Pantoea vagans C9 1 uid49871

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|298717229|ref|YP_003729871.1| glutathione peroxidase [Pantoea vagans C9-1]
    MSVFYKLTATSLNGQPVPMSDFAGKIVLVVNTASHCGFTPQYAGLETLYKKYADQGLVVLGFPCNQFGNQEPGGADEIAQ
    TCHINYGVSFPMFGKVNVNGTSTHPIFHYLKDELPGVLGGRIKWNFTKFLIGRDGKPIKRFAPTTTPEKMEAAILAAL

    >gi|298717260|ref|YP_003729902.1| thiazole biosynthesis adenylyltransferase ThiF [Pantoea vagans C9-1]
    MDRYQRQTMLPEIGEAGQQRLSRARVLVVGAGGLSATLLPLLAGAGVGFIRLYDGDRVELHNLHRQTLFGIGDVGQPKAI
    CAQRALAQRNPDCHVEAHPRMLSASQLPQALEGIDLVVDAADNFAITYQLSDACSPRDLPLICASVLGRKGFVGGFCGGA
    PGYRALFPQLPMASGN
    CNTAGVMGPAVATLGAMQAQMVLSVLLKLTPSPLGCMIHCDFVDWHVRQFRFDDAPESDAPDIP
    FIDKPMLSEDDCIVELRSPEEAPVSVAERVLRILPQQIAAWQPPSDRRVVLVCASGMRAAQAAENLAARGITRLALMAAN
    TL

    >gi|298717374|ref|YP_003730016.1| c-type cytochrome biogenesis protein [Pantoea vagans C9-1]
    MLTAIAAAFLGGIILNLMPCVFPVISLKALSLIRHHESPSHARAEGLAFLLGVVVTMVALTAVLLLARAGGASVGWGFQL
    QSPLVIAALILVMLGSALNLLGLFEVGLSIQRVGEVGGDRGGLVGSALTGALAIIVATPCSAPFMASAVGYALTQPPLVS
    VVIFISLALGFAAPFTLISFFPVLARILPKPGAWMITLKQGLAFPMLGAVGWLIWVLERQAGSAALAAILACCLLFSFAA
    WLYGMAQKRRMMGQRHVVLHVATTFFLALVVVPLLNLNSFATAPAETEAASPAAAAVAWSPQNVDAIKGQGKPILVNFTA
    SW
    CITCQVNDRTSLSTQAVKAAMARTSTIYMVADSTKYNPDVEQALSDFGRGGLPLYVVYPADGGKPVVLPQVLTPGIVI
    SALDQATEKGKKT

    >gi|298717375|ref|YP_003730017.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pantoea vagans C9-1]
    MKNTLKTLAVATLLALSVPATSAFAALQVGEKAPDFKLDAALAGKSTTFSLQQALKKGPVVLYFFPAAFSAGCTLEAHDF
    AEATDEFKKQGATVIGVTAGNTDQIAKFSQLECRDKFTVAADPGAKVAEEYKSTMEMKGQKVSDRTSYVIAPDGKILLSF
    TDKNPDTHIQKALDAVKKYRQANPA

    >gi|298717448|ref|YP_003730090.1| hypothetical protein Pvag_pPag30349 [Pantoea vagans C9-1]
    MSQPDDLITALADIDPASALAHARQTRHAATRHAQGSYNVLFDQGDDDFPLAERRLLAAKVAGWHARSELQAHYQPQQPV
    PDSDRISAALDFAHRLTFEPVAATPAHLETLKQAGWSPRGIVTLAQLVAFISFQSRLITGLRSLQGHEAAAEAAPVVAGH
    WHEALKTASGKTALTAFTQQELGWEPWLPARPLAEFSKEEQAILAKFGHTDSDYFRLLGRNLPLLEQRTLTDKGIFYTAG
    GLPRAERELAATVVSKVNGCIY
    CASVHARKASQLSKQDDAIQKLLNVAPGAVLSHGHTARWQAIIAFSAALSLTPAQPTQ
    SQIAALREQGLDTLDLLDLIQSTAFFAWANRLMLTLGEPFLPE

    >gi|298717481|ref|YP_003730123.1| hypothetical protein Pvag_pPag30382 [Pantoea vagans C9-1]
    MIPSVNLKPLHWHPYITPVDVEQATPAQLDAMKVTPSNKKISEYVRTLVHDPESYTARTGLFNAIMYVEGGLDRADRELG
    ALGASIVNGCRY
    CAVVHARRHVQLADSDAVVSAIYFDRADILGKRDAAIYHFARRLSVTPSEATPDDVAALRAVGMNDQE
    IIDLIHAIAIFGWANRLMHVLGHADLNK

    >gi|308185687|ref|YP_003929818.1| dihydrolipoamide dehydrogenase [Pantoea vagans C9-1]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALEEHGIVFGQPS
    TDINKIRSWKEKVINQLTGGLSGMAKGRKVTVVNGLGKFTGANSLVVEGEGGATTINFDNAIIAAGSRPIELPFIPHEDP
    RVWDSTDALELKEVPKRLLVMGGGIIGLEMATVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKKISKKFNLMLETKVTA
    VEAKDDGIYVSMEGKKAPGEAQRYDAVLVAIGRVPNGKGLDAGKAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKLI
    FDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNAKAKKK

    >gi|308185730|ref|YP_003929861.1| hypothetical protein Pvag_0192 [Pantoea vagans C9-1]
    MSDEVVALPLQFTDAAATKVKNLIADEENPALKLRVYITGGGCSGFQYGFTFDDQLNDGDMTIEKQGVSLVVDPMSLQYL
    VGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI

    >gi|308185833|ref|YP_003929964.1| Osmotically inducible protein [Pantoea vagans C9-1]
    MTIHKKGSAHWEGDIKGKGTVSTESGVLSQQPYGFNTRFEGVKGTNPEELIGAAHAACFSMALSLMLGNAGHKPESIDTT
    ADVSLDKKGEGFAITKVALTSTISLPGIDESTFDEIINKAKAG
    CPVSQVLNAEITLDYTLNN

    >gi|308185956|ref|YP_003930087.1| copper-transporting ATPase [Pantoea vagans C9-1]
    MSHTISLALDGLSCGHCVKRVKEALEKRDDVDQAEVTQQEAQVSGHADAAALIATVEQAGYHATLKTADASPKSEPLTAS
    EPPPEALTTETPSHPAEKTLPAHMLLIEGMT
    CASCVSRVEKALQQVTGVSQARVNLGERSALVLGDADPQQLVAAVDAAG
    YGAQVVDDEQERREKQQHSARSAMRRFSWQAAVALAFGVPLMVWGMVGDNMMLTDHNHGIWLTLGIVTLLIMVVTGSHFY
    RSAWRSLRNGSATMDTLVALGTGAAWIYSFSVVLWPDFFPPQARHLYFEASVMILGLINLGHALEQRARQRSSKALERLL
    DLTPAQARLVDPRGDRLIAVSDVQPGMTLRLVTGDRVPVDGDITTGEAWFDEAMLTGEAVPQSKSPGAAIFAGTLVQDGA
    IEFIARATGNHTTLSRIIRLVRQAQSSKPDVGRLADRISAVFVPVVVLIALLSGAVWYLFGPQPQIAYMLVIATTVLIIA
    CPCALGLATPMSIIAGVGRAAELGVLVRDADALQRASQIDTLVFDKTGTLTAGKPQVSEVLVWGNASRESVLTTAAALEF
    ASGHPLAKAIVAEAKLTQPASLTQFRTIRGKGVSGSLDGRALLLGNAALLQDNGVDYRAAEAAITRLTQQGATPVLLAEQ
    GQLTGLIALRDRLRPESSAALKRLHQQGYRLIMLTGDHESTARAIAAETGIDEVIAGVLPEGKAAAIEQLQQQGRRVAMV
    GDGINDAPALAQADVGIAMGGGSDVAVETAGITLMRADLNSVADALALSSATLRNIRQNLFGAFIYNSIGIPVAAGVLYP
    LTGTLLSPIVAGAAMALSSITVVSNANRLLRYRPPRQ

    >gi|308185960|ref|YP_003930091.1| hypothetical protein Pvag_0429 [Pantoea vagans C9-1]
    MSPHASIIDINESNLQQTLEQSMQLPVLFYFWSERSQHCQELTPVLERLAQEYAGQFILAKLDCDKEQRVASQFGLRSIP
    TVYLFQDGQPVDGFQGPQPEEAIRALLEKVLPREEELKAQQAMALMQEGKPLEALPLLKDAWQLSNQSSEIGFLLADVLI
    TLNRSDEAEAVLKVVPLQDQDTRYQSLMAQIDLLKQAADTPEIQQLQSELEADPSNAGLAAKLSLQLHQVGRNEEALELL
    FSFLKSDLNAADGQARKMLQEILAALGTGDALAARYRRQLYSLLY

    >gi|308186088|ref|YP_003930219.1| methylated-DNA--protein-cysteinemethyltransferase [Pantoea vagans C9-1]
    MYYFKPIATPVGELKLVASDSGLAGILWENDDPKRTRFLPQTRNDDHPILIETERQLSEYFTGERRCFELPLDMVGTDFQ
    KKVWQALVAIPFGETRSYSQIAREIGHPQAVRAVGTANGRNPLSIVAP
    CHRVIGANGKLTGFAGGLDIKAFLLTLEAPQS
    LIDKAASEPVQLVIQAD

    >gi|308186193|ref|YP_003930324.1| Molybdopterin biosynthesis protein moeB [Pantoea vagans C9-1]
    MLPELRDEEMLRYNRQIVLRGFDFEGQERLKASHALVVGLGGLGCAAAPYLTSAGVGNLTLLDFDTVSHSNLQRQILHHD
    ADIGRAKVDSAAQSLAAINPHCQLHPVNGQLDDAALLALIAQQQVVLDCTDNVAVREQLNRLCRQQRVPLVSGAAIRMEG
    QISVFNWQPGTPCYRCISRLFGEQTLS
    CVEAGVMAPLVGVIGAMQAMEAIKVLTSFGAPATSRLLMYDAMSAEFRSMKVA
    QDAHCEVCGGGASKTSAS

    >gi|308186211|ref|YP_003930342.1| glutaredoxin [Pantoea vagans C9-1]
    MIAVIFGRPGCPYCVRAHELADKLTAERDDFSYQYVDINAEGITKADLEASAGKPVSTVPQIFVDEKHIGGYTEFAAWTK
    ENLGFVA

    >gi|308186242|ref|YP_003930373.1| Thioredoxin reductase [Pantoea vagans C9-1]
    MSTAKHSKLLILGSGPAGYTAAVYAARANLNPVLITGLEKGGQLTTTTEVENWPGDPHDLTGPSLMERMHEHAEKFNTEI
    IFDHIHTVDLQNRPFTLTGDSGVYTADALIIATGASARYLGLPSEEAFKGKGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLANIAAEVHLIHRRDSFRAEKILIDRLMEKVRNGNIVLHTHRTLEEVTGDQMGVTGLTLRSTQNSDETEALEVAGL
    FVAIGHSPNTAIFEGQLALENGYIKVQSGLHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERFLDGLVKN
    DR

    >gi|308186373|ref|YP_003930504.1| UPF0176 protein [Pantoea vagans C9-1]
    MPVLHNLVSNKELKARMLAETEPRTTVSFYKYFQIADPKAFRDALYLGLTSLKVFGRVYVAHEGINAQISVPASQYEKMK
    TWLYGFDPALNNLRMNIALDDDGKSFWVLRLKVRDRIVADGIEDESFDASDVGQYLKAAEVNAMLDDPDALFVDMRNHYE
    YEVGRFDNALEVPADTFRDQLPMAVDMLQDQKDKKIVMY
    CTGGIRCEKASAWMRHNGFEDVYHIEGGIIEYARRAREQGL
    PVRFKGKNFVFDERMGERISDDVLSNCHQCGEPCDTHVNCVNDGCHLLFIQCKSCAEKFENCCSPICQEEAKLSPEEQRA
    RRAGRENGNKIFNKSRGLLNMTIPSPVKK

    >gi|308186382|ref|YP_003930513.1| glutaredoxin-2 (Grx2) [Pantoea vagans C9-1]
    MKLYIYDHCPFCVKARMIFGLKNKPVELVVMLNDDEETPKRLIGQKMAPILQKQDGSAMPESMEIVHYVDQQDGAPLITG
    ALNPAIGDWLRHMNSYVNKLLLPRIAEAAFAEFATPEARAYFRSKKQASLGDFETLKSHSAGLIKNVSEDLRKLDKLIVQ
    PNAVNGELSEDDFNLFPLLRSLTLVAGIDWPSRVADYRDNMAKQTQVNLLSSIAH

    >gi|308186654|ref|YP_003930785.1| ABC superfamily (binding protein), vitamine B12 transport protein [Pantoea vagans C9-1]
    MNIYETELVTLDGEKTTLSQWQGKVLLVVNVASKCGLTPQYEELENLQKAWQDQGFSVLGFPCNQFLEQEPGSSEEIKTF
    CSTTYGVTFPLFAKTEVNGPARHPLYAQLIAARPDAVRPEGSGFYERMESKGRAPKEQGDILWNFEKFLIGRDGSVIQRF
    APDMTPEDPIILETIKQALAK

    >gi|308186658|ref|YP_003930789.1| UPF0061 protein [Pantoea vagans C9-1]
    MSAGKASFDNTWFRELTGCYTALNPTPLAGGRLLYHNAPLATSMGLDSALFEGHGHDVWHGAALLPGMQPLAQVYSGHQF
    GVWAGQLGDGRGILLGEQRLDDGSKLDWHLKGAGLTPYSRMGDGRAVIRSSVREFLASEALHHLGIPTTRALTLSIGDEP
    VYRETTERGAMLMRISPSHLRFGHFEHFFYSQQQEKVQQLADYAIRHHWPHLEEEADRYQQWFTDIVLRTARLIALWQSV
    GFAHGVMNTDNMSILGLTIDYGPFGFLDDYQPDFICNHSDYQGRYSFENQPMIGMWNLNRLAHALSGLLTTEQLRTALSA
    YEPELMRVWGERMRAKLGLLTQQSSDNQILTDLLALMTQEHSDYTLTFRLLSETQQAESRSPLRDEFIDREAFDGWYQRY
    RSRLMDEQVSDEERQTVMKAANPAVILRNYLAQQVIEEAERGEQGALARLHQALQRPFSDETAAEYRQRPPDWGKTLEVS
    CSS

    >gi|308186665|ref|YP_003930796.1| Iron-sulfur cluster biosynthesis protein sufA [Pantoea vagans C9-1]
    MASVNTDSFSPDDFVWKGLTLTETAAQQILNLAAQDPDVKGLRLGVKQSGCAGFGYVMDLVKEPVEDDLQFSFHGATLFV
    PLQAMPFVDGTELDYVREGLNQIFKFNNPKAQHACGCGESFGVE

    >gi|308186682|ref|YP_003930813.1| glutaredoxin-4 (Grx4) (Monothiol glutaredoxin) [Pantoea vagans C9-1]
    MSTVEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV
    GGCDIIVEMLQRGELQSLIKETAEKFKEAE

    >gi|308186743|ref|YP_003930874.1| Electron transport complex protein rnfE [Pantoea vagans C9-1]
    MSEAKSLLVGGLWKNNSALVQLLGLCPLLAVTATATNALGLGLATTLVLTLTNSFISASRRWVPSEIRIPIYVMIIASVV
    SCVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVVGRAEAVASKSSIPLSALDGFAIGMGATCAMVVLGSLREIIGSGTLFNG
    ADQLLGPWAKSLRIEVVHFDSPMLLAMLPPGAFIGLGMMLACKYLIDQKMKQRAALRAQAAETAAPQNVVGKPV

    >gi|308186748|ref|YP_003930879.1| Electron transport complex protein rnfA [Pantoea vagans C9-1]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVITLASICAWLVNHLILLPLDLVYLRTMAYILV
    IAVVVQFTEMVVRKTSPSLYRLLGIFLPLITTN
    CAVLGVPLLSVNLNHTFMQAALYGFSASIGFSLVMVLFAGMRERLVL
    ANVPAPFKGNSIALITAGLMALAFMGFSGLVKF

    >gi|308186958|ref|YP_003931089.1| thiol peroxidase [Pantoea vagans C9-1]
    MSQTVHFQGNAVPVAGQFPQAGDKAKAFTLVAKNLVNVALSEYAGKRKILNIFPSVDTGVCASSVRKFNQAASELNNTVV
    LCISADLPFAQSRFCGAENLSNVVTLSTLRGSEFKYDYGVEIADGALEGLTARAVIVLDENDKVIYSQLVDEITTEPDYD
    AALAALK

    >gi|308187057|ref|YP_003931188.1| peptide methionine sulfoxide reductase [Pantoea vagans C9-1]
    MAKDTAPEAKIAQLTEMQRYVTQHRGTEPPYSGALLHNKQEGIYHCLVCEAPLFLSETKYDSGCGWPSFYQPVNDDAIRY
    IEDNSHGMQRVEIRCGSCDAHLGHVFPDGPQPTGERY
    CVNSASLNFTDEQGEQTKG

    >gi|308187073|ref|YP_003931204.1| disulfide bond formation protein B [Pantoea vagans C9-1]
    MLRYLNQCSRGRGAWLLLALTALALELTALFFQHVMGLKPCVMCIYERNALFGVLGAGLVGAIAPKSPLRLGALALWIYS
    AWEGLRLSYEHTMIQLHPNPFTT
    CDFAARFPSGLPLDKWLPSVFLASGDCAERSWTFLTLSMPQWMIGVFAGYLLVAVLV
    LIAQPFKPKRRDLFGR

    >gi|308187245|ref|YP_003931376.1| Peptide methionine sulfoxide reductase [Pantoea vagans C9-1]
    MAIEYAVIAGGCFWCTEAVFKDVIGVESVESGYTGGARPNPTYEQVCSGATGHAEAIRIGFDPEQVTYGDLLDISFVTHD
    PTQLNRQGNDIGTQYRSAIFPANAEQEAEARAAIERAQADHDVPVVTTIEPLKEWYPAEAYHQDYWEGAGQRNGYCMAVI
    PPKLQKLRKSFANRVKS

    >gi|308187513|ref|YP_003931644.1| alkyl hydroperoxide reductase subunit F [Pantoea vagans C9-1]
    MLDTNLKTQLKAYLEKLTKPVELIATLDEGAKSTEIRELLVDIAGLSEKVSFREENDRQVRKPSFLITNPGSNSGPRFAG
    SPLGHEFTSLVLALLQTGGHPSKEAQSLLDQIAALDSDFHFETYYSLS
    CHNCPDVVQALNLMAVINPRISHTAIDGGLFQ
    NEIQDRNVMGVPAVYLNGKEFGQGRMSLAEIVSKVDTNADKRAAEELNKRDAYEVLIIGSGPAGAAAAVYSARKGIRTGL
    LGERFGGQVLDTVDIENYISVPKTEGAKLAGALRAHVDDYNVDVIESQSAIKLIPAAKEGGLHAIETASGAVLKSRSIIL
    ATGARWRNMGVPGEEEYRTKGVTY
    CPHCDGPLFKGKRTAVIGGGNSGVEAAIDLAGIVEHVTLLEFAGEMRADQVLQDKL
    RSLKNVDVILNAQTTEVKGDGTKVTGLHYIDRTTQTTHELPLSGIFVQIGLLPNTPWLEGAVERNKMGEIIIDGKCETSL
    KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTKSAE

    >gi|308187514|ref|YP_003931645.1| alkyl hydroperoxide reductase, C22 subunit [Pantoea vagans C9-1]
    MSIINTKIKPFKNAAFKNGEFIDVTEKDVEGKWSVFFFYPADFTFVCPTELGDVADHYEEFQKLGVDIYSVSTDTHFTHK
    AWHGSSDTIAKIQYAMIGDPTGALTRNFEIMREDEGLADRGTFIVDPEGVIQAIEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|308187633|ref|YP_003931764.1| UPF0176 protein [Pantoea vagans C9-1]
    MSSVLQIPAATPQQSLDYLQAKLAYYTDAWDLAEDLARQAPEIVVIDARAPEAYRAGHICGAISFPHRGMDTTTTARLDR
    SKVFVTY
    CDGIGCNGSTKAAWKLASLGFQVKELIGGLDFWKRDGHPLTWGDAAGEWPAAAPIASCGC

    >gi|308187653|ref|YP_003931784.1| Cytochrome c biogenesis protein ccmG [Pantoea vagans C9-1]
    MNKKILFIPLMLFLLLAAALLWQLTRNADGDDPTRLESALIGKPVPLFRLEALDQPGKTYDQRVLTDGKPILLNVWATWC
    PTCRAEHHYLNTLAEQGIRVVGLNYKDDRQKAVNWLNTLGNPYALSLYDGNGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNARVWEQEVKPLWMKYSAEAGS

    >gi|308187719|ref|YP_003931850.1| Protein yffB [Pantoea vagans C9-1]
    MSTQWVMFGIKNCDTIKKARRFLTDAGIDYHFHDYRADGLSDALLQEFIDALGYEALLNTRGTTWRKLPEADREAVNDAS
    SAKALMLVHPAMIKRPLLRAPDGSLLAGFSEATYQNAIQEKL

    >gi|308187729|ref|YP_003931860.1| bacterioferritin comigratory protein [Pantoea vagans C9-1]
    MNPLKAGDTAPAFSLPDQDGEHVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVEVLGISTDKPEKLSK
    FVEKELLNFTLLSDENHEVCQAFGVWGEKTFMGKTYDGIHRISFLIDAEGRIEKVFDNFKTSNHHDMVLDYVKSA

    >gi|308187740|ref|YP_003931871.1| Regulatory protein spx [Pantoea vagans C9-1]
    MVTIYHNPRCSKSRETLALLNARGIEPEVVLYLQTPPDRETLQILLQKLGMQSARELMRTKEAIYSELALGDKNENALLD
    ALVENPVLIERPIVINGDKARIGRPPEAVLDII

    >gi|308187777|ref|YP_003931908.1| thiosulfate sulfurtransferase [Pantoea vagans C9-1]
    MTTPLFVSADWLQEHYNDERLQVLDARLLPPGMEAVRDVQAEYLAGHLPDAPYFDIEALSDHTSPYPHMLPRAETFAVAM
    RELGVSSDKHLVVYDEGNLFSAPRAWWMLKTFGVAQVSILAGGLQGWKEAGFALATGDVNLPEGEFEAHADESRVKRLTD
    VLLISHEGGAQIVDARAANRFNAEVDEPRPGLHRGHIPNSLNVPWNTLVEQGKLKPEAELRRLFANAGVDITQPVVAS
    CG
    SGVTAVVLILALTALGARDATLYDGSWGEWGSRDDLPIVK

    >gi|308187848|ref|YP_003931979.1| glutaredoxin-like protein nrdH [Pantoea vagans C9-1]
    MRIIIYTKDNCVQCTATKNAMDRQGLAYQLINLDSQPEAIDNLKTLGYRQVPVVMADNDHWSGFRPDKIATLRQLAAVGG


    >gi|308187857|ref|YP_003931988.1| thioredoxin-like protein [Pantoea vagans C9-1]
    MNTVCASCQATNRVPDERLADVAKCGRCGNELFDGEVVNATSANFDKYLQDDLPVVIDFWAPWCGPCVNFAPVFKDVASE
    RSGKVRFIKVNTEAEPALSARFNIRSIPTIMLFKNGERVDMLNGAMPKAPFNEWLDESL

    >gi|308187996|ref|YP_003932127.1| protein disulfide isomerase II [Pantoea vagans C9-1]
    MNKHFAMLALLASAFSGLAQADDSAIQQSLKKLGLNQTEISPSPLPGFKTVLSESGVLYVTDDGKHMIQGPLYDVSGKQP
    VNVTNQLLDKKVEALVPEMIVYKAPKEQHVITVFTDIT
    CGYCHKLHEQMADYNALGITVRYLAFPREGLNGQIEPAMKAI
    WCSADRNKAFDEAMKGNAPKMAAPDSCKIDIAQHYKLGVLFGIQGTPAMLTDTGMMIPGYQSPQELKQVLDNQKRGG

    >gi|308188064|ref|YP_003932195.1| selenoprotein W-related protein [Pantoea vagans C9-1]
    MAQKPVVVIHYCLQCNWLMRSAWMAQELLHTFAEDLAEVTLKPGTGGIFEITLDGHLLWERKRDGGFPDATTLKQRVRDI
    CFPDRTLGHIDKNKSEIS

    >gi|308188433|ref|YP_003932564.1| thiosulfate sulfurtransferase [Pantoea vagans C9-1]
    MRDSMEMFECINVQQAQAHLAEGALLVDIRDPQSYALGHAAGALHLTNTNLSDFVSGADHSLPVLVMCYHGNSSKSAAQY
    LLGQGFSAAYSIDGGFDAWRAAFPQQVALGSE

    >gi|308188484|ref|YP_003932615.1| heavy metal-transporting ATPase [Pantoea vagans C9-1]
    MDCPGCARTIETAVRQVKGVTDARVLFSSEKLVVNADNDVQSAVERAVKKAGFRLATPSETPSVSSRWQQNRILILLALL
    VLASSVLSQFAPVWGDRLFVLTTLVGLVPVARGAWQRLRSGSPFTIETLMTLASAGALIIGAHAEAAMVLVLFQLGEQLE
    NYAASRARSGVTSLMALRPESAIRLEQGKRSEVPLAALQLGDVIEVAAGSRLPVDGCLISPLASFDESALTGESLPVTRA
    SGEKILAGATSVDRLVTLEVVSKPGESAIDRILQLIEEAETHRAPVERFIDQFSRIYTPLVMLLSLLVMVVPPLLFAGDW
    QPWIYKGLTLLLIGCPCALVISVPAAITSGLAAAARQGALIKGGAALERLSSLRRMAFDKTGTLTLGKPQLTQILRFGTA
    SESEMLALSAAAEQGATHPLASAIVAAAQARDLVIPDAQDQQVQAGRGISARVSGQQIQLLTPGHPPGLTPQQSAQIAQQ
    EAEGETLVVLMRDGEALGALALRDQLRDDAVEALKALKKLGIESLMLTGDNPRAAATIARQLDIDYRASLLPADKVAAIR
    ELSQQQPLAMIGDGINDAPAMKAATLGIAMGSGTDVALEAADAALTRNQLSNLAPMIALARRTRRIIRQNIGIALGLKAI
    FLVTTLLGLTGLWLAVLADSGATALVTANALRLLRRRD

    >gi|308188525|ref|YP_003932656.1| glutathione oxidoreductase [Pantoea vagans C9-1]
    MDTSMTRHFDYLAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKIMWHAAQIAEAIHLYGPDYGFDTTV
    NRFDWATLVKNRSAYIDRIHSSYDNVLGKNKVEVIKGFARFVDAHSVEVNGEIITANHILIATGGRPVHPSIPGAEYGID
    SDGFFELDALPKRTAVVGAGYIAVELAGVVNALGSETHLFVRKHAPLRSFDPLLTETLVEVMNTEGPALHTEAIPKAVVK
    NSDGSLTLQLENGSDYTVDCLVWAIGREPETDNLNIQAAGVALNEKGYISVDKFQNTNVSGVYAVGDNTGAVELTPVAVA
    AGRRLSERLFNNKPDEHLDYSNVPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTAMYTAVTQHRQPCRMKLVCV
    GADEKIVGIHGIGSGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|308188587|ref|YP_003932718.1| soluble pyridine nucleotide transhydrogenase [Pantoea vagans C9-1]
    MQKSYDYDAIVIGSGPGGEGAAMGLVKQGARIAVIERYHNIGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHTRLLR
    SSFADILNHTENVISQQTAMRQGFYERNRCELYQGDAHFVDANTIEIEQPDGTRETLTAEKFVIACGSRPYHPDDVDFTH
    PRVYDSDSILNLHHEPGHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEF
    EKIEGVEDGVIMHLKSGKKVKADCLLYANGRTGNTDSLSLENVGLEADGRGLLKVNSMYQTAQPHIYAVGDVIGYPSLAS
    AAYDQGRIAAQAIIKGEASAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKNGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|308188589|ref|YP_003932720.1| peroxiredoxin/glutaredoxin family protein [Pantoea vagans C9-1]
    MFASQEGKAIPSVTFHTRQGDRWVDVTTEALFKDKTVIVFSLPGAFTPTCSSSHLPRYNELAGLFAQQGVDSILCVSVND
    TFVMNAWKAEQRADNITFIPDGNGEFTRGMEMLVEKADLGFGPRSCRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    RYLAPECKAQESVSIFTKPG
    CTFCTQAKQMLMDHGIQYEEIVLGQDATTVSLRAVSGRATVPQIFMGGRHIGGSEELQHY
    LLSA

    >gi|308188633|ref|YP_003932764.1| glutaredoxin-C6 (glutaredoxin-C2 1) [Pantoea vagans C9-1]
    MANVEMYTKATCPYCHRAKALLTQKGVSFQEIPIDGDMAKREEMIKRSGRTTVPQIFIDAQHIGGCDDLFALDNREGLDP
    LLQA

    >gi|308188634|ref|YP_003932765.1| UPF0176 protein [Pantoea vagans C9-1]
    MQEIMQFASNHPILSLAWVVLLVMVIVTTVKGMFSKVKTISRGEATRLINKEDAVVVDVRSRDDFRRGHISGALNVAAAE
    IKKGNLDELAKHKAQPIIVV
    CATGQSAGDSAAHLSAAGFEQVSVLKEGISGWSGENLPLVRGK

    >gi|308188690|ref|YP_003932821.1| Thiol:disulfide interchange protein dsbA precursor [Pantoea vagans C9-1]
    MKKIWFALMGLVLAFSASAAQFTEGKQYVSLPKPVASEPQVMEFFSFFCPHCYQFERIYHVNDAVKKNLPADTKLVKYHV
    DFLGGDLGPVVTQAWAVAMALGVEDKVTAPIFDGIQKTQTITDPASLKEAFVKAAGISAADYDAAWNSFAVKALVAQQQK
    AAADVDLRGVPAMFVNGKYMVNNGGLDTSSMDNFVADYANVVKFLVSQK

    >gi|308188800|ref|YP_003932931.1| hypothetical protein Pvag_3344 [Pantoea vagans C9-1]
    MSLEQVVYRAKAKATGGRDGRATSSDGVLDVKLGVPKEMGGAGGEVTNPEQLFAAGYSACFLGAMKFVAGRDKIAMPKDA
    WIEGEVGIGPIPDGFGIEATLNIHLPEMDEAEAQKLVDAAHIV
    CPYSNATRNNIDVTLNIIR

    >gi|308188836|ref|YP_003932967.1| Thioredoxin (Trx) [Pantoea vagans C9-1]
    MSSDKIVHLTDDSFDTDVLKADGVTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKLNIDDNPGTAPKYGIRGIPTL
    LLFKNGEVAATKVGALSKGQLKEFLNANLA

    >gi|308189041|ref|YP_003933172.1| Thiol:disulfide interchange protein [Pantoea vagans C9-1]
    MAARISRLITLLLTLFICLQAHASLFSNPATSRFVPVDQAFTFDFDQQGAQLNLHWKVKPGYYLYRQQIHITPQNATIAP
    LTLPAGQPHEDEFFGKSEIYPQDLTLPVTLKQAGPDATLSVTYQGCAAAGFCYPPETRSVPVSEIAASSAPAPVSAQPAP
    ASPLPFSPLWALLIGIGVAFTPCVLPMYPLISGIILGGKRNYSLGRLFALAMVYVQGMALTYTLLGMVVAAAGLRFQAAL
    QHPYVLFTLSLLFIVLALSMFGLFTLQLPASLQTRLTLWSNRQQGGSLPGVFLMGALAGLICSPCTTAPLSAILLYIAQS
    GNLWAGAGTLWLYAVGMGLPLIAVTLFGNRLLPKSGPWMQTVKEGFGFVILALPVFLLERVLGDAWGVRLWSLLGVAFFG
    WAFTVSLHASSGKWRVVQIIMLAAALISARPLQDWAFGGQAAQHAVAPLPFQTLQTPQQLNSALQQARGRITMVDLYADW
    CVACKEFEKYTFSDSAVRDSLSQVQLLQANVTANSASDNVLLQHLQVLGLPTILFFDAQGHEVPGSRITGFLNAADFRAH
    LQKLTP

    >gi|308189373|ref|YP_003933503.1| hypothetical protein Pvag_pPag20167 [Pantoea vagans C9-1]
    MKNTFKMASIALAMSTALFTVQAGAAGADAFTPEQQVRIGEIAADYLVAHPDVLIEVSKKLQARQQAMQQQAYVQSALKT
    HRLLIQLDGVPVKGPADSKVIVTEFFDYE
    CIACSMMAPVMEKVMAANAGVRFAFRDWTIFAARYPESEQSSRRGLGIYRK
    QGADAYMAFHNGIYRTGHNEGKLTAEDIEKVAAAAGADEASEEDKTVSDHITENNAALAEMLGLTGTPGIIVMPAENATA
    QNITVIPGVVSEGVLQQAIALAAAKGL

    >gi|308189401|ref|YP_003933531.1| hypothetical protein Pvag_pPag20195 [Pantoea vagans C9-1]
    MQIQTAQYDLVTSWQGGMTSRTLCRYFSADNPPPVPQSHVIDSDEPVSLGGEGLAPDPRALMLAAVNACMMAAFIQEARA
    EGLALTQLEIHTDGHLPKGIAATGDIPAEDASGRLQYVICVSGDGTMHQFEGIHQSPL