref|YP_001413013.1| glutaredoxin 3 [Parvibaculum lavamentivorans DS-1]
    MADVTIYTTMMCPYCHRAKGLLQKKGVSFTEVDVGMDADKRQEMMKRAHGSHTVPQIFIGDKHVGGCDDLYALDHAGKLD
    PMLAA

    >gi|154252589|ref|YP_001413413.1| OsmC family protein [Parvibaculum lavamentivorans DS-1]
    MATSVHLTSTSGVFQEIEARQHRMTADEPTNNHGTDKGPAPYELLLASLAACSSATLRMYSDRKGFALGTITADLAFKRD
    RDGNESIERVISFSEKPTEEQMERIRDIIEKTPVTKTLKRGTPITTRFE

    >gi|154252603|ref|YP_001413427.1| peptide methionine sulfoxide reductase [Parvibaculum lavamentivorans DS-1]
    MFNLRKKTEMPAPGEALPGRDFAIPTASRHFVNGADLKGPYPEGSETAIFGLGCFWGAERKFWELPGVHVTAVGYAGGYS
    PNPTYEEVCSGRTGHNEVVLVVYDPKKVSYEALLKTFWESHNPTQGMRQGNDVGTQYRSGIYVTSPAQREAAESSRAAYE
    AELRKQGYDVITTEILDAPEFYFAEDYHQQYLAKNPAGYCGLGGTGVSCPIGTGVNAA

    >gi|154252696|ref|YP_001413520.1| glutathione peroxidase [Parvibaculum lavamentivorans DS-1]
    MTGKTAYDFDFLSLKGKPLPLADFAGHPLLIVNTASKCGFTRQYKELEALWQKYRDDGLVVLGVPSNDFANQEPGGAAEI
    ASFCETNFGVDFPLTEKVAVKGRAAHPLFQWLAREGGFLSRPRWNFYKYVIGKDGKLVDWFASTTTPGSAKVERAIEKAV
    RG

    >gi|154252697|ref|YP_001413521.1| OsmC family protein [Parvibaculum lavamentivorans DS-1]
    MNILYKARASSSGGRTGEAKTDDGRLDVKLDTVKEFGGAGGPGTNPEQLFAAGYAACFHSALKFVAGQKKVKVPADSAVT
    AEVGIGPHPKGKGFALDIDLIVSLPGLDRAEAQALVAEAHEV
    CPYSNATRGNVDVRLSIA

    >gi|154252752|ref|YP_001413576.1| thioredoxin reductase [Parvibaculum lavamentivorans DS-1]
    MSEKKHSKVLIVGGGAAGYTAAIYAARAMLEPVLIQGIQPGGQLTITTDVENYPGFAEAVQGPWLMEQMEAQARHMGTEM
    VADTIVSADLSKHPFELKGDSGTLYTADALIIATGAQAKWLGIPSEEKFQGFGVSA
    CATCDGFFYRGKEVLVVGGGNSAV
    EEALFLTNFATKVTVIHRRDTFRAEKVMQERLFNHPKIEVIWDSAIDEILGTENPPGVTGARIKNVKTGETRELKADGVF
    MAIGHSPATELFKDQLKTKAGGYLVTAPDSTATSIPGVFAAGDVTDDIYRQAVTAAGMGCMAALESERWLAGKDAEKAGI
    GPDPVERARQAETA

    >gi|154252753|ref|YP_001413577.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Parvibaculum lavamentivorans DS-1]
    MAVLVGKQAPDFTAAAVLPDGDIVEDFNLRNYLNGSYGLVFFYPLDFTFVCPSEILAYSNRVPKFEAMNVKVIAVSVDSQ
    FTHAAWRNTAPNDGGLGPVKFPMVADMTKQIARDYDVLIEKDGVALRGTFLIDREGVVRHQLVNDLPLGRNADEALRMVD
    ALQFHEEHGEVCPAGWQKGQEGMKADAAGVAKYLGAHAEAL

    >gi|154252765|ref|YP_001413589.1| methyltransferase type 11 [Parvibaculum lavamentivorans DS-1]
    MSVESVKEYYGQTLKGSADLKTDACCDPGATPPHIRAALSDIHDDVLTRYYGCGLVIPDKVEGMRVLDLGCGAGRDAYAL
    AKLVGETGSVTGVDMTAEQLAVARAHVSWHMERFGYRRANVDFREGYIERLGELGLEPESFDIIVSNCVINLSPDKRAVL
    EGARRLLKPGGEFYFADVYADRRLDPSLRDDPVLLGE
    CLGGALYWNDFLTLSKQAGFADPRLVTDRPLEVREPSIRRALG
    NARFFSTTYRLFKLDALEPACEDYGQAVIYKGGIPHAEDAFTLDAHHRIEKGRVFPV
    CGNTWHMLKATRFAPHFDFIGDF
    SQHYGIFEGCGTQMPFGAGGGEAAAGACC

    >gi|154252964|ref|YP_001413788.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Parvibaculum lavamentivorans DS-1]
    MTQETITTDVVIVGAGPCGLFAVFELGLLDMKCHLVDILDKPGGQCAELYPEKPIYDIPALPVVSGHELTERLMEQAAPF
    GPQYHYNEMVEEVQKLEDGRWRVKTDGGLVFEAKVVVIAAGGGSFQPKKPPIPGIEAYEGKSVFYAVKRMETFRGKNVLI
    SGGGDSALDWTINLHPIVQSMQLIHRRDGFRAAPDSVNKMHALVEEKKMQFHLGQITSLHGDNGQLEGVTVKGNDGADYQ
    IECDTLLPFFGLTMKLGPIANWGINLHENLIPVDTEKFQTSEPGLFAIGDINTYPGKLKLILSGFHEAALMAQAAFRYAN
    PDAKLTFQYTTSSTSLQKKLGVA

    >gi|154253025|ref|YP_001413849.1| glutaredoxin-like protein [Parvibaculum lavamentivorans DS-1]
    MSENPVFDRIKGEVASQDVVLFMKGTPVFPQCGFSNAVVQVLTYLGVPFKGINVLEDDDIRQGIKEFSEWPTIPQLYVKG
    EFVGGCDIVREMFEQGELRDYLAQKGVQTEAA

    >gi|154253429|ref|YP_001414253.1| rhodanese domain-containing protein [Parvibaculum lavamentivorans DS-1]
    MFEATSPLVTTEWLEEHLDAPDVRVVDASWYLPQMQRDARAEYEREHIPGAAFFGIDEICDLASPYPHMLPAPEKFSSRV
    RAMGLGDGNRIVVYDGAGLFSAARVWWMFRVMGHDDVVVLDGGMKKWKAEGRPTDDMKPRASARHFAARRNTGLIRDRAA
    MLQNIDTCNEQVLDARSAGRFNATEPEPRQGLRGGHIPGSLNLPAGMLVAADGTLKKPDELRALFEKAGIDLSRPVVTT
    C
    GSGVTASILALGLAVLGKPQVPVYDGSWAEWGAVTEMPVEV

    >gi|154253460|ref|YP_001414284.1| iron-sulfur cluster assembly accessory protein [Parvibaculum lavamentivorans DS-1]
    MTDTATIEPTTITVTDNAAKRIARILEGEGEGVMLRVAVQGGGCSGFQYGFTLDDLQNDDDLVIEKNGVKVLIDSVSVEY
    LAGSEIDFVDDLIGSAFKINNPNATAACGCGTSFSV

    >gi|154253522|ref|YP_001414346.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
    MQLDVVSDTVCPWCYIGKKRLDEALTMQGGDGITLVWRPFQLDASIPEGGVDRKSYMEKKFGAEKARTVGNTIREFGEAV
    GIDFRFDKIERSPNTLDSHRLIRWAGTAGCQNEMVDILFRRYFEDGEDIGSHDILADAAAEAGMDADIVRDLLLKDADKA
    LVRREDTLAREMGISGVPSFVINSKWVMVGAQEPETLVRMFNKLLAREAEETAAAQ

    >gi|154253578|ref|YP_001414402.1| dihydrolipoamide dehydrogenase [Parvibaculum lavamentivorans DS-1]
    MADQYDVVVIGSGPGGYVAAIRASQLGLKTAIVERDALGGICLNWGCIPTKALLRSAELYETLQRLDEFGLKADKIGFDA
    DAVVTRSRKVAEQLSGGVKFLMKKNKIDVIEGSGRLAGAGRVTIESKDGKKNEIGSKNIILATGARARTIPGLEPDGKRI
    WTYREAMVPKEMPKSLIVVGSGAIGIEFASFYRAFGADVTVVEVLDRILPVEDEEISKEAAKAFKKRGIKILTGAKIDKT
    DNGAKGIAVTVTAGGKTETIEADVAISAVGIVGNVENLGLEEAGVKVEKTHVTVNEWLETGVKGIYAIGDLVGPPWLAHK
    ASHEGVLAAERIAGLKDLHPLDTTRIPGCTYSTPQIASVGLTEAKAKEKGHEVKVGRFPFRANGKAIALGEMEGFVKTVF
    DAKTGELLGAHMIGAEVTELIQGYGIAMTLETTEADLIRAVFPHPTLSEMMGEAVLDAYGRVLHT

    >gi|154253695|ref|YP_001414519.1| iron-sulfur cluster assembly accessory protein [Parvibaculum lavamentivorans DS-1]
    MARPTPKAITLTEIAAARMKEIMAASSGKYIGVRIGVKNGGCAGMEYTMEYAEDVKPLDEVVEDRDVKILIDPKAILFLL
    GTEMDYSEEKFSAGFRFNNPNQTDACGCGESVSITPATL

    >gi|154253708|ref|YP_001414532.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Parvibaculum lavamentivorans DS-1]
    MAKATAPKSAPAAGGLPAEGKKAPAFSLPADDGTKVTLKALAGKKVVLYFYPKDDTPGCTTEGIEFSALKKKFDAAGAVV
    LGVSKDTVDKHCKFRDKHNLTVRLLSDEDGKTVEAYGVWGEKSLYGRKFMGINRVTFLIDEKGVVRKVWPKVKVKGHAED
    VLAAAREI

    >gi|154253719|ref|YP_001414543.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
    MRFIFQYCPTRPRARATGVIFLALALMSGALLTPAGGARAEARFEGKDRQAIEEIVREYLIENPEVLIEAMRVLEQREQN
    AALASRREAIEKRHADIYNDPGDFVAGNPKGDVTIVEFFDYR
    CGYCKQSFKPLMDFVKADGNIRLILKEFPILGPASLEA
    SKAAIAAKKQNRYLEMHRALYEHKGQLDSEAIFGIATSLGLDTAKLRKDMEDPEIAKMVSRHYDLAEALGVDGTPAFIVG
    GELYPGAADKERLTEIVKTARGG

    >gi|154253811|ref|YP_001414635.1| heavy metal transport/detoxification protein [Parvibaculum lavamentivorans DS-1]
    MAATRPYKLYIDGMDCAACALKIEKAMYHLPGVSDVDVSHANGTLALQLDEDRTASFLIEERVRSLGYIPLAGHVEPETR
    QALGR

    >gi|154253826|ref|YP_001414650.1| heavy metal translocating P-type ATPase [Parvibaculum lavamentivorans DS-1]
    MMASGENLVNEERSMNKEPSSPCACSGGNGQQTACASEQASTETTVFHVSNMDCRNEEALVRRTLEGMPGVERLLFDLPQ
    RLLTISHREVSADALEQALNSVGMKAQAVRDAAVSTTYRIENMDCPSEEKLIRSHLGAVEGIQDLDFDLAERTLSVKHLA
    QARAQMEQVLASIGMRAKEQTFGHTGPIEAAAVIPSSALQQQPTAAVSAPPIGERVTYRIENMD
    CPTEEALIRDRLGKLP
    GVTALDFNLMQRVLGVQHTLATSAPIEKALASIGMQAARQDMQTATTVLRIAKMD
    CPTEESLIRGKLQGMPGVQGMDFNL
    MQRTLTVRHTPDAIKPAVEAIESLGMEAEVQRTDEPRDAPVAAHKTNWWPMAVSGVAAVAAEGVYWVNDGNHWAVIVLAL
    VSIFTGGLSTYKKGWIALKNLNLNMNALMAIAVTGGMAIGHWPEAAMVMFLFALAEVIEAKSLDRARNAIRGLMDLAPET
    ATVRQADGSWTELPAKEVAKGAVVRVRPGERIALDGLITSGRSAINQAPITGESLPVEKAEGDQVFAGTINETGSFEYKV
    TAGASDSTLARIIHAVESAQGSRAPTQRFVDQFARVYTPAVFAVSVLVAVVPPLAFGGAWFDWVYKALVLLVIACPCALV
    ISTPVTIVSGLAAAARRGILIKGGVYLEGGRKLKALALDKTGTLTHGKPEQTDFVPLIGEAQEVAAWAASLAARSDHPVS
    QAIARKANRDGIALHEVDDFAALPGRGVRGRVAGRMLHMGNHRLAQELGLSEATLQARLETLERQGKTAILLMDDATVLG
    IFAVADTVKETSREAVADLQALGVRTLMLTGDNQHTAAAIAAQVGISEARGDQLPEDKLKTIESLVGGEGQVGMVGDGIN
    DSPALARADIGFAMGAAGTDTAIETADVALMDDDLRKIPAFIRLSRSTAAILTQNIVLALGIKAVFLALTFTGHATMWMA
    VFADMGASLLVVVNGLRLLKFKAA

    >gi|154254077|ref|YP_001414901.1| UBA/THIF-type NAD/FAD binding protein [Parvibaculum lavamentivorans DS-1]
    MKLSDDQLERYARHIVLKEIGGPGQQKLLKARVLIIGAGGLGSPCLMYLAAAGAGTIGIIDNDTVSLSNLQRQIAHGTGD
    LGRAKTESAGDAARRINPDVKIVQHKERLTGANALEIVSQYDIVADGCDNFATRFLVNDACYFAKVPLVSAAVGQFEGQV
    ATFRAFERDGEGKPKPNYRDFVGATPPPGSVPT
    CEEAGVLGALTGVVGSLQALEVIKEITGAGESLAGKLLIYDALDTRF
    RTVKLKWDPKNALTGESPTITDLSGHA