Parabacteroides distasonis ATCC 8503 uid58301

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150006768|ref|YP_001301511.1| thioredoxin peroxidase [Parabacteroides distasonis ATCC 8503]
    MKALIGKKAPEFHAPAVVNGNEIIEDFSLEQYVGKKYVVMFFYPMDFTFVCPTELHAFQQKLQEFERRNVAVVGCSVDSQ
    FSHFAWLNQDKNKGGIHGVTYPLVSDFSKTISENFGVLAADYITNESGELISRGNPVAYRGLFLIDKEGLIRHYVINDLP
    LGRNVDEALRMVDALQHFEEYGEVCPANWSKGKDAMKATNAGVSNYLSHH

    >gi|150006893|ref|YP_001301636.1| thiol:disulfide interchange protein [Parabacteroides distasonis ATCC 8503]
    MKQFCMMALAGLLVVGCQEVPKGYVINGEVENMPDGKIYLKSFRNKMFFDVDTAEVKDGKFTFKGEVDQPLLFGLATENM
    NYPVQLFLENTDMNVKIGNDGETITVRNSPVNDVFQENAEKVFEEGYDIDSLISKYPDSPAAAFYLYRYFTYQLSLDDLK
    ATRAKISPALANSPYVKDLDGIIKQLEHVQIGQVAPEFSLPDTAGVSVSLSDFRGKYVLLDFWASW
    CPPCRKENPNVVNA
    FQQYKDKNFTIVGISLDKDKAKWQKAIADDHLTWAHVSDLKYWDSEIPALYGVRGIPANVLLDPNGVIIAKNITGEDLQN
    TLKEVIK

    >gi|150006920|ref|YP_001301663.1| methylated DNA-protein cysteine methyltransferase [Parabacteroides distasonis ATCC 8503]
    MQYTDKYRSPLGEITLASDGDHLTGLWFDGQKYFAATLSAEHQERELPIFEQAKEWLDSYFMGKIPSFTPPIHLEDTPFR
    LAVWDLLSKIPYGEVVTYKELAGEIARQKGIPSMSTQAIGGAVGHNPISIIIP
    CHRVVGSDGSLTGYAGGVDKKRSLLTI
    EQAKGF

    >gi|150007058|ref|YP_001301801.1| thioredoxin reductase [Parabacteroides distasonis ATCC 8503]
    MSDSVNEKVRCLIIGSGPAGYTAAIYASRANLSPVLYEGIQPGGQLTTTTEVENFPGYPDGITGPELMEDLKKQAVRFGA
    DIRFGIATAADLGEAPYKITIDGEKVIETETLIIATGASAKYLGLPDEHKYAGMGVSA
    CATCDGFFYRKKTVAVVGGGDT
    ACEEAIYLAGLAKQVYLIVRKPYLRASKVMQERVFKTPNITVLFEHNTLGLFGENGVEGAHLVKRMGEPDEEKVDIAIDG
    FFLAIGHKPNSDIFKPWVDTDEVGYIVTVPGTPRTKVPGVFAAGDVADPHYRQAITAAGSGCKAAIEAERYLSEIGK

    >gi|150007111|ref|YP_001301854.1| thiol-disulfide isomerase and thioredoxin [Parabacteroides distasonis ATCC 8503]
    METFDDIIKGDKPVLVDFFATWCGPCKVLSPTVEALGKELAGQVRVLKIDVDKNEALATQLRIQSVPTLIIFKKGEIIWR
    SSGVMDHGSLLRKAQSYID

    >gi|150007114|ref|YP_001301857.1| thiol peroxidase [Parabacteroides distasonis ATCC 8503]
    MKKHCLFSFVLSTESCLYLRSQLKVRLFNLHTKMAKVTLKGNEIHTNGELPKVGTEAPDFKGVKSDLSELSLSDLKGKKV
    VINVFPSLDTSV
    CAASVRRFNKEAASHPDTVVLAVSKDLPFAHGRFCTTEGIDKVITLSVFRCSCFEDKYGMLLVDGPLK
    GLLARGVIVVDGAGKVVYEELVPEITTEPNYDAALAALK

    >gi|150007166|ref|YP_001301909.1| electron transport complex protein RnfA [Parabacteroides distasonis ATCC 8503]
    MEYILIFIAAVFVNNVVLAQFLGICPFLGVSKKVETAAGMGAAVTFVLTIATIVTFLVQKYILDAFGLGFMQTISFILII
    AALVQMVEIILKKVSPALYQALGVFLPLITTN
    CCILGVAILVIQKEYNLLESVVYAISTAIGFALALIIFAGIREQLAMT
    HVPEGMKGTPIALITAGLLAMAFMGFSGIV

    >gi|150007167|ref|YP_001301910.1| SoxR-reducing system protein RsxE [Parabacteroides distasonis ATCC 8503]
    MSNLKILMNGIITENPTFVLLLGMCPTLGTTSSAINGMSMGLATMFVLICSNIVISALKNVIPDLVRIPGYIVVIATFVT
    VVQMCMEAFVPALYASLGLFIPLIVVN
    CIVLGRAEAFAAKNGVVPSAFDGIGIGLGFTMALTLLGACREFLGTGKLFNVT
    LMPEEYGSLIFVLAPGAFIALGYLVAIVNKLRKA

    >gi|150007196|ref|YP_001301939.1| pyridine nucleotide-disulphide oxidoreductase [Parabacteroides distasonis ATCC 8503]
    MKYLIIGGVAGGATVAARLRRMDEKAEIILFERGKYVSYANCGLPYYIGDTINDRNKLFVQTVKGFTDRFRIDIRTEQEV
    TRILPESKQVEVKKLGTGETYTETYDKLVLSPGAEPLRPRIEGIESKKIFTLRNVPDTDTIKNYVNTEKPRTAVVVGGGF
    IGLEMAENLHELGIHVTVVEMANQVMAPLDYSMAAIVHQQLIGKQVGLMLEDGVSRFEETSGGVTVHLKSGKQIPADMVL
    LSIGVRPETRLAKEAGLTIGALGGIAVNEYMQTSNPDIYALGDAVEVRHLVTGKPALIPLAGPANKQGRIVADNIVSGNK
    ETYDGTMGTSIAKVFDLTVATAGANAKLLKREGIAYQSSYTHGASHAGYYPGAVPLSIKILFAPEDGRLLGAQVVGFGGV
    DKRIEMLAQVIQRKGTVYDLTELEHAYAPPYSAAKDPVNMAGFVAENLLTGKAKAIQWREIQNLSPDTVRIDVRTRDEYS
    LGTIPGFINIPVDELREHLAELPKDKPIVVT
    CAVGLRGYLAYRILTQNGFTNVRNLSGGYKTWSVATAKIKNEPACAPCS
    SEAVSDKASGKSSSCKSTPAATAIKVDACGLMCPGPIMQLKKNYENLRENESLEITATDQAFGKDVSSWCKITGAELVSL
    ENKGGTIAATVRKKKAECKIATGGNSADNKTLIVFSDDLDKALASFVIANGAASTGKKVTMFFTFWGLNVIKKREKPAVS
    KDIFGKMFGWMLPANSEKLKLSKMNMGGAGSWMMRLIMKKKRIDSLESLMAQAVENGIEMIACTMSMDVMGVKKEELMDN
    VVLGGVATYLERAEDANVNLFI

    >gi|150007300|ref|YP_001302043.1| putative pyridine nucleotide-disulfide oxidoreductase [Parabacteroides distasonis ATCC 8503]
    MKKYDAIIIGFGKGGKTLAADLANHGWNVAVVERSTGMYGGTCINIGCIPTKALVHNAQVTGYRRPSTFEQYAEEFKQAI
    LAKEKLTSLLREKNFKNLDDRETVTVYTGEASFRSPYEIVVKTDTDSFLLEGEKIFINTGATTIIPTISGIEDNPYVYTS
    TSIMELEKLPRHLVIVGGGYIGLEFASMFAGFGSKVTILEAGEVFIPREDRDIADSVKSTLEKKGITIHLNTVVQTIEQD
    AERATVICRNAISGDTLRLDAEAVLLATGRKPNTESLNLQAAGIRTTNRGAIEVDSKLRTNIPNIWAIGDVHGGLQFTYL
    SLDDYRIIREELFGNGFRSLDDREAVAYSVFIDPPLAHVGLNETQARKMEKNIKVASLPAAAMPRTRTIEQTDGLLKAVV
    DADTGKILGCTLFCAESSEVINTVSLAMRLGQDYTFLRDSIFTHPSMSEALNDLFGLIK

    >gi|150007330|ref|YP_001302073.1| putative thioredoxin [Parabacteroides distasonis ATCC 8503]
    MKEKELNREERNKTVMETGALVMAEFYADWCPHCQKMMPIVKEFKELEKGKLEVVQINIEEESALADLYTVESIPTFILL
    RKGEALWRQSGEMNLDRLRKVVEDVVG

    >gi|150007340|ref|YP_001302083.1| dihydrolipoamide dehydrogenase [Parabacteroides distasonis ATCC 8503]
    MYMEYDIAIIGGGPAGYTAAERASENGLKTILFEKNAIGGVCLNEGCIPTKTLLYSAKILDSIKSASKYGIVAMKDPSFD
    LAKIIDRKNKTVRKLTLGVKARLTGNGVTIVEGEARITGEEFGNIRIHCDGKEYLVKNVLV
    CTGSETVIPPIKGLSEVKY
    WTSREALDLNDLPKSLAIIGGGVIGMEFASFFNSMGVKVKVIEMLPEILGNMDKETSAMLRSEYKKKGVEFFLNTKVTEV
    SAEKVFVEKNGKADTIEADKILVSVGRRPITKSLGLENLAIEIQGAGVKVNEHMLTSHPHVYAAGDITGFSLLAHTAYRE
    AEVAIHHILGIPDEMSYKAIPAVVYTNPELASVGKTEEELIANGESFRVQKIPMTYSGRFVAENENGNGLCKLITDDEDR
    IIGCHLLGNPASEIIVTAGIAVENGYTVDEFKKNIFPHPTVSEILHESLYI

    >gi|150007562|ref|YP_001302305.1| cation-transporting ATPase [Parabacteroides distasonis ATCC 8503]
    MKDLETIILPVLEMSCAVCANNVENTVKGLPGVEEASVNFAANTLSVKYHPSLITPQKMREAVQEAGYDLVVEVEDPTAV
    QEEMAREHYRKLRRNTIGAWVLSIPLALLGMVFMHTPGGNWIMMALALVIMIVFGRSFYVNGVRHALHGSANMDTLVALS
    TSIAFLFSFFNTVYPQFWYEKGLEPHVYYEASGVIIAFVLLGKLLEERAKNSTSSAIKSLMGLQPKTARRVRDGQEEEVS
    ISFLRVGDLVSVRPGEKIPVDGTVSQGSSSVDESMLSGEPIPVVKSQGDRVLAGTINQKGAFLMEATGVGSATVLSQIVQ
    MVQAAQGSKAPVQRIVDKISGIFVPIVVGLAILTFIVWLVVGGSGYFSYALLSAVSVLVIACPCALGLATPTALMVGMGK
    GAEHHILIKDAFALENLCKVDTVVLDKTGTLTEGVPEVTDSFWVSEASRDMLDILYTAEMKSEHPLASAILSWLKGTEAA
    EIDADSFESVTGRGIQMQVHGVTYWVGSKGFLETFKAMVPPEAGREIIRWEEDGKSIVYYGWESELLAVMAISDRLKLTS
    GEAVEALKEMGIEVHLLTGDGKRTAETVAAMLDIRHYKADVLPSDKEEYIRSLQAAGRKVAMVGDGINDSQALARADVSI
    AMGKGTDIAMDVAMVTLITSDLMLLPDAIRLSKRTVRSIHQNLFWAFIYNLIGIPLAAGGLFPVNGLLLNPMLASAAMAF
    SSVSVVLNSLRLKWSKL

    >gi|150007688|ref|YP_001302431.1| NADH:ubiquinone oxidoreductase subunit [Parabacteroides distasonis ATCC 8503]
    MAQYTNYILVCGGTGCRASQSEQIIENLRAAVEQYGLEDTQVIRTGCFGFCEKGPVVKMIPDNTFYVQVQPSDADEIVRE
    HLVKGRKVERLLYMNPETRELVPDSKHIRFYKKQLRIALRNCGFINPENIDEYIARDGYVALGKALVEMTPEEVIKEIMD
    SGLRGRGGGGFPTGLKWQITRKVQAPQKYVVCNADEGDPGAFMDRSILEGDPHSIVEAMAINGYCTGASKGLVYIRAEYP
    LAVERLKIAIRQAKEYGLLGENIFGTDFSFDIEIRYGAGAFVCGEETALIHSMEGLRGEATVKPPFPSEHGYKGCPTNVN
    NVETYANIPVILLRGAKWFSSIGTEKSKGTKVFALAGKVNNVGLIEVPMGTTLREVIFGIGGGIKDGKKFKAVQTGGPSG
    GCLTEKHLDLPIDYDNLLAAGSMMGSGGMIVMDEDDCMVAMAKFYLDFTVEESCGKCAPCRIGNKRLHEILQKITSGNGA
    EEDLTRLRNLAMVIKDTAL
    CGLGQTSPNPVLSTMDNFYDEYLAHVREHRCPSHQCRELTQYFINPEKCKGCTLCARVCPV
    HAITGGRKIPHIIDPQACIRCGTCMEKCKFGAIYVH

    >gi|150007763|ref|YP_001302506.1| Na(+)-translocating NADH-quinone reductase subunit E [Parabacteroides distasonis ATCC 8503]
    MEQLLSTFVRSIFVDNMIFAYYLGMCSFVAVSKNVKTALGLGIAVTFVLFCTLPINYMLENYVLKEGALSWLGPEYAEVN
    LSFLAFIIFIAVIASFVQLVEMVVEKFSPSLYASLGIFLPLIAVN
    CAILGGSLFMQQKAFPNVGVATVYGLGSGIGWLLA
    IVGMAAIREKLSYSNVPNALKGLGITFIITGLMGMAFMCFSGLKI

    >gi|150007764|ref|YP_001302507.1| Na(+)-translocating NADH-quinone reductase subunit D [Parabacteroides distasonis ATCC 8503]
    MGLLSEKNKEVLLGPLSANNPVVVQMLGICSALAVTSKLEPAIVMGISVTAVVAFANVIISLMRNTIPNRIRIIVQLVVV
    AALVTIVSEVLKAFAYDVNKQLSVFVGLIITN
    CILMGRLEAFALGNGPWESFLDGIGNGLGYAIILIIVGFFRELLGSGT
    LLGFQVIPQAFYDLGYVNNGLMILPPMALIVIAVIIWVHRAKNKELQEN

    >gi|150008087|ref|YP_001302830.1| putative bacterioferritin co-migratory protein [Parabacteroides distasonis ATCC 8503]
    MAVQIGDKVPEFLGTDQDGKEVKMSDYKGKKVALYFYPKDNTSGCTAEACSLRDGYQALQAKGFEIIGVSKDSAKSHQGF
    IQKQNLPFRLIADTDTTLQEQFGVWAEKKMYGRSYMGTLRTTFIINEEGIVTNIIGPKEVKTKDHANQILNL

    >gi|150008155|ref|YP_001302898.1| thiol:disulfide interchange protein [Parabacteroides distasonis ATCC 8503]
    MKKYLTLAASALLLAACSEKPGYEINGTVANTDLNGKYVYLYEYGVQDAAPMDSALVQNGTFTFKGTQSAPALRKLAFAE
    DVVEPKRAASGENAPFTSVFVLENGKLQAVLDEAASAVSGTPENDGLKALQAQMKTLRADLEKLSADMKSEDKEVVSAAE
    KKYDEIDQKVTDAVKTYILNNTTKQSAAKLLYDFRYSLDEAAQNEIIAKADSAFKAVPNIDKLMAHLDVLKTVAVGKKFV
    DFEMADPNGKTHKLSEFVGNGKNIVLIDFWASW
    CPPCRRDMPNLVAAYKKYKNKGFEIVGISLDSKADAWAKGVKDLNIT
    WTQLSDLQGWKNSGAQLYGVNSIPHTVLVDKDGTIIAKNLHGEEIDAKLQEILK

    >gi|150008156|ref|YP_001302899.1| hypothetical protein BDI_1522 [Parabacteroides distasonis ATCC 8503]
    MSAQITLNWEKDLTFETLLDGHKVTIDRDMENGGNDEGPRPKALMLVALAGCSAMDVIPLFNKMRVRFEKVSIDVKAESS
    DTIPMVYTAFHMTYHIQGNKEDAAKIDKAIRLSQEKYCGVGLMMKKIAPITYEILLNGEPLKPYPNDK

    >gi|150008339|ref|YP_001303082.1| thioredoxin [Parabacteroides distasonis ATCC 8503]
    MRKLKSLWLVSVVLLLVSCSMSAKSDKSSEAGTASKGEVVTLNKAEFLQKVFNYEKNATKWVYEGDKPCIIDFYADWCGP
    CKQVAPILRDLAILYKNDIVVYKVNVDKEKELAAAFGIQSIPTFLFIPKEGQPQISMGALPREEFVKQIDTFLLKKK

    >gi|150008417|ref|YP_001303160.1| hypothetical protein BDI_1798 [Parabacteroides distasonis ATCC 8503]
    MKKYLLASLLALLAFVGKAQEDNSDIVKVGDTMPSFTIVSDNGSKLQSASLKGKVILVNFFATWCPPCQKELAAVQQTLW
    PKYKNNKDFVLLVIGREHSDADLQKYNEKKGFDFPLYPDKDRAIFGAFAKNLIPRGYLVGKDGKIIYTSKGYTDEEFAEL
    MTKIEGALK

    >gi|150008439|ref|YP_001303182.1| hypothetical protein BDI_1821 [Parabacteroides distasonis ATCC 8503]
    MKYLYVLLLTLTVNACSGQRNQKTEESNVAPPTFEMVSVPTLITDPVERAEYLVKHYWDKFDFKDTTYIHEPQVTEQALS
    NYIDLMNYVSPAAMSSSVKAMMKQTEQDSAMFQYFSEMMEKYLYDPNSPLRNEEMYIAVLEYLTESSSLSDVEKIRPAHL
    LELALKNRIGTPATDFTYTLANGQTGKLYNIKADYLLLFFYNPD
    CHACQEITRQMESSFLINEFSKSNKLKILAVYPDED
    LDAWKEHVSVMPKDWINSYDKSVSLKNDEIYDLKAIPTLYLLNKEKKVLLKDATFQQIENYLSQTTN

    >gi|150008538|ref|YP_001303281.1| thioredoxin [Parabacteroides distasonis ATCC 8503]
    MGFIKVGAVLFASLLVGMANASNGNKNNNNKTENKMTVTELTQEDFVKKVYDFETNPNAWKFEGDKPAVIDFYATWCGPC
    KMMSPILDEISKEYEGKINVYKVNVDKEADLASVFGIRSIPSLLFVPMKKEPSMVQGAMPKNELKKLVDDILLESK

    >gi|150008592|ref|YP_001303335.1| thioredoxin [Parabacteroides distasonis ATCC 8503]
    MVVIDLTKDGFIANVGDFEANPKDWKYIGSRPCLIDFHAPWCGYCKRLSPILDEFAKEFDGKIYIYKVDVDQEEALETAF
    NIRTIPTLMFCPLDGPREMMIGTMGKLELKQLIQEKLLK

    >gi|150008648|ref|YP_001303391.1| putative methylated-DNA methyltransferase [Parabacteroides distasonis ATCC 8503]
    MKADFYTEVYNIVKEIPEGNVVTYGQLAKLARRPQCSRMVGQAMFNAPRELNLPCHRVVNSQGRLAPNWTEQRELLEKEG
    IAFKKNGCVDLKKHIWAEILPII

    >gi|150008650|ref|YP_001303393.1| putative peptide methionine sulfoxide reductase [Parabacteroides distasonis ATCC 8503]
    MKHLILFIALLVSNGLAIARTTMSDQLSKTTRMNTQSEIYFAGGCFWGTEHFMKQIDGVTNTRVGYANGKMSIKNPTYEQ
    VCNDNTGFAETVEVSYDPRQADLKLLIELFFKTIDPTSINRQGNDIGSQYRTGIYYTNTDDLPIIKETVEALAKNYTKPI
    VVEIQPLSNFYPAEDYHQDYLDKHPDGYCHISPDLFDFARKANKGKASNKPVSQKKFQKPDDQTLRSKLTAEQYAVTQQN
    ATERAFKNEYWNEKREGIYVDITTGEPLFISTDKFDSGCGWPSFSKPIDKSLVMEKTDLSHGMKRIEIRSKTGDAHLGHV
    FNDGPADKGGLRY
    CINSASLRFIPKAKMEEEGYADYLPLL

    >gi|150009396|ref|YP_001304139.1| hypothetical protein BDI_2804 [Parabacteroides distasonis ATCC 8503]
    MIKKLALIIGFIICLSSCGKDYVYRIEGELSNLEDQTVYAVFEKDNYKVVDTVVCTKPGQFQIDQNEAGFHCVTIFFADK
    EHWVTAYLEPGETVKITGDANSPLLLQVKGGRTNDKLTAFKKKIAPLLTELTNLSNSLNSKDLNDTIEETDIAARLANVN
    MQLSEEAIRYVKENPDEEVSVVLIQSFFSDPDDTRKIDELLALLNPRLKDFYLVKELEQYSARAKRTALGAEAPDFSVRN
    IYGNTVSLDSFPQKYLLLTFTAPW
    CDMCQTEDLYLDKVAMKYPKDQLDILLVSLDDNPDNVRDVLKKDSIAWNLVTDSAG
    QAAMLIDLYNVSVLPRCFLIDEDHKILMKTENGIEIKQTLENLFED

    >gi|150009638|ref|YP_001304381.1| alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase [Parabacteroides distasonis ATCC 8503]
    MKYDVAIIGGGPAGYTAAERAAQGGLSTILFEKNALGGVCLNEGCVPTKTLLYSAKTYDNIKHASKYAVKAENPSFDLPK
    IIARKNKVVKKLTAGIRMKMTEHGVVMVTAEACIQGRAADGTITIAAGEELYEAANLLI
    CTGSETVIPPIPGLAETEYWT
    SREALQSKELPASLVIIGGGVIGMEFASFFNSLGVEVHVVEMLDKILGPMDRELSEMLQAEYAKRGIKFYLSHKVTGVHG
    TEVSVEKDGETFTLHGDKVLLSVGRRPVTKGFGLETLAPETFRNGVKVNEYMQTSLPNVYACGDITAFSLLAHTAVSEAE
    VAVDHLLGKSRPMSYKAIPGVVYTNPEIAGVGKTEEELQAEGISYTVKKIPMAFSGRFVAENEMGNGVCKLILSEDETLI
    GAHMLGNPASELIVIAGIAIEKGMKSDELKSFVFPHPTVGEIIKEALY

    >gi|150009977|ref|YP_001304720.1| alkyl hydroperoxide reductase subunit C [Parabacteroides distasonis ATCC 8503]
    MEPIINSQLPEFKVQAFQNGNFKTVTNEDVLGKWAIFFFYPADFTFVCPTELVDMAEKYEQFKSMGVEIYSVSTDSHFVH
    KAWHDASETIRKIQYPMLADPTGALSRAFGVMIEEEGMAYRGTFLVNPEGKIKVAEIHDNNIGRDASELLRKVEAAQFVA
    SHDGEVCPAKWKKGEATLKPSIDLVGKI

    >gi|150009978|ref|YP_001304721.1| alkyl hydroperoxide reductase subunit F [Parabacteroides distasonis ATCC 8503]
    MLESTLKEQLKGIFAGLNANYTFDISISPAHESRQELLDLLGDVASCSDKISMRVSDGDGLEFILLKDGAKTGIKFRGVP
    NGHEFTSLLLAILNSDGKGKNFPDESICNRVKALNGPIHLTTYVSLT
    CTNCPDVVQALNAMTTLNPQIHHEMVDGAINQA
    EVDALKIQGVPSVFADGKLIHVGRGEFGELLSKLEAQYGINESLTEKTVKRYDVVVVGGGPAGASSAIYSARKGLSVAVV
    AERIGGQVKETVGIENLISVPETTGTQLADNLRLHMRQYPIDLLEHRRIEKVTIEGNEKVLSTAGGEIFKAPAVIIATGA
    SWRKLNVPGEAEYIGRGVAF
    CPHCDGPFYKGKHVAVVGGGNSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKAKSLP
    NVEIFVSSQTTEVVGNGDKVTGIRTKDRKTGEERVIHLDGIFVQIGLAANSGVFKEIVETNRPGEIVIDAHCRTNVPGIY
    AAGDVSTVPFKQIIISMGEGAKAALSAFEDRVRGVLD

    >gi|150010023|ref|YP_001304766.1| hypothetical protein BDI_3442 [Parabacteroides distasonis ATCC 8503]
    MKYLNLIILLLFLLACQDKKKDEIKHLVSEWQGKEIRFPKDMVFARFATDTVDFTLPKSPHKVLVFVDSIGCTSCKLQLH
    RWKELIQYTDSITQGTVPFLFFFQSDDKKEIRYLLKKDNFDKPICMDQSDRLNELNHFPADGRFQTFLLDKDNKVVVIGN
    PIHNPNIRELYLKEITGKQPASQIQTTVKVEEASIQLGTIQMGESKEAVFRLTNTGNNPLVILDAATT
    CGCARPSFDKHP
    AKPGEILQVRVIMTPKDKGVFDETISVKCNTNQLIKLNIRGMAQ

    >gi|150010064|ref|YP_001304807.1| thioredoxin [Parabacteroides distasonis ATCC 8503]
    MALQITDANFEELVNSGKPMVLDFWAEWCGPCRMVSPIIDELATEYEGRVTIGKMNVDENDDVVGQFGIRNIPTVLFFKD
    GKMVDKVVGATAKDKFVEKIEAMLK

    >gi|150010090|ref|YP_001304833.1| putative thiol-disulfide isomerase and thioredoxin [Parabacteroides distasonis ATCC 8503]
    METKKENKKGFWASLFSPKPCSCSCGSNLIIEEPEKPETSCCCGDKSSANNSGVTEIKILGPGCAKCKSTYQVIERVVSE
    NKLDVKLTKIEDIAEIMSYNIMATPAVVVDGTVKIKGHVPSESEVKQLLGI

    >gi|150010311|ref|YP_001305054.1| hypothetical protein BDI_3745 [Parabacteroides distasonis ATCC 8503]
    MLNIKRLILALTAIISITTAWAQQGAQILSDELTYNFGTIAEADGFASHTFTIKNTGDAPLVITRVTASCGCTRPEWTKS
    PIAPGKTGEVKITYNPKGRPGPFYKTVSIFSNGKKGSYSLAIKGNVTPKPSQPVFTYPYSIGDLKLHTKTVLFSSIRPEE
    TLGEKINIKNEGKTSATIHLGKVPHYLNVQVNPATLQPDEVGAITILMDAKVLKRKGRVSTLLPIMIQSAGKKEVSGEIQ
    ISANVIDNFSKLSAADKAQAPIAELSGTLLEFGKLPNKKSIVPLIGGKVSGTFEITNAGKTPLTIYSVTCDDERVDLSGG
    KKELKPGATATFKVTLRPKEIKTKLEALINVVCNDPNGPIRLIKVTAYK

    >gi|150010312|ref|YP_001305055.1| hypothetical protein BDI_3746 [Parabacteroides distasonis ATCC 8503]
    MKQIVFIFMAILLATGMASAQKKAVISAETTSFDFGTIKEADGKVSHTFEVSNTGDMPLVITRVIASCGCTTPEWPKEPV
    APGKKAQIKVTFDPAGRPGPFTKTISVYSNGKTGSFIMNIRGEVE

    >gi|150010358|ref|YP_001305101.1| thiol:disulfide interchange protein [Parabacteroides distasonis ATCC 8503]
    MKKLISSIMLALIALVAQAQILTPVKWKIKLDDKGGAPEKEIVFTATADKGWHLYDMNLPEGGPVSTSFTFETLNGAELI
    GQPVPSVKPTTVYDEQFAMNLRWYPGTVSFIQKLKVTDPAKFKVEGEVEFMACNDETCLPPDQIPFSFDKKSIHVDPALA
    ANSSTTEVDKEDATAIQPDTQVVAEEASELNTPDPAAKETPATTSPKASDSLTDSPNLWSPVIDQLKSFGDATVSAADTS
    WLFIFFAGFLGGLIALLTPCVWPMIPMTVSFFLKRTKDRKKAIRDAITYGLSIIVIYLVMGLLITGIFGASALNDLSTNA
    IFNILFFLLLVVFAVSFFGAFELVLPASWTSKLDSKADSTTGVLSIFFMSFTLVLVSFSCTGPIIGTLLVQAASMGTAVG
    PAIGMFGFALALSIPFSVFAIFPNMLQSMPKSGGWLNSVKVVLGFLELALALKFLSVADLAYGWRLLDREAFIVLWIVIF
    SLLGVYLLGKIKFSHDSEVKYVSVPRLFMAIISFAFAIYMVPGLWGAPLKAISAFAPPLYTQDFNLYKNEVHAAFDDYES
    GMAYAKKVNKPVMIDFSGFG
    CVNCRKMEASVWTDPKVKQMLENDYVLITLMVDDKTKLPQPIEIQENGKTRKLKTIGDKW
    SYLQRSKFGSNAQPFYILLNDEGQPLGPSYAFNEDVSKYIQFLQNGLKEFKKEQQ