Paracoccus denitrificans PD1222 uid58187

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119382794|ref|YP_913850.1| UBA/THIF-type NAD/FAD binding protein [Paracoccus denitrificans PD1222]
    MNRYARQMVLPEVGAEGQERIAAAHALVVGAGGLGVPVLQYLAGAGIGRITLVDPDTVEESNLHRQPLYRMKDIGQPKVR
    AAAQAVARLNPAVEIEALADRLTPLNAPVLVAAANVVLDCADSYAASYTLSDACLAAGKPLISASALGLAGYVGGFCGGA
    PSLRALFPDPPDSGQT
    CATAGVLGPVVGMLGCIQAQMALRLLLGTTPSPLGEFIRFDNGRFTQFRFDAAPEADGPRFIAR
    EDIRAADLVIDLRPEDEAPRKATPDALRIPGYGAAGPLPDPGQRVVLACRSGLRSWRAADALSRRWSGEITLLALGDDDR


    >gi|119382966|ref|YP_914022.1| heavy metal translocating P-type ATPase [Paracoccus denitrificans PD1222]
    MMERPLPAVPAWETRMTDSTTERREWTVSGMDCAACTVKVTRAVERLPGVSDVKVALMGERLSLALADGATAAEEIEKIV
    RRLGYGIAPREREQPRQAALAPRRPHDDGCGGTCGHDRKAASPSGAGHGTPAGGSTPWYRTAKGRLVILTGALLSLAWAF
    ELLAPAEWGYRAFLLACLIGVAPVAKRAFEALRLGQPFTIESLMTIAATGALFIGAAEEAALVVFLFAVGEVLEGVAAGK
    ARDGIRALANLVPRTAIVEIDGQARETPADSLQIGQVVLVRPGDRVPADGEILDGTSGIDESPVTGESVPRTRGPGEPVF
    AGSINAEAALRVRVTREASDNTIARIIRLVEEAEEARAPTERFIDRFSRWYMPAIVGLAALVVVVPPLAFGAEWGTWIYR
    GLALLLIGCPCALVISVPASIASSLSAGARRGMLMKGGAVIEAAARVSHVAFDKTGTLTHGKPVVTDLIPAPGIGEAALL
    EVAGGVEAGSSHPLAQAILSRLAQEGVTPLPARAARVLVGQGAEAVVGGAPAWVSLPRHAAQRDGIEADALREATRLEGE
    GKTVVAVFRDGQPLGLIAMRDEPRGDAAEAMRQLRDLNVGAIMLTGDNPRTAAAIAGGLGMDYRAEMMPEDKLAAIRETG
    LPGSVMMIGDGINDAPALKQAGIGVAMGSGTDVALETADAAILRDRVTDVPALIRLARATMGNIRQNVTIALGLKAVFLV
    TSVLGITGLWIAILADTGATVLVTLNALRLLRFRPEQA

    >gi|119382969|ref|YP_914025.1| arsenate reductase [Paracoccus denitrificans PD1222]
    MDIILYHNPDCGTSRNTLGLIRNAGLEPHVIEYLKCPPSRELLVRLIARMGLTARDLLRQKGTPYADLGLDDPALSEDQL
    LEAMMAHPILINRPIVVSPRGVRLCRPSEAVLDLLPPQRGAFAKEDGEAVVGDDGQPVTPAS

    >gi|119383273|ref|YP_914329.1| heavy metal translocating P-type ATPase [Paracoccus denitrificans PD1222]
    MKHHQNDAELTVTGMSCASCVGRVEKALAAVPGVEEPRVNLATGRAHFRLTAPEALPRAVEALAGAGYPAAPLETRLSIE
    GMS
    CASCVGRVEKALAALPGVTSAQVNLTTASATIHHSPGVAPQALADTVTAKGYPAELQAEAGHHMHDHGGDAASMKRN
    FLVALVLTLPVFVAEMGGHAFPAFHHWLHMALGQQTLWVLEFLLTTAVLAGPGRVFFRVGFPALMRRAPEMNSLVALGAS
    AAWLYSTVATFAPGVLPADSVHVYFEAAAVIVTLILLGRWLEARAKGRAGNAIRRLIELAPDSAHVQRDGRIVEIPVAEL
    HPGDIVHLRPGERVAVDGVLTEGSGAIDESMLTGEPVPVAKQPGDTVTGGTVNGNAALAYRVTATGGNTVLARIIRMVED
    AQATKLPVQALVDRITAVFVPVVIGLALLTFVLWMIFAGSLGQALVAAISVLIIACPCAMGLAVPVSIMVGTGRGAELGV
    LFRRGDALQRLAEARIVALDKTGTLTQGAPALTAIEAEDIEPLDALRLAAAAEARSEHPLAAAIVGAARDKGLDLPPAEA
    VQAAVGRGLSARVEGRALLIGNAAALTEAGITPSPALIAAAEGWAANGATPVHLAVDGRHAAAMALADPIRPEAAETIAE
    LHTLGLQTAMISGDVRATAEAVGRKLGIDTVTAGVLPEGKLAAIREMGGGTVFVGDGINDAPALAAAETGIAIGTGTDVA
    IESAEVVLVGGDPMGVARAIRLSRSVMRNIRQNLFWAFGYNVALIPVAMGALVPFGGPQMSPMLGAGAMALSSVFVVSNA
    LRLRRAA

    >gi|119383303|ref|YP_914359.1| dihydrolipoamide dehydrogenase [Paracoccus denitrificans PD1222]
    MSTYDLIVIGAGPGGYVCAIRAAQLGLKVACVEGRETLGGTCLNVGCIPSKALLHASHMLHETHENFEKMGLMGAKPKVD
    WGKMQGYKAETVGGNTKGIEFLFKKNKIDWLKGWASIEAPGKVKVGDTTHETKNIVIATGSEPASLKGVEVDNDAGIVVD
    STGALSLPKIPKSMVVIGAGVIGLELGSAYARLGAEVTVVEFLDAITPGMDGEVQKQFQRILAKQGLKFVLGAAVSGVEV
    EKGKAEVKYKLRKDDSEHEIKAECVLVATGRRPYVAGLGLDKVGVALTDRGFVQIDDHWQTSVKGIYAIGDAVPGPMLAH
    KAEDEGMAVAEVIAGKHGHVNYDVIPGVIYTTPEVASVGLTEEAAKESGRKIKVGKFPFMGNARAKALFQAEGFVKMIAD
    AETDRVLGCHIIGPNAGEMIHEVCVAMEFGASAQDIALTCHAHPTCSEAVREAALACGDGAIHA

    >gi|119383363|ref|YP_914419.1| dihydrolipoamide dehydrogenase [Paracoccus denitrificans PD1222]
    MAQSFDMVVIGSGPGGYVCAIRGAQLGLKVACIEREHLGGICLNWGCIPTKALLRSAEVFHLMHRAKEFGLSADKIGYDL
    GAVVQRSRGVAKQLAGGVGHLLKKNKVTVIMGEASLTAPGKISVKTDKGTEEVTGKAIVLATGARARELPGLEPDGDLVW
    NYKHALQPPRMPKKLLVIGSGAIGIEFASFFNTLGADTTVVEVMDRVLPVEDAEISALAKKQFVKQGMKILEKAAVKKLD
    RAKGKVTAHIETGGKTETHEFDTVISAVGIVGNVENLGLEKLGAKIDRTHVVTDEYCRTGVEGLYAIGDVAGAPWLAHKA
    SHEGVMVAELIAGGHPHPIKPNSIPGCTYCNPQVASVGLTEEKAKAAGYEVKVGRFPFIGNGKAIALGEPEGLIKTVFDA
    KTGELLGAHMVGAEVTELIQGYVVGRTLETTEAELMETVFPHPTLSEMLHEATLSAYGRAIHF

    >gi|119383373|ref|YP_914429.1| peptide methionine sulfoxide reductase [Paracoccus denitrificans PD1222]
    MNAPIHRIFGRPLDAEMPKGYDQAIFGMGCYWGVERLFWQQEGVWLTEVGFAGGTTENPSYKQVCAGGTGHAEVVHVVYD
    SSRVSYERLLQIFWENHDPTQGNRQGNDVGSQYRSLIMVFNDSQKAAAELSKADYGNRLAVQGYPDITTQILPAGPFWRA
    EDDHQQYLDRYPDGYCGLRGTGVKAPLTDIAEGY

    >gi|119383383|ref|YP_914439.1| 3-mercaptopyruvate sulfurtransferase [Paracoccus denitrificans PD1222]
    MSTDSDDPKVLVSTDWLAAHLSDPDLRVIDATWFLEPGRDARAEYMAAHIPGARFFDIDEIADKRSELPHMAPQPEMFIS
    RMRAMGIGDGHQVVIYDNSPVRSAARVWWTFKLMGKQDVAVLDGGFGKWLAEGREIEDMPPILRDRHITVQRQAALVRDV
    TQVAAASKLGDHEIVDARSAERFRGEATEPRAGLRSGHIPGSKSLPFGRLYDQDGTLKSPDALRAEFEAAGVDLSKPVIT
    T
    CGSGVTAAVLFLALERIGHRDHSLYDGSWAEWGSFPDLKIATGDA

    >gi|119383675|ref|YP_914731.1| OsmC family protein [Paracoccus denitrificans PD1222]
    MIVNSGSAKWEGGLKDGKGALSTKSGALSNQPYGFNTRFEGLPGTNPEELIGAAHAACFSMALSAILQEAGIGNVRIETT
    SEIGLAKEGDGFAIKTAHLNTRVWGDGDKAVIEECARKAEKG
    CPVSKVLNAEVTMDVTVG

    >gi|119383679|ref|YP_914735.1| iron-sulfur cluster assembly accessory protein [Paracoccus denitrificans PD1222]
    MNTGLNLPPKVTERAFARLAEINGDGPTRPLRVAVAGGGCSGFQYDIRLDEAAEDDLVLSGAGQSVVVDPVSLPFLAGAT
    IDFADELIGARFTIDNPNASSSCGCGTSFSI

    >gi|119383703|ref|YP_914759.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
    MTDPLPGQVRLDIFADPVCPWCMIGKAELDQALERRPGHPFAITWQPFRLDPQMPQAGMDYVAYMKMKFTDEKGILAAMK
    PVMEASERLGLWINPSLIERVPNTLDAHRLLYWAGLEGVQTPVMSGLMRAHWREGRNISNPDVLALIGEKAGMDGGMIRR
    LLATAEDRDQIASREMHARQRGIASVPTFIVADTHVVTGAQPAGLWQNVIDELTGGQAQ

    >gi|119383816|ref|YP_914872.1| OsmC family protein [Paracoccus denitrificans PD1222]
    MSVQVLYRTQATATGGREGQARSADGRLEVALSTPKELGGAGGAGTNPEQLFAAGYAACFLGALKLVAQQQKVKLPADAA
    ITATVGIGPRAEGGFGITADLAISLPGIAREEALRLVEAAHQT
    CPYSNATRNNVAVGLTVI

    >gi|119384118|ref|YP_915174.1| redoxin domain-containing protein [Paracoccus denitrificans PD1222]
    MMKGRMMKQGDLLPEVTFQTRVRDESVGGPNPYRWQPVTTADYFKGKRVVLFSLPGAFTPTCSTYQLPGFEKAAGEMAEL
    GIDAIYCMSVNDSFVMNQWAKAQNLSNVKVIPDGSGAFTEKVGMLVRKDNLGFGARSWRYAAIVDDGRIEAWFEEPGRCD
    DCPEDPYGASSPESVLDWLRANPTKAAA

    >gi|119384133|ref|YP_915189.1| glutaredoxin-like protein [Paracoccus denitrificans PD1222]
    MTDARQQIQETIDGDDVVLFMKGTKEMPQCGFSSRVAGVLNYMNVQYRDVNVLADDTIRQGIKDFSDWPTIPQLYVKGEF
    VGGCDIVTEMTLSGELDQLFDKAGVTYDKDAAEKIREANA

    >gi|119384151|ref|YP_915207.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Paracoccus denitrificans PD1222]
    MLLPVAIFAGFAGLSGWALLRDDPDALPSAMIGREAPSVGEATLPGKVQLTDEMLRQPGVKLVNFWASWCPPCRAEHPTL
    TELSARLPVYGVDLKDPEGAALGFLSEHGDPFHALAADPRGRVAIDWGVTAPPETFIIDGSGRILHRHAGPLVREDYTNR
    FLPELEKALAAE

    >gi|119384164|ref|YP_915220.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Paracoccus denitrificans PD1222]
    MDHDVLVIGGSFSGLAAAMQLARARRRVCVLDTGAPRNRFAAASHGFPGQDGRPPQDIRAALRHELAVYPTLSLRDGAAV
    SAAREGNGFRVALAEGRDITARRLVLAFGVRDSLPDLPGLSERWGATVLH
    CPYCHGYELNGGPVGVLARGEAALHQAMLL
    PDWGPTTLFTQGALVLTREQRQGLTARGVTVEKTPVAALIGTAPALDGVRLDDGREIALAGLFLAPDTAPSCDLAAQLGC
    TMKDGPTGPYVAVDPMQATSQPGVFAAGDLASPMPNATIAAAAGVMAGGAAHRSLIFDPDLTAAA

    >gi|119384556|ref|YP_915612.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
    MKALLTAALLTATALPAMAFDPANMTEAEKAAFGEAVRDYLMANPDVLIESINVLEERRLADEARNDELLVENSKAAIFD
    DGHSWVGGNPQGDVTLVEFIDYR
    CGVCKRVSPDVEKLISADGNIRWILKEFPILTQESDMAARFAVAVQQEAGPDAYKKA
    HDALMESRGPVNLESLTKLAGELGVEAQAVINRMNTEDVSAVLRKNHQLAEQMRIMGTPTFIIEGEMLRGMPAEGLEGTV
    ARAREAKAEG

    >gi|119384579|ref|YP_915635.1| heavy metal translocating P-type ATPase [Paracoccus denitrificans PD1222]
    MSDATLHDHDARLSACPACDAAPLASRIAGTRGVQEDIVLSLPTIHCATCITDVERVLQRHPGVRDARVNLTLRRVTVDA
    PGMTAEELIPVVESIGYEAHELDPAALSASAADRQGRDILMRIGVSGFAMMNIMILSVAVWSGAEDATRDMFHWISGAIA
    LPTVAFAGQPFFSSAWRALRHGRLGMDVPISLALILASAISVYETLHSGHHAYFDAAVMLCFFLLIGRYLDYRTRAVARS
    AAEELTALEVPRAFRVTPAGDEPVPVAELVPGDLIRIRPGARVPADGEIAEGSSEIDRSLLTGESIPVAAGPGLALSAGE
    VNLTGPLVMRVTAAGRDSSLARLTALVAAAESARGHYTGLADRASRLYSPLVHLLAFCSFLGWYLGTHDLRLAVNVAAAV
    LIITCPCALGLAVPAVVTAASGRLFRRGMLIKDGTALERLAEVDAAVFDKTGTLTMGVPQLVSLDPIPTDARPVALALSQ
    GSGHPLSQALAQALRETGTEPAALQDLREVPGHGISGVWQGREVRLGRADWLGARHGEATLSASWLSLGQGAPIRLEFSD
    RLRPGAEACVARIVASGRRVMLLSGDAAPVVQDLARRLGIEEWRAGVTPVEKAEALRRLRQEGLHPLMVGDGLNDTAALT
    EAHVSISPASALDAARTASDMVLMGSDLAPVAEALELARSARARIKENFAISLVYNIVAVPIAIAGFATPLMAALAMSLS
    SISVTLNALRLR

    >gi|119384628|ref|YP_915684.1| methionine-R-sulfoxide reductase [Paracoccus denitrificans PD1222]
    MSERITKTDAEWRAELDPETYRVTRQAGTERPFSHPGFPKGPGHYECVCCGARLFDGDAKFESHCGWPSFSQPGGKIDEH
    RDITHGMIRTEVRCHRCDAHLGHVFPDGPPPTGLRY
    CINGVALRFVPEPG

    >gi|119384678|ref|YP_915734.1| UBA/THIF-type NAD/FAD binding protein [Paracoccus denitrificans PD1222]
    MLILAIMLAVLVAARLLGWPAWRGWAGVAALWLAAVAALVLAPGSGVAHLVGGDARVWVLGGGVVALLLGYRLLLRQLHR
    RAVPVPEAPQPSAQSGPLSDPELDRYARHIVLRELGGPGQAALRRARVLVVGAGGLGAPVCLYLAAAGVGRITVADDDHV
    GLSNLQRQVIFRSADDGRPKAEAARDAMLALNPHVEVAALNRRITDADAALIAEHDLVLDGTDSFAARRAVNAACVAAGV
    PLVAGAIAQWEGQVTIWDPRHGAPCMTCIFPEAPAPGLAPA
    CAEAGVVGPLPGVIGSLMALEAIKLIARTGEPLRGRMLI
    FDGLYGENRLMKISRRADCPTCGSGHFRAG

    >gi|119384755|ref|YP_915811.1| redoxin domain-containing protein [Paracoccus denitrificans PD1222]
    MEIDWQAAHDGGLAKLAPTDPTPVPATAFTDPEGGTHSLADWQGKVVLLNFWATWCAPCREEMPSLDALQAEMGGEDFEV
    VAIAAGHNPPPAVRKFLDEEGITHLPVHLDPRQQLAREMGVMGMPVTVLIDREGNEIARLIGGADWSSEAAKELVRQATA
    P

    >gi|119384827|ref|YP_915883.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
    MMLLRRSLIAAATAALTVSALPALAQEAKPADNAQAAEQMPEGKVLPDIALGQADAPVTIIEYASFTCSHCAAFHDQNLP
    KLKAEYVDTGKVKFIQRDVYFDAVGLWAGILARCGGDEKYYAVSDLIFGDQKNWLSAKSGDEIAANLRKIGAKAGMTPEQ
    MDTCWNDQQKVADLVTTFQTHATADQIEGTPTFIIAGEKVQNQPWDDLKKIIDAKLAEAESKG

    >gi|119384940|ref|YP_915996.1| thioredoxin reductase [Paracoccus denitrificans PD1222]
    MSHAPAEIAADTSLPAHSRVLIVGSGPAGYTAAVYAARAMLSPVLIQGMQPGGQLTITTEVENWPGETEIQGPDLMVRME
    AHARAMGARIFVDTVTRLDLGRRPFVAELDSGARITADAVILATGAQARWLGLSSEEKFKGFGVSA
    CATCDGFFYRGREV
    VVVGGGNTAVEEALFLTNFASKVTLIHRRDSLRAEKILQERLFRNPKVSVLWDHELVEVQGEQQPPGVTGVRVRHVRQGT
    EQVVPADGVFIAIGHAPASELVKDQLELHHGGYVKVEPGTTRTSIPGVFAAGDLTDHIYRQAVTSAGMGCMAALDAERFL
    AEHDMAGEPNPHAAEIPA

    >gi|119385003|ref|YP_916059.1| arsenate reductase [Paracoccus denitrificans PD1222]
    MITIYHKPTCSTSRKVLQMIRDAGHEPEIVDYAREGWTRAQLLGLFAAADVTPRQAMRVKGTDAAERGLLDAGDEDILAA
    MVENPLLVERPIVCGPGGVRLCRPAELVAETFAR

    >gi|119385056|ref|YP_916112.1| redoxin domain-containing protein [Paracoccus denitrificans PD1222]
    MQLTEEPRMSIAKGDKLPEGTLLKLGANGPEEVAAADLAQGLVAIFAVPGAYTPTCTNAHMPSFVKNAANFRDKGVSRLV
    CITVNDPFVAGKWAADTGATDAGIEVLADADGSFTKALGMNIQGAGWVNGRSKRYAMLVSDGTIEELQVEEAPSACSVSS
    GESLLELV

    >gi|119385075|ref|YP_916131.1| heavy metal translocating P-type ATPase [Paracoccus denitrificans PD1222]
    MSAEQAQRHEWTVTGMDCASCSAKVTRAVERLPGVGEVRVALMAERLSLTLEPGTTGRDEIEGVVRKLGYGIAPKGQQAP
    RRKALVLPDAPPPSAEAAAQPSRHDHDAGGESWYRTGKGRLVILTGVLLAAAWGLELLTSTETGYWAFLAACLIGVAPVA
    RRAWAALRMGQPFTIEALMTMAAIGALFIGAAEEAALVVFLFALGEVLEGVAAGKARDGIRALADLVPKTALLEIDGATR
    EISADRLEIGQTVLVRPGDRIPADGEIVDGIGGVDESPVTGESVPRTRGPGEPVFAGSINAEATLRIRVTREPADNTIAR
    IIRLVEEAEEARAPTERFIDRFSRWYMPAVVAVAALVMLVPPLGFGADWDTWVYRGLALLLIGCPCALVISVPASIASAL
    SAGARRGLLMKGGAVIEAAAGIRHVALDKTGTLTRGRPAVVRILPAPGIGEAVLLATAAGVEAGSGHPLAQAILHRAAEA
    GIAPPPARAARALPGQGVEAVLGESRAWVVSPRHAATLGGLHDAGAAEALEAEGMTVVAVLDEHRPLGLIALRDEPRPDA
    AEAMRQLRAMGIEATMLTGDNPRTAQAIAGTLGIGFQAAMLPADKLAAIREMAAQGGVMMIGDGINDAPALKQASVGVAM
    GSGTDVALETADAAILRDRVADVPALIRLARATMGNIRQNVAIALGLKAVFLVTSVLGITGLWIAILADTGATVLVTLNA
    LRLLGHDPGKVG

    >gi|119385101|ref|YP_916157.1| thioredoxin domain-containing protein [Paracoccus denitrificans PD1222]
    MLELGSAPKDAAPADIIKDVTEATFMADVVEASMKVPVIVDFWAPWCGPCKTLGPQLEAEVARHKGRIRMAKVNVDENQM
    IAGQLRVQSIPTVYAFFQGQPVDGFQGAIPQSQIKQFVEKLVAMGGDDGGLAEALEAAEAMIAEGAPEDAAETFAAILEE
    EPENAAAWGGLIRAHLAAGAEDRAEEALAQVPAAVANAAPVEAARAQLQLARQAASAGPLDELRHKVEADPADQQARFDY
    ATALHAAGEVEEAIDQLLEAFRRDRDWNEGAAKAQLLTIFDAMKPTDPLAQKGRRRLSSLIFA

    >gi|119385159|ref|YP_916215.1| methylated-DNA--protein-cysteine methyltransferase [Paracoccus denitrificans PD1222]
    MNAGPDPQADPGAALTALLGQPPQGPAALAAAWFDTPLGAMIAVADSDRLHLLEFVEREALPAELRRLAKGAGGRIGPGR
    TAVTDRAEAQITAYFASGLTAFDLPLALHGTDFQQQVWRELQRLPAGATISYAELARRIGRPSAIRAVARANGANQIAVV
    IP
    CHRVIGSDGGLTGYGGGLWRKRALLDHETRHFPA

    >gi|119385313|ref|YP_916369.1| glutaredoxin 3 [Paracoccus denitrificans PD1222]
    MMAKIEIYTTPTCPYCIAAKSLLQKKGITYEETDVSCDPQLRIAMTQRAGGRRTVPQIFIDGQHVGGSDDLHALEHRGKL
    DGLLGLTA

    >gi|119385447|ref|YP_916503.1| selenophosphate synthetase [Paracoccus denitrificans PD1222]
    MNDLPRLTSLAHGGGCGCKLAPSVLRELLADQPMAQAFPQLLVGTETSDDAAVWQVDDNTCVIATTDFFMPMVDDPRAFG
    RIAATNAISDIYAMGGRPIMALAILGMPIDKLAPERIREILEGGREICHQAGIPVAGGHSIDAPEPIYGLAVIGLCHPSE
    LRRNADARPGDALILTKGLGVGIYSAAIKKGALDEAGVAEMVASATTLNRVGADLAKRADVHAITDVTGFGILGHGLEIA
    RGARLRLRLRLTDLPLLSRAAELAEAGFVTGASTRNWAAYGAEVALPEGLPLWQRALLTDPQTSGGLLVACAPEAAGEVL
    DFIRDAGFPLAAIVGHAEQGVAGISVE

    >gi|119385480|ref|YP_916536.1| peroxidase [Paracoccus denitrificans PD1222]
    MSLRINDTAPDFTANSTEGQISFHDWIGDSYAVLFSHPRDFTPVCTTEFGVVAQLIPEFEKRGTKVLGVSVDSVEDHGKW
    KADIEKVAGTPANFAIIDDTGLKVAKAYDMLPADYYLPTEGRTPQHSATVRTVFIIGPDKKVRLTMTYPMSVGRNFAEIL
    RALDAVQKTDGVPLATPANWVPGQDVIVALALDDAAAEAKYGQLNKALPYLRFAKDPA

    >gi|119385517|ref|YP_916573.1| thioredoxin [Paracoccus denitrificans PD1222]
    MANTQAVSDAEFDSEVRQSPTPVVVDFWAEWCGPCRQIGPSLEELAAEYEGRVKIVKVNVDENPESPAALGVRGIPALFL
    FKDGQVVSNKIGAAPKAALKAWIDESI

    >gi|119385599|ref|YP_916654.1| methylated-DNA--protein-cysteine methyltransferase [Paracoccus denitrificans PD1222]
    MTQTFFTFAQPQPGLRVSITTQPAQDLGAVLCRGRFATPLGTVVAMGAGGALWGLGFAGAMSEDQVEADLAARWPRARLV
    EASEALAPSIQALLAGEGVITVHLTGTEFQLQVWRALVTVPPGQVISYATLAERIGRPNALRAVGTAVGQNPVSWAIP
    CH
    RVTRTGGRIGGYHWGEAVKRALLVREGASIAPRTIAAL

    >gi|119385751|ref|YP_916806.1| alkylhydroperoxidase [Paracoccus denitrificans PD1222]
    MADISMPKASAALGAKRHALAPAIDDAFLALSKVVFADGALDKRTKQLIAVAVAHVTQCPWCIEGHVKGARREGATNEQI
    MEAIWVAAEMRAGAAYAHANKALAVLDEIDGA

    >gi|119385842|ref|YP_916897.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Paracoccus denitrificans PD1222]
    MQDVIVIGGSYAGMAAALQLARARRKVLVIDAGQRRNRFASYSHGFLGQDGVDPARIWAEACRQLLAYPTVTWVEGSAST
    IAGGKDEFRVSTAAGDTFAGRRILLATGVADRLPDIPGLADRWGRTVFH
    CPYCHGYELDQGRIGVIATGAMSLHQAQLLP
    EWGEVTFLTNGALTLEPEQRDDLRSRGVAIEETPVARIAGEAEVELRDGRVLPFAGLFTATGTEPASPLAEAAGCELIET
    PMGRQIVTDETKETSLPGIFACGDVARAPHSVSLAVGDGAWAGAQLHRSLVWPE

    >gi|119385854|ref|YP_916909.1| rhodanese domain-containing protein [Paracoccus denitrificans PD1222]
    MPAPDAITCDKLAKLIGTARCPVVLDLRRADARDTEPRLIPSARWLAEDEIAPAALSELARSLDRPVVVLCAEGHGRSQG
    VAAWLRHEGVAAEYLEGGMAAWLAAGLPLVTTTRITGHDPQGRSLWVTRARPKIDRIACPWLIRRFIDPRAVFLFVAPAE
    VPAVAERFGAMPFDVEGVFWSHRGEDCTFDTLLKETRLSIPALDRLALIVRGADTARLDLAPEAAGLLAASLGLSRMYSD
    DLEQLDAGLQLYDAFYRWARDATDEIHNWPTNARGTGRSAT

    >gi|119385857|ref|YP_916912.1| arsenate reductase [Paracoccus denitrificans PD1222]
    MDVVIYHNPDCSTSRNVLAMIRNAGIEPHVVEYLKTPPSRAMLERLIARMGIAPRELLREKGTPYAELGLDDPALTDAAL
    IEAMLAHPVLINRPIVVSPRGVRLCRPSEQVLDLLPPQQAAFSKEDGEQVVDAQGNRIRPA

    >gi|119386013|ref|YP_917068.1| heavy metal transport/detoxification protein [Paracoccus denitrificans PD1222]
    MTKTILRSDEFSCPSCVVKIEKALKALPGVSEAKVHFNTGRIEVAHDQTAAPVDTLVQTIRATGYEARPAAF

    >gi|119386053|ref|YP_917108.1| rhodanese domain-containing protein [Paracoccus denitrificans PD1222]
    MPAPDAITCDKLAKLIGTARCPVVLDLRRADARDTEPRLIPSARWLAEDEIAPAALSELARSLDRPVVVLCAEGHGRSQG
    VAAWLRHEGVAAEYLEGGMAAWLAAGLPLVTTTRITGHDPQGRSLWVTRARPKIDRIACPWLIRRFIDPRAVFLFVAPAE
    VPAVAERFGAMPFDVEGVFWSHRGEDCTFDTLLKETRLSIPALDRLALIVRGADTARLDLAPEAAGLLAASLGLSRMYSD
    DLEQLDAGLQLYDAFYRWARDATDEIHNWPTNARGTGRSAT

    >gi|119386056|ref|YP_917111.1| arsenate reductase [Paracoccus denitrificans PD1222]
    MADASPRVFNVLFLCTGNSARSIIAESVLRKEGDARFRAFSAGNQPKGEVHPRTLKILQNYHYPTEGLRSKSWDEFAGPD
    APVMDFVFTVCDDAAGEACPYWPGQPMTAHWGLPDPAAATGSELQRDMAFIETLRYMKARIQTFAALPIGTLDRASLVSR
    LHEIGRSEGANGAADGMDVVIYHNPD
    CGTSRNVLAMIRNAGIEPHVVEYLKTPPSRAMLEQLIARMGIAPRDLLRQKGTP
    YAELGLDDPALPAAALVEAMLAHPVLINRPIVVSPRGVRLCRPSEQVLDLLPPQRAAFSKEDGEQVVDAQGNRIRPA

    >gi|119386377|ref|YP_917432.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Paracoccus denitrificans PD1222]
    MKFDYDLFVIGGGSGGVRAARIAASEYGARVGLAEESRMGGTCVIRGCVPKKLMIFASQAGAAAAESRGYGWQGAGEGRF
    DWAEFHGKLGRELDRLEGAYTSGLVNAGVEVHMQRARLHDAHTVELADGQRLTAKHILIAIGGRPQRPDIPGKELGLISD
    DLFTLEKLPGRVLVVGGGFIACEFATILQGLGSATVLAYRGDAVLRGFDGEMRRHVTEQLRAIGVDVRLGTNPARLDREG
    AGVRVTFEDDSSEIFDAVMFATGRVPYTKGLGLEDAGVKLGRKGEIVVDEWSQSSVPSIFAVGDVTDRVNLTPVAIREGH
    SFADTVFGARPRKVDHRLVASAVYTRPHELATIGLTEEEADACGPADVYVASFRPMRSLFAGSDARAVMKLIVDAQTDKV
    LGCHIFGPEAGEMIQMIAVPMGMGATKADFDAAIAVHPTLAEELVTMRKPSRRVGAANLDKPVASA

    >gi|119386499|ref|YP_917554.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
    MLRPLAAIALALLCALPPVPAQAQDHSPAEVAAIKDAVFNGPGLPVMGNAQGDAVLVEFSDYNCGFCRKSAPQVMALLQS
    DPGLRLVVHEIPIFGEGSRFAAEAALAAQAQGKYAEFHRALMAMRGKAEKPSVLRVAREVGLDVARLQRDMQSPEITRRI
    ERSLALADEIGLVGTPSFIAGDRAIFGYLSKDDLAELVAEARAAK

    >gi|119386584|ref|YP_917639.1| uncharacterized peroxidase-related enzyme [Paracoccus denitrificans PD1222]
    MVKTSRPEDRTMTHPISRFPVPSLDEMPEDIALRIRKVAEKSGFVPNVFLALAHRPDEFRAFFAYHDALMEREGGLSKAE
    RELIVVATSGLNQCQY
    CVVAHGAILRIRARNAFIADQVAVNWRKADLSARERAMLAYAEKVALNAQEIGDADHQTLHEAG
    FSQDEIWDIGAIAAFFGMSNRLVNAGDIRPNDEFYMLGRN

    >gi|119386729|ref|YP_917784.1| redoxin domain-containing protein [Paracoccus denitrificans PD1222]
    MAVRPPVCDFGAKAPDFTLPDPDGRMFSFSDIAGPSGTLVMFICNHCPYVQAVIDRIRRDAAELQGLGVGVVAISANDVA
    EYPQDAPEQMKLEAERHGFTFPYLYDESQDAARAYGAECTPDFFGYNAAGELQYRGRLDASGRNPAPPDARRELFEAMAQ
    IAQTGQGPREQVASMGCSIKWKA

    >gi|119386748|ref|YP_917803.1| arsenate reductase and related [Paracoccus denitrificans PD1222]
    MYGLGHCSTCQKAQAELEAAGWQVDFRDVAKAPLDQDEWRRMIAEFGEKLVNRASLTWRGMSEDERAGTPLQMLSAKPSL
    MKRPAIVEGDKRLLGWTANVKRALGVAA

    >gi|119386850|ref|YP_917905.1| protein of unknown function DUF395, YeeE/YedE [Paracoccus denitrificans PD1222]
    MDELPYGVLAALVGLAGGIVLGLSARLGDFCTLGALESAVYGKDSRRLRLWGVVLGVAILTTQALALTGWIELENSFYHT
    IHWNPLASIIGGLVFGYGMAMAGN
    CGFGALVRFGSGDLRSLVVVVVMAIVGFIVLSGPLAPLRVLLFLQPEANGPQGIVH
    DLGLMGLPAPVTVALIGVSALAWGLGHAPLRARPQMIAWGAAAGLAVSWSFFGTSWLYDHSLGAVQIEGPSFTAPVGRTL
    IFLMTSTAGGITFSVGSVVGVMAGALIGSMIRGLFKWEACEDPRELGRQIGGAALMGAGGVVAMGCSVGQGVSAFAALAW
    SGPVTLIAIVAGAAFGLRRLIGGFQGAVD

    >gi|119386854|ref|YP_917909.1| thioredoxin SoxW [Paracoccus denitrificans PD1222]
    MKPIRALAACLLLAATPAAAVETGDDGLHKPTWLRETFKDLREDLAEANAEQKRLLILVEQRGCIYCAEMHEKVFPDPEI
    DALIRDGYFVVQMNLFGDVEVTDFDGTALSEKDMAVRWGVMFTPTMIFLPEDVPEGQTASEAAVALMPGAFGKGTTSALL
    TWVRAHGYENGEHFQKFLARELERKN

    >gi|119386866|ref|YP_917921.1| protein of unknown function DUF395, YeeE/YedE [Paracoccus denitrificans PD1222]
    MSKRTVVMDLALLLEHFPEPYLAALFGLLVGAVFGFSAERSSFCLRAATVEFARGSLGPRVAVWLLTFSTAVIWVQGARL
    LGLFRAEDARMMAVTGSWSGAVIGGLMFGAGMVLARG
    CSGRLLVLAATGNLRSVVSGLIFAVVAQMALHGWLAPLRQELA
    GLWTTAGGRNVSLLTALPLPESGAILIGFGFAAAALWLARANRIGVRVLVFASGAGFAVALGWVLTFSLSQQAFEPVSVT
    SATFSGPSASTLMFFLTEKPGLDFDIGLVPGVFAGAFLSAALKRRLKFQGFEGEGQMRRSMLGAALMGFGAMLAGGCAIG
    AGVSGGSIFVATAWLALLCMWIGAAITDLLVDQAGKRAPA

    >gi|119386944|ref|YP_917999.1| methylated-DNA--protein-cysteine methyltransferase [Paracoccus denitrificans PD1222]
    MDHTPIPTESDPRWQRVLARDAAADGSFVYAVRTTGVYCRPSCPSRRAKPQNVTLYASPDQAEAAGFRPCRRCNPRGASA
    AEANAALVAAACRLIEQAETPPTLQALAEAAGLSPFHFHRQFKAIIGLTPRAYAAAHRAGRLRARLAQGASVTGAIYEAG
    FNSSSRFYEGADGMLGMTPSAWRKGGAGAEIRFALGQCALGAILVAQSRRGICAIALGDDPEALLRDFQDRFPAATLIGG
    DAEFEALVARIVGFIEAPGIGLDLPLDIRGTAFQQRVWQALRQIPPGTTASYAEIARRIGEPQASRAVAQACAANPIAVA
    IP
    CHRVVRSDGALSGYRWGVARKRALLDREGAA

    >gi|119387009|ref|YP_918064.1| iron-sulfur cluster assembly accessory protein [Paracoccus denitrificans PD1222]
    MFSIPGKSPVTITQAAERQIARLMAQKSASGLRIGLKKGGCAGMEYTMELAETPAPGDEVVEQGEARVLIAPTAQMFLFG
    TEIDYESGLLESGFKFRNPNVTDSCGCGESVNFAPLEGSRAKA

    >gi|119387080|ref|YP_918135.1| glutaredoxin-like protein NrdH [Paracoccus denitrificans PD1222]
    MTITVYSKPACVQCTATTRALDARGLDYHLVDLTEDDAAMELVASLGYRQAPVVIAGEAHWAGFRPDMIGRLS

    >gi|119387127|ref|YP_918182.1| alkylhydroperoxidase [Paracoccus denitrificans PD1222]
    MSYKAKIDGMRGELRVMNKAIPDTAKGFGTLSKAVHDGGVLDVKTREFIALGMAIVQRCEPCILLHVEALMKAGATREEL
    GDVLSMAIQMSGGPGMMYAGHALACWDELAAG

    >gi|119387316|ref|YP_918350.1| rhodanese domain-containing protein [Paracoccus denitrificans PD1222]
    MAVGYKQLLAEAEAVVQSVTVDEAARMRDDPQVVLVDIRDPRELEREGLIPGAFHAPRGMLEFWIDPDSPYHKPRFAEGG
    TYVFY
    CASGWRSLLAARVAQEMGLDARSLRGGFGEWRRAGQPVAERPARG

    >gi|119387317|ref|YP_918351.1| uncharacterized peroxidase-related enzyme [Paracoccus denitrificans PD1222]
    MTETADTPVSRFAVPRLADMPEDIRTRIEAVQEKSGFIPNVFLTLAHRPDEFRAFFAYHDALMDRPGNLTKAEREMIVVA
    TSTVNQCQY
    CVIAHGAILRIRAKNPLVADQVAINYRKADITPRQKAMLDFAMKVSARAQEVGDDDFATLRGHGFDEDDIW
    DIAAIAAFFGMSNRLANVSSMRPNDEFYTMGR

    >gi|119387455|ref|YP_918489.1| methylamine dehydrogenase accessory protein MauD [Paracoccus denitrificans PD1222]
    MTSFLIASNILLWLAFLGVTVVMLGLMRQVGLLHERSSPMGAMITDHGPDIGDAAPEFELPDFFGRPVRIGGAEAQGRQT
    LLMFTAPS
    CPVCDKLFPIIKSIGRAEGINVVMISDGAPEEHRRFLDSHELGEMRYVVSAEAGMAFQVGKIPYGVLLDGQG
    IIRAKGLTNTREHLESLLEADKTGFASLQQYMASRKKQAA

    >gi|119387483|ref|YP_918517.1| dihydrolipoamide dehydrogenase [Paracoccus denitrificans PD1222]
    MREIQCRLLVIGAGPGGYVCAIRAGQLGVDTVVVDAAPPGGTCLNVGCIPSKALIHAADEFHRLAQLSSTPSMGISAGPA
    RLDLGATMAWKDGIVERLTGGVATLLRKAKVRLVTGRASIRDGKTVLVETPEGPVQIRTEVLVLATGSEPIELPALPFGG
    KVISSTDALALTEVPGRLAVVGGGYIGLELGIAYAKLGAEVTVVEAAPRILPQYDAELTRPVAQRLTQLGIRVLTGARAG
    GLSDSGALRVAGVDGAEDIQADKVLVTVGRRPRATAAGVDGLRLDMAGPFIRIDERCRTSMTGVLAIGDVTGEPMLAHRA
    MVQGEMVAELVAGQPRAWDKRAIPAVCFTDPEIVSVGISPEEAAAAGREVVTGLFPFAANGRAMTAGDEAGFIRVTARPD
    THEVLGIQAVGAGVAEMAGGFALALEMGARLEDIAGTIHAHPTRGEALHEACLRALGHALHI

    >gi|119387496|ref|YP_918530.1| alkylhydroperoxidase [Paracoccus denitrificans PD1222]
    MTPRMTDHFDRTRTGYRALTGFEAALQAGPLEPKLLHLVKLRASQINGCAFCIQMHTAEALQDGETHLRLHMVAGWRDSP
    LFSDRERAALAWTEALTLIAQTGAPDADWQAVEAAFSPDERAWLTLAIGAINLWNRVQVGLRAPHAMGLPAERADAA

    >gi|119387621|ref|YP_918655.1| uncharacterized peroxidase-related enzyme [Paracoccus denitrificans PD1222]
    MPDAVLTHPDNAEPVEFTRAELGWVPWRAPLPEAEFTKRHYDGLVDRGRAKSPYFALLARDPEVLGARTRTDKDIFYNTD
    GGLPRAERELAATTVSRLNSCIF
    CASVHARFAAHHAKAPEDVDALLAGGVATRTSPRWDAVVDAAAALTRTPSAFGPDEI
    RALRATGLADDEIADLIFAAAFFNWAKRLKLSIGKPTPPTAG

    >gi|119387703|ref|YP_918737.1| alkylhydroperoxidase [Paracoccus denitrificans PD1222]
    MNAKQKLAEMNARAAALYKADGKTMSAFRGLMVAANREGKVGPAMKEMIAIAVAIGRGCEDCIVFHASEAKAHGASREEL
    LEVLAVAIEMSGGPGTVYAAKALAAFDEL

    >gi|119387711|ref|YP_918745.1| Fis family transcriptional regulator [Paracoccus denitrificans PD1222]
    MQRRHLVLAGASLLALPVLGRAGLAQETRDNPMPDDLRQSLERDPTAPVLGNPQGDITLTEFFDYNCPFCRKMVEPMHRL
    ITSDRNLRVVFREWPVFGEDSDFAARASLASLQQGRYWQMHRALFRTKGRVTEAATMRAARDVGLDTARLERDMAAEPVE
    RHISMSHMLAEHMGLIGTPTFVAGDEGAFGEYSLDDLRGLVRRARETMG

    >gi|119387724|ref|YP_918758.1| rhodanese domain-containing protein [Paracoccus denitrificans PD1222]
    MSNRITAAELSADLSGIDLLIDVRAPKGRAENGEIASAVILPKPLVAEVFAGPLASVPKDARIVVFCGSVNGSGPVVGTL
    AGLGFTNVADVEGGYAALKERGVA