Paludibacter propionicigenes WB4 uid60725

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|313202512|ref|YP_004041169.1| thioredoxin [Paludibacter propionicigenes WB4]
    MTGNFDSIINENRPVIVDFHAVWCGPCKTQSPILKQVAEELGERVRVIKIDVDKNQAIAGRYQIQSVPTLMIFKNGEIKY
    KQAGVHTKAQLTNILHNIQ

    >gi|313202519|ref|YP_004041176.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MENIIKNIWFILFIVWGLPLGYYRSRFRKLVYRTDSWTINIKPVFRTELRGLFGNLFPGNKLYAKSRNFYLFYLSVYALL
    FIVYLNTDTKKGVQVGDKVPSFELQDQYGKPFALDSVLGKKNLVIYFYPKDDSPG
    CTKEACSFRDQYEVFRDADALIIGI
    SAQSVSSHLEFAKKHRLNYTLLSDSDNKVRKTFGAEGKIFGLIPGRITYVISKEGKVLYIFNSQVQAEKHVDEALRILKQ
    LK

    >gi|313202526|ref|YP_004041183.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKKLISVVLSMVFCICIYAQTSVLTLSPSKIEAGKDVRFTYTGKLAMKGTKIAVRLYNSKAFTDKVVKTKLTGKSITGSF
    NVPDTTTYVSFVITNGDKTDIKDKESVGYDYLVYKAGKPVKGTYLVKGALLSSKGGGNKALELIEKEYTLFPEQREKTYY
    NYLYAMLGIKERKAEVIALAQKHFDKVLQTATDDNDLSIYIRLIYDGSIKKRDSLEKEVVRKFPKGSTSFMLKLEKLYSQ
    KDPDSTLVMLSALQNEFPDRCKTSKQTIDNILLNTYRKKKDYVNFDKVVSSIKDKQVKAQQYNQIAWEMATTDTNLALAK
    SYSEKCIATMDSVLKYEKPADAGYLKEWEERQAYTQGNNYDTYGYILEKQGNIKEAAEKEQLGVVLSKSNNTYMNEQLMK
    YLITLNQPKEALTWGEKFLSTDKSSAKLDSLYDVAYIRLNGSTTGLAAAKAKLALKLKPAPDFTLKTLDGKTVKLSSMRG
    KIVVLDFWATW
    CGPCLASFPGMQKSIDALKDNKDVCFYFINTSERTSADTRIKEVKQTLETKKVKFDVLLDEQQGDDFMV
    AKLYKVNSIPTKIVIDKNGKIRSTTVGYSGNDDELVNGFKKIAEVLK

    >gi|313202551|ref|YP_004041208.1| peroxiredoxin [Paludibacter propionicigenes WB4]
    MKHYSIILCLLLIGAFSTKAQEKSTSTDFYSFKSTNIQGQNVSMKAFKGKVVLIVNTASKCGYTPQYEGLEKLYKTYKNR
    GLVILGFPCNQFGNQEPGSAEEIAKFCTLKYDVTFPMFMKIDVNGENADPLYKYLKASLPDNGTGDIKWNFTKFLLDKNG
    KPIKRYASAIKPEELAADIEKLLL

    >gi|313202553|ref|YP_004041210.1| peroxiredoxin [Paludibacter propionicigenes WB4]
    MNTNFHQFTATSLQGKEIAMVDYKDKVIIVVNTASKCGLTPQYEGLEKLYKDYKDKGLVILGFPCNQFGKQEPGTEKEIS
    EGCLINYGVSFPMFSKIEVNGKNTHPIYAYLKKELKGTFGNNIKWNFTKFIIDKNGNPYKRFAPVTTPEKLRKHVEDLLK
    K

    >gi|313202696|ref|YP_004041353.1| thioredoxin reductase [Paludibacter propionicigenes WB4]
    MNEKVRCLIIGSGPAGYTAAIYASRANLSPVLYEGMQPGGQLTTTTEVENFPGYPSGTTGTELMEDLKKQAERFGADIRF
    GAATATDLSAAPYKVTIDGEKVIEAETIIISTGATAKYLGLPDEQKYAGSGVSA
    CATCDGFFYRKLTVAVVGGGDTACEE
    ATYLAGLASKVYLIVRKNFLRASKIMQERVLSNPKIEVLFEHETLGLTGENVVQGADLVKRRGQSDEEKVHIDIDGFFLA
    IGHKPNSDIFKPWIETDEVGYIKTIPGTPRTNVSGVFAAGDVSDPHYRQAITAAGTGCQAAIEAERYLSEKGL

    >gi|313202744|ref|YP_004041401.1| thioredoxin domaiN-containing protein [Paludibacter propionicigenes WB4]
    MKKIFQILLVGLLFSTVALAQKSANVEIVELNAKSFKEKVWNFDKDKSFKRIGNLPIILDFHATWCGPCKILSPHLQLIQ
    NKYKGKLIVYKIDVDKDPELAQRFKVNAMPTMIFIGMKDKYKPEVGYSGDYSELEKMVKTNLSLN

    >gi|313202760|ref|YP_004041417.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKKIGLIIFSLLLMAGQTKVAAEKGYKIGDSAADFKLKNIDNKTVSLANYTSAKGFIVVFTCNHCPYAKAYEDRIIALNK
    KYAHLGYPVIAINPNDPKAEPSDSFEAMQVRAKEKGFTFPYLFDDGQKIYPLFGATKTPHVFVLNKENGKNIVRYIGAID
    NNYSNPADVSQKYVEAAVDALLTNKPIAQSTTVAIGCSIKSQKK

    >gi|313202761|ref|YP_004041418.1| redoxin domain protein [Paludibacter propionicigenes WB4]
    MKYYIIVLLTIITLDGFAQQKVSSGYQVKIVRFEDLEKVLNKNDDKLYVVNFWATWCRPCVLELPEFMEVNKANRSNQHF
    KMILISLDMAKDAKTLVRPFLIKNKIDADVYLLDDNKRMNEWIPAIDKSWSGAIPATVFYKNGKKLEFIESQLNKKELEQ
    IINKYL

    >gi|313202774|ref|YP_004041431.1| hypothetical protein Palpr_0284 [Paludibacter propionicigenes WB4]
    MKKYSLFLVCLVFSVVAMAQKPVATFSEKVFDFGKINEKDGSVTHVFEFTNKGNSPLVVSRVQTSCGCTTPSWTKEPVEP
    GKKGSITVTFDVRNKTIFEKQIMVYTNDTAEPIMLVIKGEVIPVSKQAEAASKK

    >gi|313202775|ref|YP_004041432.1| hypothetical protein Palpr_0285 [Paludibacter propionicigenes WB4]
    MRKYSLLLIGLLFSVLVMSQKASIAFDVKSHDFGKIKEEDGKVTYIFSFVNNGKGPLVVSRVQSSCGCTTPVWTKTPVEP
    GKKGTITVTYNPLGRPGKFFKPVSVYSNATDELVNLSIQGEVIPRQSGEDSTYPVNIGGLGLKAKVVSIGNVERGRMQTR
    VLGIQNTSKASLRPTIENLPGYLSATVLPEVLNPGEEGKITFTLNSKNCNQWGPLSDDVYLSLNGVRRFTDDTRILVVAN
    ILEDFSKLTLEQRRKSPVIELPEREIDLGTLREGSKRTGKLKLLNKGLSTLEIRRIINNNKELSIKTSKNSVAVNKKTDI
    VIGLNTRNLSEAEYKKSFTIQTNDPENAFLIVVVSWKVQK

    >gi|313202838|ref|YP_004041495.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKRIIISLLSVFLSFSAFAQGGKEFVIKGTLKNVADSTVILLMKEEGAFGLQASSDTVRNGKFMFKWKVENGKEKYSLFR
    GPNESEFPTMSLDIWVKPGSVIEVTGNNKWIYTWDVKSDIPEQIERSRFIKINKTDWDKYQYVDVEKNTIAKGNLETSRK
    KALTDSLNKLTKTIINRIVIKEIELLKQKPIKTIAGMEVLNRAVTEMKNKNNKSKLLELKQIYRQLTKQQKESVEGYSIY
    TLLYPPKTVKAGDMMVDGDLFDLDGNKHNLAEYRGRYILLDFWNSG
    CGACIMKFPDLAEIYEKQKDKLNIVGINMNTVAA
    WKIGNQFAKITWTNLNDRKESAGLATKYKLKATPHYVFISPEGKILFTTSYWEELVKNMAEYIKD

    >gi|313203064|ref|YP_004041721.1| thioredoxin domaiN-containing protein [Paludibacter propionicigenes WB4]
    MKKTVLLFLVVFSASLYAQEVGIKFSKDTLLSKALTQAKKEGKLVFIDCYTTWCGPCKFLAKEIFPQKEVGDFYNSHFIN
    LTFDMEKGEGLKIREKYGVQAFPTLLFLNAEGEKVHMGLGSMPAFAFIDLGKAALDETRNLRGITAKMKAGDKSVQTLLL
    YLKANHYSPDANALVTEYFKTASDEEKLSIEAWDLFVNFINDIDHEQFQYFLKHRSAYEQKFDKKKVDSKIVNGFAYYLQ
    KYKDNPAKAESVKSIDPALYAKFLVLRDFNLVSYEFQTNKTDKTKWNNFIAKAKLVIVPDDSEPMSINGVCWTIYENYRK
    FDDIASLKLAKEWEEKAHNALPNNHPINDTYAHILFDLGYVKEAIEHEELAIKVATEEKSDTDLKFYHDEVERFRKAK

    >gi|313203085|ref|YP_004041742.1| peptide methionine sulfoxide reductase [Paludibacter propionicigenes WB4]
    MKLNTLTPEEQAVILHKATERPFSGEYETNFAKGTYVCRQCDAPLYRSEDKFDAHCGWPSFDDEIPGAVKRIPDADGKRT
    EIICNNCGAHLGHVFLNEGFTPKNTRF
    CVNSISLKFIPAKKMKQENNTHETAYFASGCFWGTQYHFMKAAGVISTTVGYM
    GGHTLNPTYKEVCTGETGHAETTEVVFDNTKTSYENMVKLYFETHDFTQVGGQGPDIGDQYRSVIFYTSEAQKQIAEKYI
    RILTDKGYKVATILQKAPEFWKAEDYHQEYYEKKNGTPYCHIYRKIF

    >gi|313203107|ref|YP_004041764.1| hypothetical protein Palpr_0623 [Paludibacter propionicigenes WB4]
    MSTSEHKYTNHLIHESSPYLLQHAHNPVDWYPWSQEALNKAKKENKNLLISIGYAACHWCHVMERECFEDEEVARYMNEH
    FVAIKVDREERPDIDQIYMTAVQLLTERGGWPLNCVALPDGRPIYGGTYFPKAQWLDMLNQVSGFIQLHPDKTENQARAL
    TEGVQNNEMIYRADLPGLEATVNDQEDIFYHIQAGIDTVNGGYGTAPKFPMPSSLQFLLHFHHLSGNNDALKALTTTLDR
    MAFGGIYDQIGGGFARYATDEAWKIPHFEKMLYDNALLVSVYASAFQYNRNPHYEKVLHETLEFVSSELTSPDGGFYSSL
    DADSEGVEGKFYVWTFDELQTILGKNAGLIMDYFQVTAAGNWEESQNILYRKGNDEEIARKHNLSTVELSESIAQARELL
    QTVRAKRQKPMLDDKILTSWNALMLKGYCDAYRVTAKAEYLQAALRNANFILRYMKSADNGLFRNYKNGKASIPAFLDDY
    AFIIQAFISLYQNTFDEQWLVEASELTEYTVSHFYDPESGMFYYTSDTEPALIARKMEISDNVIPSSNSEMGKNLFVLGH
    YFYNDQYITMSEKMLNNVRQNALQGGIYYANWDILMGWFASAPYEVSVVGKNSDLLRKELNTHYLHNIILSGTKFESNLP
    VLKGKWSADETLIYVCRNHVCQAPVSDLRAALQMIKQVHI

    >gi|313203240|ref|YP_004041897.1| peroxiredoxin [Paludibacter propionicigenes WB4]
    MALQVGDKAPAVLGINQDGKEIKLSDFAGKKVVLYFYPKDNTPGCTAQACSLRDNYDDLQKAGYEVIGVSTDSAASHLKF
    IAKQNLPFQLIADTDKKLSEIFGTWGEKSLYGKQYMGTFRTTFIIDETGTITRIMLPKEVNTKTHASQIL

    >gi|313203244|ref|YP_004041901.1| rhodanese domain protein [Paludibacter propionicigenes WB4]
    MLENRIDRRILKENLHNESFKRQTISFYKYFEINNPTEFRNQVYEQWFALNCFGRIYVAHEGINAQMSVPEDNMAEFLKQ
    LYAIPQLTNVPIKQAIEDDGKSFYKLTIKVRPKIVADGLPDNTYDLSKVGKHLTALEFHEAIEEPEAIVVDMRNHYESEI
    GHFKNAFCPDADTFREEILMVLEKYKDEKDKPFLLY
    CTGGIRCEKASSFLINNGFENVSQLYGGIIEYAQQIKKLGIESK
    FYGKNFVFDQRLGESVDGQVISHCHQCGKPADTHTNCANDDCHLLFIQCDDCKTKYEGCCCDDCKTVIQLPLEDRKKLRV
    QHHQKYADSKIFKSRLRPKLKADI

    >gi|313203393|ref|YP_004042050.1| thiol peroxidase (atypical 2-cys peroxiredoxin) [Paludibacter propionicigenes WB4]
    MATVKFKGGDVQTNGQLPAVGSQAPEFTLVGSGLQEIHLSDYKGKRVVLNIFPSLDTGTCAASVRKFNKWVSEKENVVVI
    CVSKDLPFAQSRFCGAEGLENVITASDFRYNTFATDYGVLLTDGPLKGLISRSVVAIDENGKVIYTELVPEIVDEPNYDI
    TAF

    >gi|313203480|ref|YP_004042137.1| osmc family protein [Paludibacter propionicigenes WB4]
    MSDKHVIRTEWKGNMAFEADVNGHKVMMDATTEGGGQNSGASPKKLQLVALSGCTGMDVVSILQKMRVNIEKVNIEVQGD
    VADEHPKHYTKMHVIYEFTGKDLPLDKLEKAVRMSEETYCGVEALYRKAIEVTSEIKIIES

    >gi|313203488|ref|YP_004042145.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MNMRRILFILAAVLTFSGQAQNKTVLKEGIWHGQLSVADNHKAPFLFNVKNAGTPSASVVLINGEERVELTGIKYRGDSV
    IIPIESYDAVIKASLSGTTLQGRFLKNYIPNDAGIAFTAEHNNKNRFTPVANPTDILLDGKWDVLFVGEKGDTTRNVGIF
    KTVNRIVTGSILTNSGDMRFLEGAYTTTGVQLSAFAGLSPYLFELNFVGKDRFEGTFFSARSKTKLIGVRNSKAGLADPY
    SLTKLKPRSEVLSFKLPNINGQTVSVNDERYKNKVVIISILGSW
    CPNCLDEMKYLAPWYKANKARGVEIIGLSFERKDDF
    AYAKAAISRLKTKYGAEYEILFAGKVGDEATAKVLPEIEKVSSYPTTIFIDKKGKVRKIYTGYNGPATGLFYEEFKQEFN
    ALMDQLLAE

    >gi|313203564|ref|YP_004042221.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKFKILVISLLAVVFQLNAQTRDITITVHIRGVWNSKISLLALSGPNAGKPIAELSPVKSNESAIVTVAKDQLPGEFVIR
    FDYKDKETSTPYPSEKHIFAYSQNLELFVNPPFCNNMDSTWFQKGEIENTVYADFSKENFKQKEKLGVLQNFLMSYDDTH
    STLYRTGITEYEKRRTNYNRWIEKQIAQHKKTFVSKAFKFQYVPAMEWEDSLVDRVNGMIAHYFDGIDFKDTLILKTSDM
    IQWMNKYVNIYGAMSTTPALRDSLLSVAATIAIDKARVGGNPFVYGWMVDYFYNGFEANNIPVGIKALQPYLDDPSCYTN
    KKQQIEKRLNGIKKLVVGSPAPDFNIINDAGTNTQFSTYSTTCRYKLVLFWSAG
    CDHCKELIKNLYPWYQQISNKKAVEI
    FALGIDDTEADIKLWDKVHTLLKGWKHMLLKGGINSKVANAYFILSTPVMVLVDAQTNKIVALPESVEQLETAMK

    >gi|313203582|ref|YP_004042239.1| glutamate synthase (NADH) small subunit [Paludibacter propionicigenes WB4]
    MGNPKAFINIPRKNAGYRPINERIYDFGEVEQTLNREDRKLQASRCMDCGIPFCHWACPLGNKMPEWQDLIYKGHWKEGI
    EILHETNNFPDFTGRICPAPCEKSCVLALHDAPVTIRENEAAVTEVAFIEGMIKACPPKTRSGKKVAVIGSGPAGLAAAQ
    QLNRKGHLVTIFEKDNGLGGLMRYGIPNFKLNKNIIDRRLEQLSEEGIIFKPNTEVGKDISGSEIMKNFDAVCIAIGAGH
    PRDITPEGRDLKGIHFAMEFLSQQNQVIMGENVDESTLISAKDKHVLVIGGGDTGSDCVGTSIRQGAVKVTQIEIMPMPP
    ADKNPDTPWPFYPNILKTSSSHQEGCERKWSLNTNKFVGKNGQLTEVLVEEVEWTKDETGRWNMKLTGKTDVIKADLVFL
    ALGFIHPVHEGLLTELGVEFDGRGNVAIDKTSQSNVKKVFATGDAAMGASLVVRAIASGRKVAEDIHSSL

    >gi|313203783|ref|YP_004042440.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MSVLVGKKAPVFNSKAVVNGGEIVENFSLEQFVGEKYVVFFFYPADFTFVCPTELIAFEDKAAEFAARNTVVIGASTDSE
    FSHWKWLQTPQNQGGIQGVTYPLVVDQNLSISKNYDVLIGSEEYDEEGNESFVGEPKAYRGLFLIDKQGVVRHQLVNDLP
    LGRNVDEVLRLIDALQFTEEYGEVCPANWKKGEKALVATQEGIASYLSEKA

    >gi|313203813|ref|YP_004042470.1| redoxin domain protein [Paludibacter propionicigenes WB4]
    MKLNLKSTIILLILNTILAFGQEINHSQVGSKPESKPNALKTDFNSYFHKKDSIFRLNIGKQYPKFKATSLDRQTIDEKK
    LVGKVTIINFWFKH
    CEPCVAEFDELCNLQHKFCKDSAFQFISFTSDSPQDAKESVAKFKLSFPVYPISRDECYRLNLNQG
    FPTTIIVDKAGKIVFLKSGGYLEKENIAQYIRKLEQIIEKELN

    >gi|313203886|ref|YP_004042543.1| nitrogenase-associated protein [Paludibacter propionicigenes WB4]
    MIIHFYEKPGCINNTKQKKLLEESGHTVIAHSILTQSWTPETLRKYFGSLSIVDWFNPASPRIKNGEIIPEKINEATALQ
    HMVKDPILIRRPLINAQGELICGFDNKAIVRLTANKDIHHLLTCPNLEKDTNCNNSISKISFDL

    >gi|313203993|ref|YP_004042650.1| thioredoxin [Paludibacter propionicigenes WB4]
    MRKIIYASLMSMVILSSCAQTNKEKKTEQTNQSKETKKMGTIHLTKAEFLSKVVNYEKNPTEWKYLGDKPCIIDFYASWC
    GP
    CKTIAPILEDLAKEYDGQIYIYKINTEEEQELAAAFGIRSIPTILFCPMKGAPQMAQGALPKESFKEAITKVLLEK

    >gi|313204001|ref|YP_004042658.1| methylated-DNA/proteiN-cysteinemethyltransferase [Paludibacter propionicigenes WB4]
    MRQLPPQSNPSFGFANTPFGECCIAFSDDGICALTFPESREGAYADLDNRFPQTDFKQNDERVARFVRQIFEKGESPLLN
    PIGTEFQLSIWHALQRIPKGETRTYAQIAEAIGRPKAVRAVGTAIGANPIAFLIP
    CHRVIRTDGGLGGFRWGLECKREML
    SWESKS

    >gi|313204038|ref|YP_004042695.1| hypothetical protein Palpr_1565 [Paludibacter propionicigenes WB4]
    MRTIGNRVRCIIMLLLVLCIQSCDNKKNRAELVVKKWIQKEIQIPGNITFKSVGRDTVCSRIMKHRNIVLVYIDSLGCAA
    CKLRLAEWKAFIETCQKMSYDVGFLFVVQSTNYKDLENKLLLDDFTYPIIYDYKGDFDRINSFPKEEEFRTLLLDRRHRV
    VLIGSPVRSHKMKQLFYKVISNGDFNEVRFRNIETYYLKETTVNLDKDSINLGKFSFKTSKHLIFKIRNVGNNPLLINTV
    NTS
    CGCTLAKYDKKPIPQGETTTVVLEYRPNSLGYFSKTADVMCNVPNGLVRLKISGEVVEK

    >gi|313204062|ref|YP_004042719.1| uba/thif-type nad/fad binding protein [Paludibacter propionicigenes WB4]
    MDFTEEQIQRYSRHILLQDVGVEGQEKINNGKVLIVGAGGLGAPIALYLAAAGVGTIGIIDGDVVDLSNLQRQVIHFTPD
    VNKPKVISAKEKINLINPDVKVVTYQKLLTAENALEIINDYDFVVDGTDNFPVKFLINDACVIAKKPFSHGGILRFDGQT
    LTYVPGSACYRCLFHSPPPPNAVPT
    CSQAGVLGAIAGMLGTIQAAEVLKYLTGVGDLLTNRLLTFNAKTMEFRTVHTKHN
    DNCPVCGNHPTVTGLVDYEQAVCDIESHRKNK

    >gi|313204084|ref|YP_004042741.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKLNKKYWMVILLLVATMSILLAQQKARNKQTPPHFLINGEINLPSGTIYLKGFHNKIFFNIDSTQIINGHFKFKGSVKN
    PDLFGLSTDRNETFNPYYIFIENTPIKVLIDTANHHPIKIYGSASNDLFESFKAARRGYKIDSLITAQPQSPVAAYILYR
    NYANDLSVNQLEKNLALFDPSLADLSYIKELKEILAIKKQVDVGQKAIDFSALTPDGKLLKLSQFYGNYLLLDFWASW
    CG
    P
    CRRENPNLVRIYNKFKSKGFNIFAVSLDQKRENWIEAISKDNLTWTHVSDLKFWNSEPARLYAVRNIPSNVLIDPHGNI
    VARNLRGEELEKKLDEVFK

    >gi|313204258|ref|YP_004042915.1| thioredoxin [Paludibacter propionicigenes WB4]
    MALEFTDENIKEFINSGKPVVIDFWAEWCGPCRMVGPVVEELAKEYDGKVVIGKMDVDNNVDTPNEYGIRNIPTILFFKD
    GQLVDKQVGATQKSSLVAKVEALL

    >gi|313204264|ref|YP_004042921.1| redox-active disulfide protein 2 [Paludibacter propionicigenes WB4]
    MHIQVLGTGCQKCKSLEKATREVIAQNNIDATITKVEDIVEIMKFNVMTTPALVIDGKVVVKGRVPSNYELKQLLIK

    >gi|313204347|ref|YP_004043004.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MNRILMTLTFSLFLLNLCLGQIPKEAFPLTDSLSDLWHNGETEKAIESSLELYRLYPPMFIESIHNTLAQQLQNDPKLYG
    QKYLEQLRLKKNDEISNIISPIYLWSKSINEKNENDLKEILKELNSILKDSSNYKSETERYCLLILQELDKKNAIDAKNK
    EIILHKNINNLEAYPYVNKVIVGRSEGVKRAWHRYLLAYSYNYLYTVKPNVAEYLKKASDYSPDQNDRQYKHAYFYDAAL
    LTGNTREFGFQTKYQKYLVENNLNSEALDLLSDIAFGNPSDYNIKTLREFYEKLKYNRLFTDYWANYIHKKGKPVPKLKI
    RFEKEELDLTKEPGKWIYIDVWGTW
    CSPCVKELPELQSFFVENNKSSNSRLEVCTFSFSSQNLSEFMTKNKYTFPVSEID
    KRTNDLFEVSGYPTKILISPQGNFIKIPFGVDWKIYIKNYTMM

    >gi|313204353|ref|YP_004043010.1| rhodanese domain protein [Paludibacter propionicigenes WB4]
    MKSKCLMLALSLLMAFSAFSQSNPSQLKSLPTAEFKKLVDAKSVQLIDVRTAEEFAAGHIAGAVNIDVNKPDFAENIKKL
    SKKKPLALY
    CRSGNRSKMAASKIADLGFVIYELNSGFKDWMQAGFPTIK

    >gi|313204400|ref|YP_004043057.1| redoxin domain protein [Paludibacter propionicigenes WB4]
    MKQFILLMALTLTPFLYGQSTDDRGYIVKVGDAAPDFSIKLTDGKTVKLSDLKGKVVMLQFTASWCSVCRHEMPFIERDI
    WKKHKANPDFALVAVDRDEPLATVLKFAKSIPITYPIGLDPHANIFALYATRDAGITRNVIVDKTGKIVMLTRLYNEEEF
    KTMTEKIDSLLK

    >gi|313204609|ref|YP_004043266.1| heavy metal translocating p-type ATPase [Paludibacter propionicigenes WB4]
    MKTEKFDVTGMMCTACVSHVEKSVSKLDGVKNVNVNLLTNSLTVSFDELNLNTVAIEKSVEEAGYEAHLRVDAANVTTGQ
    EPKIDFVKLEQDEMKKRWWISFVFLLPLLYISMGHMLRLPIPHTFHSTENALMVAFTQFLLTLPIVFVNKKYFQNGFKSL
    FKAAPNMDSLIAIGSSAAILYGIFAIYKIGYALGHADMQTAARFSEDLYFESGATILTLITLGKYLEAKSKNRTSNAITR
    LMDLAPKTAVVIRNNEEVEIPVEQVLVGDVVVVRPGQRIPVDGIVESGSSSVDESALTGESIPVFKEKNDTVLSASINKS
    GFFTLRATKIGKDTTLSQIISLVEDASSSKAPISKLADRISAVFVPVVITISLLSIVVWLILGYPFDFALSIGIAVLVIS
    CPCALGLATPVAIMVGTGKGAEYGILIKSAESLEKAQKTDTIVLDKTGTITEGKPRVTDIFSSKSISDSELLIIAASLEK
    LSEHPLAEAVLLEAENQKAEILPVKDFQAIPGQGVEGSMNGTKYLAGNHRLINNRGLDFQHFNALADKLADEGKTPLFIA
    NQKEVLGIIAVSDTLKTTSKEAVERFRQMGMDVVMLTGDHAKTAMAMQQQLNISTVIAEVLPQDKDKEITRLQAAGRNVA
    MVGDGINDAPALMRSDLGIAIGAGTDVAIESADVVLMRSDLLDAVTTIRLSKAVMQNIKQNLFWAFFYNIIGIPLAAGVF
    YSVLGWKLNPMFAAAAMSLSSVTVVLNALRLLRFKPSVENDK

    >gi|313204610|ref|YP_004043267.1| heavy metal transport/detoxification protein [Paludibacter propionicigenes WB4]
    MSEKTLQIKGMSCGHCSARVEKALNAIDGVTAAVDLEANSAKVTLLKEVSDETLKAAVDNVGYEVVGIK

    >gi|313204750|ref|YP_004043407.1| dihydrolipoamide dehydrogenase [Paludibacter propionicigenes WB4]
    MYNLIIIGGGPAGYVAAERAGHKGLSVILFEKNAMGGVCLNEGCIPTKTMLYSAKTYENALHGDKYGVYGDNVRFDYGKI
    VARKNKIVRKLVAGVNAKMKQHEVMVVSGEAIIQGKTNEGIEVTCGGETYLGENLLI
    CTGSEAFVPPIPGLEEAGEIILT
    NREILQLKEQPASLVIIGGGVIGMEFASLYNSLGTKVTVIEMLPEILGANDAEISAMLREMYAKKGIEFHMEAKVVKVEG
    NKVIFEKEGVTESVEGDKILVSVGRRAITKGFGLENLQVELIKGGIKVDEKMRTNIPNVFAAGDVTGFSLLAHTASREGE
    VVVNNLTGREDKMRYDAIPGVVYTNPEVAGVGETEESATAKAIAYKVAKLPMTFAGRFVAENEGGNGLCKVLVAEATDKV
    IGVHMLGNPCSEMIYGACMAIEKGMTLAELQEVVFPHPTVSEIFKETVFAF

    >gi|313204772|ref|YP_004043429.1| thioredoxin domaiN-containing protein [Paludibacter propionicigenes WB4]
    MKKQLLIVSTLFIAISSFAQGIVFEQGTWKQVLEKAKQTNKPIFVDVYTTWCGPCKKMSKEIFPLAEVGAVYNANFVCYQ
    IDAEKGEGIDFAKKYEVKAYPTYVFIKPDGTLFSRALGSMPAKDFINVATVALADLSDPKPIEEWDKEYATRKNETAFLL
    GYMDKRSKLGKPNDQLFDEYLQLIPEEELTSDIVIKKYINDGQQMKVNSYAYENLLKNRTKYFAKLFGYTDLYLMAGVVN
    TMREAAKLKDDQLLEKAIKAYDQLPGNTLQKQRDEIYMEYYQRTENTNKYQKYATGFCNNYLMKISKDSIDKKDQLTLQL
    IENQIKSGALAKIDSVQLAQLRQYSAHAVRDKISEALNNVAWKFFETVSDKKALNDALSWSKRSLEIYPENPMWMDTYAN
    LLYKLGKNEEAVAMEEEALELVGKDSKEGFKNTLQKMREGQKTWN

    >gi|313204974|ref|YP_004043631.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKFSIKAACLLLILLNTAGLSAQNAKNYVVNTSLSNKKGGYVKLFYNYNNAIQTDSIVFKDGLFSFNIKGEKDKKAILNL
    YVDNAEAKAYNFYLDKDTINIKIESPDELPKVDGGALNAQWTNLQLQTSPFLAQFKEIDAEYYAADSIKQKSEPFLDALV
    ERSRSIKNKINEVYKAFIKENPTSQVSPEIFLDIYSTDEKDGLYPYYKMLPEEYRNDDFMKIVGEDLSAYEKTAIGNLAP
    DFKSVDSNGKPVTLSNFRGKYVLLDFWASW
    CVPCRKENPEVVKAYAQWKDKKFTVISVSIDVAEGDKAWRAAFTKDKLVW
    TNIREPKIGTSYSVSSIPQNFLIDPNGKIIAKELRGKYLHQELEEILK

    >gi|313204981|ref|YP_004043638.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MTRIKMVLLHLSLALGLSLSAFAQTEKAVVLNPEKPQPGGKLEISYNAKESSLGDSKDVKGTVYLYCNYKWITKDLSLNY
    ESNNWKGTLDVPSDCGLLALKFKSNGKIDNNGNNGYVWMLQKADQSSMPGANAAWGLMRSPDYGYAIPNYIDLEKFAVND
    TVTYMWINNEIVKNSVSAAPMAMLFANSLYRSHVDGAEQRMKNIAAFLIKQNTEESLVNAAVIYKNLLGMAQPADSLTKV
    ILGRYPKGSIARLNAYRAASKQTDMKKKRQALAQFLIDFPESPADAQYNENNMINYDKAYEMIVLIDTMDKNYSSLQTYL
    NQLSFGASITLFYKLIQIPHDRKDIPDQELYQYAKLLVDHMESIKSVKPARYYYLSPNEWEEQWQDDMARTVLITYIDLL
    KNVGKNKEALSYALQAQQSFNYTVADVNNSMISLLTETGDKEGLKKLLIGALYNNQVTPLMLDLLKKEYVAEHNSEAGFD
    EFVKSHKDPKLVAKELKSLDGNRREGVMPAWKMMDIDGKLIDSNNIKGKTYVLDFWSSW
    CVPCKASFPGMKLAVERYKND
    PSVEFYFVDTEEHSADYKAAAIKYIKDNNYPFHVLFDNKVKGAKINDEVFSRIAKAFTISGIPQKIFVDGNGNVQFISIG
    YKGSPSELADEISGMVELTKSIK

    >gi|313204984|ref|YP_004043641.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKVFRLLALTLLPTALLAQSGPYTINGKVGNFNAPVKVYLLTKRDNVTKIDSAILKNGMFEFKGQIADPAKARLVVDHAG
    TGLKKIEKPDLLEIYLEKGKIKVLSTDSVSKSEITGSPINVENKKYNALLAPTVAKQNAILAEYYGASDEKKKSAEFQKD
    IDTRYDAVDNELKTLIKGYIQVNPGSFVSLDALKSLGNPVFEVELVEPLFNGLTEQLRNSASGKELLAKIAKLKLVAVGA
    QAPDFKQLSPDGKELKLSDFKGKYVLIDFWASW
    CGPCRAENPNVVIAYNQYKDRNFTILGVSLDSEKSKAAWLKAIEKDQ
    LVWNHVSDLKGWNNEAAQLYSVQSIPQNFLINPDGKIIAKNLRGEDLQLKLKEIFK

    >gi|313204986|ref|YP_004043643.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MLINSTLKDGFDAIGTEKIYNTLSSDIKKTPLAESVIKRILEVKRTQVGIDAPDFTQKDANGKPVKLSDFKGKYVLVDFW
    ASW
    CAPCRRENPNVRVAYDKYKSKGFEILGVSLDKEDARAAWLKAIADDKLTWTQVSDLKGWSNEAAVLYSVKAIPTNFL
    IDPQGKIIAKDLRGENLQQKLKEIFK

    >gi|313204991|ref|YP_004043648.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Paludibacter propionicigenes WB4]
    MKKIYLALVLCGMVSITLNAVNNRKKTVSSNPVPNFLISGEVKGINQGVVYLGYRENAKDKKDSAIIAGGKFSFKGKVIE
    PVYAFLSTKDRKVFVGFFLENNKVTISVDSLGKSTVKGSPISDIYIGWAKMWSVVTQKAGDIYKRMNEEYKKEGLDPNSR
    TAKLSDSARKAFDDEFKVLNVETDSTVFPVVRKYPNSVASAFIIVDRYVSWHDVSNAQKMFNYLTPEARKSVYGIQIKEF
    LDTEAKVSIGKVAPNFTMNDTTGHPVKLSDFKGKYVLLDFWASW
    CGPCRKENPNVVNAYKKFHDKGFEIVQVSLDTKKPA
    WIAAIQKDGLNWNHLSDLKGWQNEAVLMYGVKAVPTNFLIDKDGKIIARDLREEKLQETLSEIFK

    >gi|313204993|ref|YP_004043650.1| proteiN-disulfide reductase [Paludibacter propionicigenes WB4]
    MTKKVVLSFLLLCCVLGMSAEIQKPVTWSYSSKQVSDTEFNLVLSASVDNNWHLYSQFIGEGGPVPTSFKFKPSPDYVLV
    GKASESPKPHKIFEKVFGMDVAFFEKKVTFTQKVKLKVPATKITGTLTFMVCDDSQCLPPEDIDFSFDLKGAKVEVAAAP
    AAPTAADTAKTAVAPAATVAKDSSAAVVKTEPLASASNPSGQQSLWTIFILGVLGGFAAFLMPCIFPMVPMTVSYFTKKE
    VTKRKGVINALIYGLSIVVIYVVLGLLITVIFGADALNVLSTNGIFNFFFFLLLVAFALSFLGAFELVLPSSWVNKMDSK
    SDKNGLGGLFFMAGTLALVSFSCTGPIVGTLLVQAATSGQLLGPAIGMLGFAIALAIPFVLFAMFPAWMKAMPKSGGWLN
    SVKVVLGFLELAFAFKFLSNVDLAYHWNWFDREIFLSLWIVISALMGFYLLGKLKLPNDSDVKHVSTPRLVLAIITLSFT
    MYMIPGLWGAPLKSISAFLPPMSTQDFVMSAGSAPAAAHNSGNHKYSEIFHAPLGLDVFFDYDEGLAYAKKVNKPMFIDF
    TGHA
    CVNCRKMEASVWPDKEVLSRLTNDYVVIQLYVDDKTDLAAAEQTVSKYSGKKINTIGNKWSDLQASRFNANSQPFY
    VLLDNKGNLLVQPQGADYDPVSFTKYLDSGLAAFKKGVQ

    >gi|313204999|ref|YP_004043656.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Paludibacter propionicigenes WB4]
    MKYVIIGAVAGGASAAARLRRNDELAEIVIFEKGEYISYANCGLPYYIGNVITNRNALFVQTAASFNKRFNIDVRTQTEV
    ISINRTAKTISARNQTTGEVYEETYDKLVLSPGAEPIRPPLPGIGGKGIFTLRNVADTDYIKAYVQQEQVKKAVVIGAGF
    IGLEMAENLHSLGMDVTIVEMAGQVLTPVDFPIAAILQQHIRSKGVKLQLNTAVSGFEQTENGQKVMLNNGQELDADVVI
    LSIGVKPDTKLAAEAGLKIGEARGIYVNEYMQTSDPDIYAVGDAIEFTNPITNKSMVTYLAGPANKQGRICADNLVFGHH
    KKYNGSINTAIVKVFDMTVATAGTASKHLQLSGIKHQVSTITSGSHAGYYPGAKQMTIQIAFTPGDGRLLSAQIVGYDGV
    DKRLDILSSVIKRNGTIDELTEFEHAYAPPFSSAKDPVNMAAFAAENILLKRSVVFYWNKFDKITPDDVLIDVRTKNEYN
    AGKILDAINIPVDELRSRLDEIPKDKKIYIY
    CLGGLRGYLAQRILMQNGYADTINLSGGYQLWNTCNTEMNLI

    >gi|313205000|ref|YP_004043657.1| rhodanese domain protein [Paludibacter propionicigenes WB4]
    MELEKAINEKAGTIVDVRTREEFMGGNVNESVNIPLQEIQQRLGEIKSLKTPLVICCASGGRSAVATNFLSSQGIECVDG
    GSWLNVNYYKSKAV

    >gi|313205001|ref|YP_004043658.1| rhodanese domain protein [Paludibacter propionicigenes WB4]
    MLATIKKLLGFGPKADFAELVSQGAVILDVRSKGEYAGGHIKGSINIPVDQLSGNLNKLKDKNKVIITCCASGMRSASAK
    GILTSNGFTNVYNGGGWQSLKYKIG

    >gi|313205166|ref|YP_004043823.1| thioredoxin domaiN-containing protein [Paludibacter propionicigenes WB4]
    MKKSILFLLLIMFKFSVSAQYEGIKFNHELTLADALSKAKDENKYVFVDCYTTWCGPCKLMVFDVFSQKQVGDYYNRNFI
    NLKLDLEKPDNKFIVEKYGITAFPTYLFFDPNGKLKLKAKAYLEAPIFLEMGKAALDNANNFEVNAKKIEDGDRSIRTVK
    RFFVQNYNYKKSESLVEECFKILSDEEKISQDGWDLFNLYIKDPKSESFQFFLKNRLKFTEKYGKEAVERRILYGLFLYT
    YEMDIAGFDSLRSIDPVIFDKAKNFIAIAAAYWECVRNKNIDNQADWKNLISIASPYLEDQCDDSNYIGSQAWKIYQNSS
    KIKDKTILDKACEWAKRAYTLQPKSSEIMNTYAHLLFATGKKNNAIKLEEEALKKAEEAAIDDLVKSYKEELHKFKQ

    >gi|313205287|ref|YP_004043944.1| redoxin domain protein [Paludibacter propionicigenes WB4]
    MRKIPTLVLFVLIVASITAQNSFEKTALSQAKEMANYSNSHDFKKYVDYLLPFNYGNNSNNKEKLSEMFKRSSESDTATI
    RVVKTVKSIINKDQYQILILCRERNRDHYIFGISNDKGKNWLFTQPQQTKMNFNALQEMIPTISTSFSPLVDPKFGKRIN
    YIKGEKIAPFKFTDINGKILSSDSLKGKVIVLNFWSMS
    CGPCIKEIPDLNELVAKMKSKEVVFIAPAVYTSKDDIVKYLL
    PKHPFSYQIVCIENDDDYNVNSFPTHVIIDQNMNIVYKYDAYSKENTKKMEEILMGLLK

    >gi|313205299|ref|YP_004043956.1| arsenate reductase-like protein [Paludibacter propionicigenes WB4]
    MKPIVLCYPKCGTCQKAEKWLKTNEIEYVYRPIKEENPNKDELKSWIAKSELPVAKFFNTSGLLYKEFNMKDKVKTLSED
    ELIDILSGNGMMVKRPILLVENTVLVGFKEEEWKQLFAK

    >gi|313205454|ref|YP_004044111.1| alkylhydroperoxidase like protein, ahpd family [Paludibacter propionicigenes WB4]
    MTMKQRINIKRLEPKAYEVLYAMEKYLSATDLSIQLRELIKVRVSQINKCAFCIEMHTKDARKEGETEQRLYALSAWEES
    PLFTDEEKAVLAMVEEITKIFEHGVSDRTFQNIQNYFTDNQIAQIIIAINQMNFWNRIAVSTKMFHP