Paenibacillus polymyxa SC2 uid59583

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|310639645|ref|YP_003944403.1| thioredoxin reductase [Paenibacillus polymyxa SC2]
    MYKSIIIGTGPAGYTAAIYLARANMNPLIIEGMQPGGQLTTTTEIENFPGFEQGILGPELMDNMRKQAERFGAEFTSGWV
    EEVDFSKRPFKVKVEGKGIIEAESVIIATGASAKYLGIPGEQDNVGRGVST
    CATCDGFFFRGKKIIVVGGGDSAMEEASF
    LTRFASSVTLVHRRDELRASKIMQDRARENEKVHWALNRTPLEVVTGETGLKGLKVHNNETNQDELIEADGVFVAIGHTP
    NTGFLNGQIHTDEHGYIEVKPGTTETNIPGVFACGDVQDNRYRQAITAAGTGCMAAMDCEKYLEGSAVHDWSETLDQ

    >gi|310639918|ref|YP_003944676.1| copper-transporting p-type atpase copa [Paenibacillus polymyxa SC2]
    MENRATDGDKHTTLHITGMSCAACASRIEKGLNRIDGVAQANVNLALEQASISYDPKQVEIPEFRDKIASLGFGTVSEEA
    NLNVTGMT
    CAACAARIEKGLNRIPGVTGASVNLAMETAHVEYAAGSTTVSDLVSKIEQLGYGAIPQSAEDNIADVRSKDI
    QRKKWKWMISAVLSLPLLWAMVAHFSFTSWIYVPELFLNPWFQLVLTTPIQFIIGWQFYVGAYKALRNGSSNMDVLVALG
    TSAAYFYSLYLTLRPSDAMEGMAGMPVTTMPELYYETSAVLITLILVGKWFEAVAKGRSSEAIKSLMNLQATTARVVRDG
    QELDLPIEQVRVKDIFIVRPGEKIPVDGVVVDGRSAVDESMLSGESLPVEKGEGSPVTGATLNKNGVLRIQAERVGGDTA
    LARIIKVVEDAQNSKAPIQRIADQISGIFVPIVVAVAVITFLVWFFLVTPSDFAGSLEKMIAVLVIACPCALGLATPTSI
    MAGSGRAAEYGILFKGGEHLEMTRSVNAVILDKTGTVTNGKPELTDVIVRASSLAETDLLRLLGAAEKSSEHPLAEAIVK
    GIADRGIELVGPTDFENIPGYGVKASVEGKQVLVGTRRLMSREGITMDDSTEQQMNELEGAGKTAMLVAVDGSYAGLVAV
    ADTIKETSREAIARLRAMNIEVIMITGDNERTAKAVAAEAGIERVLAEVLPEGKAEEVKRLQDQGKIVAMVGDGINDAPA
    LATAHIGMAMGTGTDVAMEAADITLMRGNLNSIPDAIEMSRRTMTNIRQNLFWALGYNVIGIPIAALGFLAPWLAGAAMA
    FSSVSVVLNALRLQRVKL

    >gi|310640007|ref|YP_003944765.1| multidomain redox protein (nad(fad)-dependent oxidoreductase; rhodanese domain; sira-like redox domain; peroxiredoxin domain) [Paenibacillus polymyxa SC2]
    MGRKIIIIGGVAGGASAAARLRRWSEEDEIILFERGEHVSFANCGLPYYIGGTIQAREKLFLQTPQGIRDRFNIDVRVQK
    EVIQIDREHKLVHYRDMITGETDEQPYDIVVLSPGAKPMIPDIPGLHEATNVFTLRNIHDTDLIKAYVDERHPKHATVIG
    AGFVGLEMAENLRERGLAVTIMDKGQQLLNPLDPEMAKLVEQHVKLNGVEVRLEEGVAAFEEQGTQLRLTSGEMLQTDLV
    ILAIGVVPENELAKQCGLELGFRGAIQVNAQLQTSDPSIYAVGDAIQVKDRNHGFATMVSLAWGANRQGRLAADHINGQA
    ISYDGALGTSVIKTFALTAASTGNNEKTLQRLAVPYQAIHIHPGSHAGYYPGASPISMKLLFHPETGMIYGAQAVGADGA
    DKRIDVIATAIRGHLNVRELADIELAYAPPYSSAKDPVNMAGYVASNIMDGLVQTIQWHEVDDFHRNGGLVIDVRDAVEL
    QGGTIPGSMHIPLVEIRERMSEIPRDLEIAVS
    CQVGLRGYLAARILTQSGYRVRNVDGGYKTYSVMAKRDHLLK

    >gi|310640077|ref|YP_003944835.1| alkylhydroperoxidase like protein, ahpd family [Paenibacillus polymyxa SC2]
    MEKYISGRFTDKVLYELLKIRVSQINGCSYCLDMHAKDLLKLGDYADHILQLALWREVPLFSEKERAMLELAEAVTHISE
    QGVPTDLYNRVREHFTEEEYVDLITAINVINSWNRIAIATGMYPGSL

    >gi|310640130|ref|YP_003944888.1| arsr family transcriptional regulator [Paenibacillus polymyxa SC2]
    MNERDFKDGLFTEYARIGKCLSSPKRLEILDILIQGPKSVEVLSKMTSMSVANVSQHLQTLYQAKLVQSKKQGNFVYYEL
    SDSSVLHFLNSLYDLSEKQLIEVQHIKEQFLGQFSDVEGVTMEELAMRMEKGEVTLLDVRPRDEYETAHIPGAVSVPIEE
    LAEQLSLLPADSKIVAY
    CRGPYCLMAVRAIELLQAHGFEARHLDKSVHDWNDFILNEVTGS

    >gi|310640133|ref|YP_003944891.1| osmc-like family protein [Paenibacillus polymyxa SC2]
    MLTTFKATAKKLPEGLQVEAQSRGFKIVMDEPEDFGGTDKAMNPVEALLCALGACQSIVVAAFAESFGFSYEEFHIELEG
    DLDPDGFMGLADVRCGFQEIRFVMHFKTTESQEKAEAFAAFVEKTCPVGDCLANGVKLVQAGVVRR

    >gi|310640134|ref|YP_003944892.1| dihydrolipoyl dehydrogenase [Paenibacillus polymyxa SC2]
    MEVKMSMIPGGKKGKASRNHVQLGQNVSFGDVLLEVETGKGVREITATVEGSISKIHFEEGDEVSSNQVLFTIDAAAEEG
    TSTVTSQATKMEQPTLDKNVDLLIIGAGPGGYVAAIYAAKKGIKVALVEKEELGGT
    CLNVGCIPTKSLVKSSEICHHIKE
    SSLFGIHTGTDLQVDMKQVIRRKDEIKGKLISGIDYLMEKNNIEIIRGQAAFLSATQVSVKGQRHYQVTANDIIIATGSK
    ITKVNIPGINLPIVMNSTDALASTELPKSITIIGGGVIGMEFAFIYRNFGVEVHVVEFMDRLLTMVDSDISEEIKQLAEN
    AGIHIHTQSKVSKIQQADNGQAIVTYENKQGEHLLVSEKVLVAIGREPNLDGLDIEQAGIQRNERGKGIAVNEYMRTNVE
    HIYAIGDVTDIMQLAHVASHQGITAIDAIMGGSEGMHYAAIPNVIFTSPEIASVGILEDQCKREGMDFSVSKVSFSSNGK
    ALTMNESEGFIKLIKDNVTQKIVGGSIIGPDASSLISSLTLAIANELTEQQITQTVFAHPTTGEVIHEAAFGLSIGALHQ
    A

    >gi|310640260|ref|YP_003945018.1| iron-sulfur cluster binding protein [Paenibacillus polymyxa SC2]
    MQRELTRTATGTASTWASLKQEIIEAAPGLGIDSIGFASADPFLSLKAILEEHRAKGYESGFEEPDIDKRIYPELYGSQP
    ASLIAIAVAYPSKMKDPPKSDKGKYRGILARSAWGKDYHLVLREAMEKLEAFISERVPDAILKNMVDTGELSDRAVAERA
    GIGFSGKNTMMISPTLGSWIYLGELLTNIPFQPDEPVTDGCGECTKCLDACPTGALVGPGQLNAQRCVSFLTQTKGFLDE
    EFMLKIGNRLYGCDTCQIVCPKNRGLNWAHHPELTPDPEIVKPLLLPLLDLSNREFKDRFGQSAAAWRGKKPIQRNAVIG
    LGNFKDVSAVPKLTEVLLDDPRPELRGTAAWALSRIGGENAMTAIKQASEKEQHEQVREMIAQAHSKLEEQEQAEQQTSA
    ELKAEDSQGPTTIYYDEMETPVGTLTLCATDRGLCRIDYGSFYAKEALLQQWARTWVGEYVYVQEPEKLREAAEQLREYF
    AGERREFSIAYDLRGTPFQEQVWRALQNIPYGQSVSYQDIAESIGRAKAVRAVGGANNKNPLPILFP
    CHRVSGANGSLVG
    YAGGLPVKMKLLELEKE

    >gi|310640293|ref|YP_003945051.1| glutamate-ammonia-ligase adenylyltransferase [Paenibacillus polymyxa SC2]
    MSTTLTVIGQAAPDFELPGSEGKSVKLSDYRGSRVLLYFYPKDLTSSCSTQACDFRDKHAEFEGLNTVILGISPDPLKQH
    DKFIAKYGLPFQLLSDEEHQVAETYGVWQQKQMYGKQYMGIVRSTFLIDENGILVHEWRGLRVKGHIDAALAYIQDMA

    >gi|310640387|ref|YP_003945145.1| hypothetical protein PPSC2_c0921 [Paenibacillus polymyxa SC2]
    MTEKKEIANKIGWNFDNSYSRLPESMFTKLNPNPVRSPKLIILNHPLAVSLGLNENALQRDDAVAMLAGNQVPEGATPLA
    QAYAGHQFGHFNMLGDGRALLLGEQITPLGKRVDIQLKGSGRTPYSRRGDGRAALGPMLREYIISEAMHALGIATTRSLA
    VVTTGEAIIRETEQPGAILTRVAASHLRVGTFQYVSAWGTSQDLRTLADYTLERHYPEVANDENRYLSLLQEVIKRQAKL
    IAQWQLVGFIHGVMNTDNMTLSGETIDYGPCAFMDTYNPETVFSSIDMQGRYAYVNQPHIAAWNLARFAETLLPLLHDNR
    EQAVQLAEDAISDFANMFRHHWLTGMRAKLGIFNEELEDESLIEDLLKIMQKHRADYTNTFRALTLNKLEDADLFSTADF
    TQWNKQWQARLDRQQESEASSHQLMRSRNPAIIPRNHRVEEALEAAVEREDYRVMEKLLEVLSDPYAYSTEQEVYSTLPE
    EPTCPYRTF
    CGT

    >gi|310640447|ref|YP_003945205.1| hypothetical protein PPSC2_c0982 [Paenibacillus polymyxa SC2]
    MSIHLELDSLSVERLAMVLSGRPGMFKLFYDTEDCGCNGVLTILVIDAPNATDTAIQSDSYSFWVDRQQEQQFDSQMRLE
    ADPSYPSFKVSSDAGILSSNVRIQDRRVNSSKA

    >gi|310640789|ref|YP_003945547.1| glutathione peroxidase [Paenibacillus polymyxa SC2]
    MSVYKYDAQTLQGAQIPLSTYEGKVLLIVNTASKCGLTPQYKALQELYDQYHEQGLEILGFPSNQFAKQEPGSSEEISEF
    CQINYGVTFPMFAKTDVNGDQAHPLFRYLTHTAPGVLGSKAIKWNFTKFLITREGNVFKRYAPQTTPDKLIGDIEKLLRK
    N

    >gi|310640799|ref|YP_003945557.1| osmc-like protein [Paenibacillus polymyxa SC2]
    MEALYTASATVHGGRDGSVASSDGVLKHKLSTPKELGGAGGDATNPEQLFAAGYGACYESALANVARKAKVKVDNVEVTS
    HVSIGKDPSDGGFQLAVRLDVKIPGIERSQAEDLARQAHDF
    CPYSKATRGNIDVELNVI

    >gi|310640881|ref|YP_003945639.1| ferredoxin--nadp reductase 2 [Paenibacillus polymyxa SC2]
    MTESLELYDVTIIGGGPAGMYTAFYSGMRDMKTKLIEAKHELGGRMRIYPEKMIWDVGGVTPILCEKLIDQLEQQAKTFE
    PTIVLGQQITGLDRQEDGTFLLTSATGEQHWTRTIVLAVGYGILKMAKLEIEGADRYEVTNLHYTVQELEPFRDKHVLIS
    GGGNSAVDWANELESIAASVTVVHRRDHFGGHEKNVARMKSSSVRVLTPYAVGQLHSNNGETIEQVTINHVDTGETEILN
    VDAVIVNHGLKSDFGPLRDWGLDMGEWHARVSDKLETNLPGIFAAGDFVEYGSKLYLIAGTFTDAALALNSAKLYIDPTA
    DKAAYVSSHNSRFKEKNRELGVLE

    >gi|310640939|ref|YP_003945697.1| thioredoxin-like protein ykuu [Paenibacillus polymyxa SC2]
    MAERLVGRPAPDFALETVSGDGQEFGSVKLSDYRGKWLVFFFYPLDFTFVCPTEITALSDAADQFKELDTEILGISVDSV
    HSHKAWINTAKENNGLGKLNFPLASDITKKTASDYGVLIEEEGVALRGLFIIDPEGELKYQVVNHNDVGRSVEETLRVLQ
    ALQSGGLCPMNWKPGDKNL

    >gi|310640967|ref|YP_003945725.1| arsenate reductase and like protein [Paenibacillus polymyxa SC2]
    MSQLKVYQYSKCSTCRNAVKWLQNKGHETELIPIFEQPPGPEELEDLINKSGLELKKFFNTSGEVYKELKLKDKLGSMSR
    EEQISLLSSNGRLIKRPIVTDGSKVTVGFKEETFEGTWGAQ

    >gi|310641360|ref|YP_003946118.1| thiol peroxidase (superoxide-inducible protein 8) [Paenibacillus polymyxa SC2]
    MAQERTGVATFKGNPLTLIGPELKIGDQAPDFKLQKDLLEAATLQDFAGKVKLISVVPSLDTGVCDAQTRRFNQEADSLG
    DQVVVLTVSVDLPFAQARWCGAAGIDRVLTLSDYKDHSFGEAYGVFIKEFHLDHRAIFVIDQNDKIAYVEYLSEMAEHPD
    YDQAIAAVKKLV

    >gi|310641368|ref|YP_003946126.1| thioredoxin family protein [Paenibacillus polymyxa SC2]
    MKRFLFIRAIIVLVMVGSSWGIIANTVYSASLPVENAPLEEKYKGEKELDVEKNVGAESAAAEVIKRIKPGQQLPSMILK
    GLNGKSYDVGALRNKAMIISFWASW
    CDPCRLEAPMLNELYSKYKHDVDVYGINVTRYDRLEDVQKFSRSLALRFPILLDE
    QGALFEQFGGVAFPTHVTIDDHGRVREIIIGMLSERELECKIEALSKKIR

    >gi|310641378|ref|YP_003946136.1| thioredoxin domain protein [Paenibacillus polymyxa SC2]
    MNAQKSNKKKLIPVIGFFVVLIILLGVLLALNSGTKNKLYGVSTASLSPTTQELLNDPNYQQIIKPEDLQSKIDKKESFF
    VYHFASD
    CVHCRATTPKLMPLSKQENITMHEFNLREYEAGWDKYKIEYTPTLVYYEKGVEKERMVGGLKESPSDNGYTLD
    DFKAFFEKYKKNVTS

    >gi|310641388|ref|YP_003946146.1| alkylhydroperoxidase like protein, ahpd family [Paenibacillus polymyxa SC2]
    MTVMDEKVHAYKDQISHLEDKLPEVVHAYHRFTGECFQAGSLDEKTKQLIALGIGLFANNEVCTFYHVNEARSKGASDQE
    IMEAVAVAAAVGGGHALSQGVTRVQKALH

    >gi|310641392|ref|YP_003946150.1| peptide methionine sulfoxide reductase msra [Paenibacillus polymyxa SC2]
    MEKATFAGGCFWCMVTPFEEQPGIHSIVSGYTGGTISDPTYEQVKTGTTGHYEVVQITFDPELFPYEKLLELYWPQTDPT
    DGEGQFQDRGTQYKPAIFYHTEQQRELAQQSKEQLAQSGRFDKPIVTEILPAAIFYPAEDYHQDYHKKNVKHYKEDRAQS
    GRDEFIDKNW

    >gi|310641531|ref|YP_003946289.1| osmc-like protein [Paenibacillus polymyxa SC2]
    MMTIQQKMYETTVKAVGGRNGYIESSSPELRLDIDTPKEMGGAGGTGTNPEQLFAAGYSACFDSALNMVARMQRVKHEGT
    EVTATVHFGKVEDGGFGIGVNLDVLVKGVDHETAVKLVEGAHEQ
    CPYSRATRGNIEVKLNVL

    >gi|310641714|ref|YP_003946472.1| pyridine nucleotide-disulfide oxidoreductase family protein [Paenibacillus polymyxa SC2]
    MKYDCIIVGGGIAGLQAAIQLGRYSSHRVLVIDSGYGRSTLCHQYHNILGFPDGISGEELRGLGRSEAMKLGTEFVDGKA
    VKATKRDELFDIEVEAGAVYTSKTLLLATGLTDRFPKLEGLQACLGNSVYV
    CPDCDGYEVQDRRTVVMGAGKAGASMALI
    LSARTDHLVYVNHERSEVPNELIVKLREKGIEYKEAAISEIITGQPGCFEGVRLADGQVVQAERGFLAFGSNHVHSELAE
    QLGVHLLHNKHIETHPRSKMTNVENVWVAGDLGAHAEQATVAMGEGAMSAIWIHKVLSGMKTKVPQL

    >gi|310641723|ref|YP_003946481.1| hypothetical protein PPSC2_c2268 [Paenibacillus polymyxa SC2]
    MEHTFLLKADWNGGRNSDGRIEAGQLRTAISIPAEMGGPGVGTNPDEMLLGAAATCYLITLAAMMERASLPVVSLALESE
    GIVDVTNNIFTYRRIVHRPRVLLSVDATESQIEQALRLAEQAETS
    CMISRAVAGNVALSTEPVVKRAS

    >gi|310641772|ref|YP_003946530.1| glutaredoxin [Paenibacillus polymyxa SC2]
    MSSKPKVVVWSKTGCHFCGEIKSYLESQNQPYENIQVDGNDALRDVLETKYGIRYVPVVEIGGDNKYEALLNPDLEELGK
    VLESYNQAV

    >gi|310641904|ref|YP_003946662.1| rhodanese domain sulfurtransferase [Paenibacillus polymyxa SC2]
    MCEHAYRILLFYKYVNIEDPATFTAEHLAYCKELGVKGRILIAEEGINGTLSGTVEQTEQYIRDLRANPKFHDIVIKIDE
    SDGHAFKKIFVRHRQELVTLRHEDELDPNVISGKRLSPKEFYEQLQDEDVVVLDGRNDYEYDIGHFRGAIRPEVESFREF
    PQWIRDNMTGFKDKKILTY
    CTGGIRCEKLSGLLIKEGFNDVAQLDGGIVTYSKDPEVQGRLFDGKCYVFDERISVRINHT
    DEDVVVGNCYHCETTNDHYINCPVCNLQHIVCPDCEEQHQHYCSDDCRTKAETMASA

    >gi|310641971|ref|YP_003946729.1| cellulase catalitic domain protein and a thioredoxin domain protein [Paenibacillus polymyxa SC2]
    MSTSSKPNRLAKEKSPYLLQHAYNPVNWFPWSDEAFEIAKRDNKPIFLSIGYSTCHWCHVMERESFEDQEVAEVLNQDYV
    SIKVDREERPDVDHIYMSICETMTGHGGWPLTIMMTPDQKPFFAGTYLPKEQKFGRVGLLELLGKVGIRWKEQPDELMEL
    SEQVLTEHERQDLLAGYRGELDDQCLNKAFHEYSHTFDHEYGGFGEAPKFPSPHNLSFLLRYAQHTGNQQALEMVEKTLD
    AMSRGGIYDHVGMGFSRYSVDEKWLVPHFEKMLYDNALLAITYTEAWQVTGKRLYRQITEQIFTYIARDMTDAGGAFYSA
    EDADSEGEEGRFYVWSDSEIKAVLGDEDASFFNDLYGITPYGNFEGHNIPNLIDINLEAYGNKHDLTEPELEQRVSELKD
    KLFTAREQRVHPQKDDKILTSWNGLMIAALAKAGQAFGDTRYTEQARKAETFLWNHLRREDGRLLARYRDGQAAYLGYVD
    DYAFYVWGLIELYQATFDVQYLQRALTLNQNMIDLFWDEERDGLFFTGSDSEQLISRPKEIYDGAIPSGNSIAAHNFVRL
    ARLTGETRLEDYAAKQFKAFGGMVAHYPSGHSALLSALLYATGKTSEIVIVGQRNDPQTAQFVQEVQAGFRPNMVVIFKD
    KGQPEIAEIAPYIHDYDLVDGKPAVYVCEHFACQAPVTHIDDLKHMLNRIE

    >gi|310641997|ref|YP_003946755.1| redox protein, regulator of disulfide bond formation fused to rhodanese-like domain [Paenibacillus polymyxa SC2]
    MSLTSHIEADQILDCKGLACPMPIVKTKKAMDELLAGQIMEVQVTDKGSLADFQSWAQGTGHQYLGTFQEGVVMRHYLRK
    ANPTDVKEEQAFPSTISHKELQAKWFAKENFILLDVREPAEFALQHIPESKHIPLGELENRLAELNLEDEIAVI
    CQAGAR
    SERACRLLADKGAKNVKSVLSGMSGWAGEIIGYDSI

    >gi|310642076|ref|YP_003946834.1| thiol-disulfide isomerase and thioredoxin [Paenibacillus polymyxa SC2]
    MSATALTNQTFNNQIQSGITLVDFWAPWCGPCQIQLPIIHQLADDLKEKATIATINVDEQTELATRFGIRSIPALLLFQD
    GKLMDTMIGINQRDVLEAKILKLMN

    >gi|310642079|ref|YP_003946837.1| thiol-disulfide isomerase-like thioredoxin [Paenibacillus polymyxa SC2]
    MNKELLSIEEIDAFIQNNRLSMLYFSQENCNVCHSVYPKLKDLLTKFPSIKLAHVDTSNVEEVVGKFLIFSVPTIIMFID
    QRESFREGRFVQLGPLAARLQQLNDFWLKSNSGL

    >gi|310642082|ref|YP_003946840.1| thiosulfate sulfurtransferase with a arsr-hth domain, rhodanese family [Paenibacillus polymyxa SC2]
    MKEPLSSANVLKEDLYKQLARIGKCLSSDKRLEILNVLSQSPKTVEKLAACTGMNMANVSRHLQILLDAKLVKFAKRGTY
    AIYSLADPEIIDFMASLWRISEKQLPDIAKLKEDFLNNLDGIQTLTMDEVMEKVNNDSILLVDLRSKEDFEMGHISGAIS
    MPMTELDTLMQELPKDAEVIAY
    CQGPLCVYSALAVQKLQQEGYKAYRMDEGINEWQGHFLPH

    >gi|310642084|ref|YP_003946842.1| osmc family protein [Paenibacillus polymyxa SC2]
    MANQKLSLNTVWYGNAKGNGIIKSENFQTQIAIPVSKGGSGEGVEPKKLLMSSAAACYLMTLTYMLEQNRIPVLGLSMDT
    EGNTAPNGQLSITHRPHIVLKKSEATNQDVSMAETLMRNAEEN
    CQIGQLLVKADVQITIEGHVSFEAE

    >gi|310642292|ref|YP_003947050.1| protein disulfide isomerase (s-s rearrangase) [Paenibacillus polymyxa SC2]
    MNIEVWSDYMCPFCYIGKRRLEQVLQQFPHHDEVQLTFKSFELNPNAVKDSGKTINEELSAKYGVSLQEAHAMNDRMTEN
    ARSAGLDYNIHAMVPTNSLDAHRLTHWAHTQGKMLELSERLFQAVFMEGKHTGEHEVLAALAAEVGLDHNEAAAILASDR
    FTNEVRADEAEGAKLGVQGVPFFVFDRKFAVSGAQPEEVFHDALQKAWDERSPFTMISGSSSKQDAAGVCTDDGCELPSR
    ES

    >gi|310642334|ref|YP_003947092.1| dihydrolipoyl dehydrogenase [Paenibacillus polymyxa SC2]
    MVVGDASLDIDTLVIGAGPGGYVAAIRAAQLGQSVLIVDKSELGGVCLNRGCIPSKALISAAHQYEAAKHGETFGITAEN
    VKVDFAKTQEFKNGVVKKMTGGVSGLLKGNKVEVFNGECMFINENEARVFNEHESPRYRFKNAIIATGSRPIELKPFPFG
    GRILSSTEALNLPEIPKSLIVIGGGYIGAELGQMYSKFGSKVTIIEGMDTVLPGFDKDMTSIVSKSMKKTGIEIFTGAKA
    ESAEQTDKDVTVKFSVNGESKEVTAEYLLVTVGRRPNTDGELGLDLIGVELDERGMVKVDHQGRTSIPHIFAIGDIVPGL
    ALAHKASYEGKVAAEVIAGQPSVVDYKCIPAVVFTDPECSSVGYTETQAKEKGYNVKVGKFSYGANGRAVSLNAAEGFVK
    IVADADTGLVLGTQIVGLEASNLIAELGLAIEMGATLEDISLTIHAHPTLGELVMEAAEVVMGHPIHALAPRR

    >gi|310642343|ref|YP_003947101.1| adenylyltransferase thif [Paenibacillus polymyxa SC2]
    MRITKKSAAEPPQSDRYSRQERFAPFGPAGQRRLASSHVLIIGVGALGTGIAETLVRGGVGTVSLVDRDYVEWSNLQRQQ
    LFQESDAVQRCPKAVAAQRRLKDINSETIVHAHVLDVGIEELEELIQGVDLMMDATDNFDTRLLMNDMALKHRIPWIYGG
    CVGSYGVTYTILPGQTPCLHCLMGTVPLGGET
    CDTAGIIPQAVQMVTANQTTEAFKLLGGYPENLRGKLLSFDLWKNEYV
    AIAVDRLKKANCPSCGSQPTYPYLSASYRQKTDVLCGRDTVQIRPANRTHLNLAEVANRFTALGEGNVEWNSYLVSFSVG
    EHRLVVFADGRALIHGTKDLAKARSLYHRYLG

    >gi|310642362|ref|YP_003947120.1| thiol-disulfide oxidoreductase with thioredoxin domain [Paenibacillus polymyxa SC2]
    MKEIGQKEARRAIWEGCKLALFVYTPMCGTCAAARRMLEVAEHLLPEGAVVQSNINYIPELVQECRISSVPALLIYNGEN
    KNPEIIYKMESVGHLLSRIRSVME

    >gi|310642475|ref|YP_003947233.1| glutathione peroxidase [Paenibacillus polymyxa SC2]
    MSIYDYSAIAMNGKEITLSDYKDKVVLIVNTASQCGFTFQYQDLQRLYDQYKDRGLVILGFPCNQFADQEPDSNESVQTF
    CTLNYGVAFPMFQKVNVRDEQAHPLFTYLASSLPFEGFDETHSVAKILIPLIHERHPEYLPGDSIKWNFTKFLIDRNGKV
    IKRFEATTDPLDMEEYIEALL

    >gi|310642642|ref|YP_003947400.1| dihydrolipoyl dehydrogenase [Paenibacillus polymyxa SC2]
    MTIHCDVAILGGGTGGYVAAIRAAQLGKEVVIIEKDKLGGTCLHRGCIPSKALLRSAEVYATIKESAQYGIETSGAQLVF
    PKVQERKEAVVEQLHQGVQFLMRKNKITVLSGKGRVIGPSIFSPKSGAVAVELEDGEMETIVPAHLIIATGSRPRVLPGL
    EPDGEFILSSDEALTMENLPASLIIVGGGVIGVEWASMLNDFGVEVTVVEAANRLIPTEDEDVSREMQRLLTKRGVKVLT
    GAQVLAETYGKDEEGVQIDVQKGEETETLSVSKLLISVGRQANVENIGLENTDIRVERGFISVNEHLQTNEPHIYAIGDC
    IGGLQLAHAASHEGLQAVHHLAGEEFHSVPNYMIPRCIYTRPEAASVGLTEQEARERGHQVKTGKFPFQAIGKSLVYGSR
    DGFVKVVADQQTNDILGVHMIGTHVTDLISEAALAQLLDATPWEVGQLIHPHPTLSEILGEAMLAVDGQAIGI

    >gi|310642716|ref|YP_003947474.1| protein-methionine-s-oxide reductase (peptide methionine sulfoxide reductase) [Paenibacillus polymyxa SC2]
    MSTNNPNTVEKATFAGGCFWCMVSPFEEMPGILKVRSGYTGGHTENPTYEEVCSETTGHVEAVQITFDPQVFPYEKLLEL
    FWQQIDPTDEGGQFHDRGSSYQTAIFYHNDEQRIKAEASKEALAQSGRFDKPIATSILPAATFYEAEEYHQDYHKKNPAH
    YKRYRKGSGREDFIEQNWSAKIDKSDLKDRLTPIQYEVTQKNATERPFQNEFWDHEAEGIYVDIVSGEPLFSSLDKYDAG
    CGWPSFTRPLRSYNVKEKTDLSHFMIRTEVRSREADSHLGHVFDDGPGPEGLRY
    CINSAALRFVPQEDLEREGYGAYKSL
    FEK

    >gi|310642785|ref|YP_003947543.1| rhodanese-like domain protein [Paenibacillus polymyxa SC2]
    MTQIALIEPSELRARLQAGEQLQLIDVREAEEVAEGMIEGAKHIPLGQIPGRLEEIERTGEIIFICRSGYRSERACEYLQ
    QLGYEGCTNMTGGMLQWSQEQ

    >gi|310642799|ref|YP_003947557.1| nitrite reductase [nad(p)h], large subunit [Paenibacillus polymyxa SC2]
    MNYIQKLVLVGNGMAGIRTLEHLLKIAPGAYEITVFGAEPHPNYNRIMLSSVLAGGAGLQDIIINDWSWYEENNIRLYTD
    DPVTAIDTENRQVTSRSGVCVSYDLLLLATGSKAFILPLPGADKDGVIGFRDIRD
    CETMIETAKTHKKAAVIGGGLLGLE
    AARGLLNLGMDVTVIHLNGYIMDRQLDEAASLMLRRELEEQGMTFLVNKRTAAITGRRRVEGLKFADGSELEADLIVMAV
    GIKPDIELAVSAGIPVNRGIIVNDNMETNIPGIYAVGECAEHRGITYGLVAPLYEQGGVLAQRLAGMETPGYSGSVTSTR
    LKVSGVDVFSAGNYKDEPETRSLRYQDDIGGVYKKIVIKEEKLTGAVLFGDTSDGAMLFSLIKSGDSVVGREKELLLGFN
    PGQPEGSGTMMLEQMPEDEIVCGCNGVSKGDIGEAVAAGCRSLGEIKACTKASASCGGCKPIVEGLLQLYAGAETGEPIK
    EGICRCTTLDREAIIDGIREMGLKSVKEVMNVLGWNEPEGCTKCRPALNYYLGLLWPLDYEDEKESRFTNERYHANIQKD
    GTYSVVPRIYGGVTSPADLKKIAAVAEKYNVPLVKFTGGQRLDLLGVKKEDLPGIWSELDMPSGYAYGKTLRTVKTCVGN
    TFCRFGTQDAMGMGIRLEKAFERLNAPSKVKLAVSGCPRNCAEATIKDLGVVAIDGGWGIYIGGNGGIKVRAAELLCTVK
    TEDEVMEWTGAYLQYYREQANWNERTAHWVERVGVDSIKQVLANAEMRQQLVSRIEETLSTTTDPWHEIIHNEELRKNFV
    QLPELKAVME

    >gi|310642803|ref|YP_003947561.1| nitrite reductase (nad(p)h), large subunit [Paenibacillus polymyxa SC2]
    MIKRLVVIGNGMAGIKCVEEILSLEPERFQITIFGAEPRPGYNRVLLSKMLQEESTFQHIVTHSWDWYEENGVKLQAGER
    VCRIDVATGMVETESGIQEPYDILVLATGSLPFMPPIPGVRKEGVIAFRDVND
    CETMARYAKTYRKATVIGGGLLGLEAA
    QGLLNLGMETDVVHNAQYLMNRQLDRTAAVLLQRRLEQQGMRFHLAKDTVNIIGRNRAQGLMFADGNRLETDLVVLAVGI
    RPNIGLAQDSGLTVNRAIVVDDYMRTSIPGIYAVGECAEHRGISYGLVAPLYEQAKVLAKVICGRETAPYEGTVPYAQLK
    VAGIHVFSAGDIREEGSEIAIMEYNGMQEIYKKVMMRAGNITGAILFGDTAESTSLLGMVRRGAPTTELTSQNNSKSKAE
    DAAEALPEGETVCACNGVSKGDILRAIATDKLKTVEEVKSRTKASGSCGGCRPLVAALVKNGLSRETASGPVVTPTAQEV
    VSVCGCTHYDHDSLKTAMVDAVCRTPEEVVSRLGWTRQQGCELCRPAVLYYLESLGLRNGSATNQLGIDVAVQSTLPYEG
    EVGSVGLSFTNLNAERRDCVDPAPIDQACGGVIWLRERLAAVWGSLSLPSPVAVAVSPGSEYPGGVLVHDIGISRSPAGW
    EVYAGGHAGHPVRQGLLLGLEENPEEVVLMAVTCLQIYRHSARYGEKMWEWIERTGVLALRESVLDATLRSELTGSLRST
    MLTG

    >gi|310643150|ref|YP_003947908.1| thiazole biosynthesis adenylyltransferase thif [Paenibacillus polymyxa SC2]
    MSEMKKDPITDADAKAHTQASHARYSRQELFGKIGPTGQKNIRSKHVLMVGAGALGTANADMLVRAGIGRLTLVDRDYVD
    WSNLQRQQLYDEADAHEQIPKAVAAQRRLQQINSDVDIRALVQDVSLEEIGDIAAGVDLIVDATDNFDTRLLLNDYAVKH
    QIPWIYGACVGSYGTTFTIVPGQTPCLHCLLGTVPLGGAT
    CDTVGIISPAVQMVAAYQSAEALKLLTGDNSALQGKLISF
    DLWNNQHQAIQISAMKKIDCPTCGEHPVYPFLQSEHQAKTAVLCGRDTVQIRPVTGAVRDLNEAARLLSRQGGKVEHNPY
    LVSVVIGAHRLVLFQDGRVLIHGTKDIAEARSIYHKYLG

    >gi|310643180|ref|YP_003947938.1| 3-mercaptopyruvate sulfurtransferase (rhodanese-like protein) (mst) [Paenibacillus polymyxa SC2]
    MKSIVSKRWLLARLYEPDIIIADCRSLLGQAGAGRNEFNEDHIPGAVHFDLEEDLTAPLGEHGGRHPLPDVDTLAARLSR
    AGINAASRIVAYDDQGGMMASRFWWLLRYLGHEQVYVLEEGYNAWKEAKFPVTADQPIRIPSTFVPNVQPQMLTSMKEVQ
    RISETSVPVGSYIGFSPILIDSRERPRYLGLEEPIDQAAGHIPGAVNFFWKEVLDEKGAFKNEEQLKQHFSDLDQNAEII
    VY
    CGSGVSACPNVLALNEAGFSNVRLYPGSWSDWISYEENPVATGQE

    >gi|310643279|ref|YP_003948037.1| thiazole biosynthesis adenylyltransferase thif [Paenibacillus polymyxa SC2]
    MKERYSRQILFRPIGSEGQRNLSEAVVTIIGCGALGSAIAETLVRAGVGEIHLVDRDYVETSNLQRQQLFTEQDAVQMLP
    KVMAAEKRLKAIREDVRLYTYLDSLDAGLAQELAGKSTLLMDATDNFETRLLINDAALKAEIPWIYGACVGSTGVVFPFV
    PGKSACFRCLLPSLPAINQT
    CDTAGIISPAVQVTAALQCAEAMKWLSGKRDKMRSKVHLFDLWENTQMDIGISRIRNQDC
    PTCGEQPEFPALTATHRSAYAALCGRDVVQVLPDPHRPITLDDAEKMGRLMAEHVKRTPYFVEFYAFKHRMILFKNGRLL
    IHGIGSVARGQKLYHQLFG

    >gi|310643310|ref|YP_003948068.1| methylated-DNA--[protein]-cysteine s-methyltransferase (6-o-methylguanine-DNA methyltransferase) [Paenibacillus polymyxa SC2]
    MSKLSVLNYVSPIGEIEIQGTKEAVYSIMFSNRNEPLTRLTEEAPVQVLEECASQLDEYFKGERFKFSFPYAFEGTDFQQ
    KVWNALVTVGYGRTTAYKDIALAIGNEKAIRAVGSANGKNKLSIVIP
    CHRIIGSNQKLTGYAGGLWRKEWLLQHEKRCLG
    SKGGLMDERDIFERV

    >gi|310643632|ref|YP_003948390.1| lipoprotein [Paenibacillus polymyxa SC2]
    MKKGYIAGLSVIVLLIIGIAISAVVKFQDLEQVVQQKDKEIQASKSNYPEIYDHLNAVTIDGFKQFIQQDQSVFVYVGRP
    S
    CGDCNRFEPNFNKMIEQYDLGSKITFLNVHKIHKDKAQWNKFKADYNVKYTPTIAEFRNGKLVDKIEWMPKRDLSTDAV
    KEWLTFKKLI

    >gi|310643720|ref|YP_003948478.1| thioredoxin reductase, putative [Paenibacillus polymyxa SC2]
    MLYDCAIIGGGPAGLNAALVLGRARRSVALIDNNRPRNAVTHASHGFITRDGVTPAEFRRVAYEEVLRYPSVHHLPTEVI
    SVTKKESIFEVFDSSGLRIQARKLILATGVKEVFPEIEGFYTFYGKSLFN
    CPYCDGWELRDQPLVLVSESPAIYHTAKLL
    LNWSKDLLVCTNGQAFLSDEQKERLQSKGVVVMEQPVAAFIGHHGQLEYASFTDGTQVPRVGGFVTPRFVQSTPFGGDLG
    CERTESGGIQTDGAGRTSIPGVYAAGDSSYFMPSQLIFAAADGSRTAASVNLDLTEEDFNEC

    >gi|310643791|ref|YP_003948549.1| thioredoxin [Paenibacillus polymyxa SC2]
    MAIVNVSDQSFNAEVEGTGTVLVDFWAPWCGPCKMIAPILEDLSTEVGDSVKIAKVNVDENPESASRFGVMSIPTLIVFK
    DGQPVDKVVGLNSKEALKSMLTKHQ

    >gi|310643818|ref|YP_003948576.1| iron-sulfur cluster assembly accessory protein [Paenibacillus polymyxa SC2]
    MINITDSAAERLKEMLEQQETPNMFLRLGVTPGGCTGFSYAMGFDDNETDQDIYMNVQDMKVVVEKDSIRYLDGLEIDFE
    ESGMSGGFTIHNPNAVATCGCGSSFRTATDAGKPNEEPC

    >gi|310643830|ref|YP_003948588.1| thioredoxin domain protein [Paenibacillus polymyxa SC2]
    MQKIVSHEDFNKAISTPGVTVAVFKADWCGDCHFIDPFMPDVEQQYADKLTLIEIDVEQAESVSQEQNVLGIPSFIAYSE
    GRELVRLVNRLRKSREEIEQFLDRAVEVHANLAK

    >gi|310643871|ref|YP_003948629.1| o6-methylguanine-DNA methyltransferase [Paenibacillus polymyxa SC2]
    MVHQMNKTIYWSLLTHEDWNLYIAATSEGLCYVGSLNQPVEELITWAGSRFPDSPLVEEDIVLQLYAKELIEYFQGERTH
    FTFPFDFHGTAFQMAVWNALCNIPYGETQSYSDIANAIQKPNSVRAVGSAIGANPILVTIP
    CHRVIGKNGALTGYRGGLD
    MKVKLLQLEKNRTHKSI

    >gi|310644006|ref|YP_003948764.1| glutaredoxin [Paenibacillus polymyxa SC2]
    MEKAIVYTSTNCPHCRQVKSYLAEKGVEYEERNIETNEAFAQEVWDMGIRAVPLTLIGEERISGMNKTKFEKVLNA

    >gi|310644007|ref|YP_003948765.1| thioredoxin reductase [Paenibacillus polymyxa SC2]
    MYKSIIIGTGPAGLTAAIYLARANMNPLVIEGPQPGGQLTTTTEVENFPGFPEGIMGPDLMDNMRKQAERFGAEFRTGWV
    NKVDTTARPFTLDVEGLGELVTDTLIISTGATAKYLGIPGEQDNIGRGVST
    CATCDGFFFRGKEIVVIGGGDSALEEANF
    LTRFASKVTLVHRREELRASKIMQDRARANSKIEWALNRTPVEVVADENGVTGLKVLNNATGKEEIITVSGVFVAIGHHP
    NTGFLEGQITTDANGYIVVNPGTSETNVPGVFACGDVQDTRYRQAITAAGSGCMAAMDSEKYIESLEHSALAL

    >gi|310644016|ref|YP_003948774.1| cation-transporting atpase, p-type [Paenibacillus polymyxa SC2]
    MDALKRNERHEWVLEGLDCANCALKIENGVSKIEGVLDCSVNFVTKTLTMTTTSDQKEEVFRQTERKVHRLEPHVRMVAK
    SAGGRLREDSRSGVGAVEASCTEDCACGHEHEGEGHNHNDGKHAAHSHGGHSHEAHGAHDGHDHGNHAHMHHNHHAVRDH
    GEATHAHSHSYDDDSHAGHTHDHGTDGMRRMIARLSIGAVIAAVAWWLPVEGVGKLALFLVAYIIVGGDVVLQAARSLVR
    GMAFDEYFLMTLATVGAFAIGEYPEGVAVMFFYQIGELFQGIAVNRSRKSISDLMDIRPDYANLKTAESVRRVSPEEVRI
    GDLIVIKPGEKIPLDGKVVEGKSHVDTSALTGESVPRTVEPGSSVMSGFVNTNGLLTVEVSKEFGESAVSKILELVQNAS
    AKKAPTEKFITKFSRYYTPVVVIVALLLAVVPPLVVPGAQFADWIYRALVFLVISCPCALVVSIPLGFFGGIGAASRSGV
    LIKGGNYLEALNHVKYAVFDKTGTLTKGVFHVTGIYPAEAFTKESLLETAALAEMHSTHPIAASLREAYGNELQTERVQQ
    YSEISGHGIRAQIDGRLVLAGNAKLMEREHIAFNVAQQAGPLDVGTVVHVAVDGTYAGCILISDEVKEDAAKTIASLKKL
    GVVKTIMLTGDNRTVAEAVGRQLGLDEVRAELLPQHKAEAIEQLSASKKTSDKILFVGDGINDTPVLALADVGVAMGGLG
    SDAAIEAADIVIMNDEPSRLVTAIHIAQRTRRIVWQNIIFALGVKVVFLSLGAFGIATMWEAVFSDVGVTLLAVLNVMRV
    LKVGTDE

    >gi|310644045|ref|YP_003948803.1| thioredoxin [Paenibacillus polymyxa SC2]
    MERIESEQQYQDLINGDGLTVVKFDTSWCPDCKTLDKFMDGIMKENADKRFFALDAEKFQPIAEQNQVRGIPSLLVFRNG
    EKIAHLHSKYAKTPAQVSEYLTTLESKQ

    >gi|310644428|ref|YP_003949187.1| dihydrouridine synthase, dus [Paenibacillus polymyxa SC2]
    MKVAVIGCTHAGTAAIVNTAKCYPDAEITVYERNDNISFLSCGIALYVGGVVKDPHGLFYSSPDQLADMGVVTKMLHEVT
    SVDTAGKTLHARNLQTGEEFTDTFDKLIVTTGSWPIIPKLEGIELDHILLCKNYNHSNEIIEKAQHVQNITVVGAGYIGV
    ELVEAFQMNGKNVTLIDSADRILNKYLDHEFTDRIENSLREHGIKLVLGETVSRFEGTNGKVSKVVTSKGEYETELVILC
    IGFRPQTDLLKGQVDMLPNGAIIVDNYMQSSCPDVFAAGDSCAIRYNPTGKTAYIPLATNAVRMGTLVARNLVQPTIAYM
    GTQGTSGIKIYEDNIAGTGMTEAAATDEGMTVEAVTIEDSYRPEFMPTSEKVLLKVVYEQETRRIVGAQIMSKVDLTQSI
    NTLSVAIQNHMTIDQLAFVDFFFQPHYNKPWNFLNAAGLQALPTISERNPVTV

    >gi|310644429|ref|YP_003949188.1| glutathione peroxidase [Paenibacillus polymyxa SC2]
    MSVYSYNAVTPANQEVSLETYTGKVLVIVNTASKCGLTPQYGDLQKLYDEYKDRGLVVLGFPCNQFGGQEPGSSEEAAEF
    CQLNYGVNFPVFAKVDVNGPDTAALFEYLKKQQPGEQEDGTIQWNFTKFIVNREGVPVGRFEPKESPEAMKAAIEQLL

    >gi|310644597|ref|YP_003949356.1| rhodanese domain protein [Paenibacillus polymyxa SC2]
    MAKTFADMVQEARQHVQGITSQEARQRIESNPDTFVIDVQDSHDAGACGLIRGSANISLGMLPIRADLGVPQDLRDERLR
    DRNRPIITT
    CGAGGQAALAAYILQQMGFTNVAFIEGGTTAWKEAGFEVELY

    >gi|310644723|ref|YP_003949482.1| glutathione peroxidase [Paenibacillus polymyxa SC2]
    MSVYDFQATLINGKPIEFSNYRGKVLLIVNTASMCSFSSQFADLQKLYERRREQGFEILAFPCNQFNEKEPGSNSEVQTF
    CQNNHGLTFPLFEKTDVRGLSAHPLFQYLTQQSPFQGFDTQTKDGQWMDDFLRDKYPEIYVGDGIKWNFSKFLINRDGHV
    KGRFEVTTAPCAIDPVIESLL

    >gi|310830514|ref|YP_003965615.1| Thiol-disulfide isomerase-like thioredoxin [Paenibacillus polymyxa SC2]
    MKKAWTIGALLGVLLIAGCANEPKTVDNSTKAGQENIHSSEKTNNATSSLNLDELFPDETTRTYIKENIGKKAPDFTLTN
    LKGKDISLSDFKGKDVIVEIAQTT
    CGACIQAQPEMDKFQSKHPEIPVIQAFPFENKAAVHKFLKKLNSPETDTILSDEHG
    NTMIRDYKAKWTPTMYFINKQGMISFVYVGNTDVKQMEEITQHAF