Paenibacillus polymyxa E681 uid53477

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308066988|ref|YP_003868593.1| Methylamine utilization protein [Paenibacillus polymyxa E681]
    MSTSANRKKEDVGLPVGSLLPSQKVKAYTGELYQLDILDKPQIMVFISMYCSFCIDLLPHLSQIQQKHRDYQLMLFSTGD
    DEDHRDMIDYFKWDFPVFHMDQSEMENWFDITQMPFILVTHWNKVICKGVAYDVVGASQLILNV

    >gi|308067001|ref|YP_003868606.1| Thioredoxin reductase (TRXR) [Paenibacillus polymyxa E681]
    MYKSIIIGTGPAGYTAAIYLARANMNPLIIEGMQPGGQLTTTTEIENFPGFEQGILGPELMDNMRKQAERFGAEFTSGWV
    EEVDFSKRPFKVKVEGKGIIEAESVIIATGASAKYLGIPGEQDNVGRGVST
    CATCDGFFFRGKKIVVVGGGDSAMEEASF
    LTRFASSVTLVHRRDELRASKIMQDRARENEKVHWALNRTPLEVVTGEAGLKGLKVHNNETNQDELIEVDGVFVAIGHTP
    NTGFLNGQIHTDEHGYIVVKPGTTETNIPGVFACGDVQDNRYRQAITAAGTGCMAAMDCEKYLEGSAVHDWSETLDQ

    >gi|308067207|ref|YP_003868812.1| Copper-transporting P-type ATPase copA (CopA protein) [Paenibacillus polymyxa E681]
    MENRATDGDKQTTLHITGMSCAACASRIEKGLNRIDGVAQANVNLALEQASISYDPKQVEIPEFRDKIASLGFGTVSEEA
    NLNVTGMT
    CAACATRIEKGLNQMPGVTGATVNLAMETAHVEYAAGSIAVGDLVSKIEQLGYGAIPQSAEDNIADVRRKDI
    HRKKWKWIVSAVLSLPLLWAMVAHFSFTSWIYVPELFLNPWFQLVLTTPIQFVIGWQFYVGAYKALRNGSSNMDVLVALG
    TSAAYFYSMYLTLRPSDVMEGMAGMPVMTMPELYYETSAVLITLILVGKWFEAVAKGRSSEAIKSLMSLQATTARVVRDG
    QELDIPIQQVRVQDILIVRPGEKIPVDGVVVDGRSAVDESMLSGESLPVEKEAGSAVTGATLNKNGVLRIQAERVGGDTA
    LSRIIKVVEDAQNSKAPIQRIADQISGIFVPIVVAIAVLAFIVWFFLVTPTDFAGSLEKMIAVLVIACPCALGLATPTSI
    MAGSGRAAEYGILFKGGEHLEMTRSVNAVVLDKTGTVTNGKPELTDVMVGASGMAEEDLLRLLGAAEKSSEHPLAEAIVK
    GIADRGIELVGPTDFGNIPGYGVKAHVEGKQVLAGTRRLMSREGIAIDDSAEQYMNELENAGKTAMLVAVDGFYAGLVAV
    ADTIKETSREAVTRLRAMNIEVIMITGDNERTARAVAAEAGIERVLAEVLPEGKAEEVKRLQEQGMIVAMVGDGINDAPA
    LATANIGMAMGTGTDVAMEAADITLMRGNLNSIPDAIEMSRRTMTNIRQNLFWALGYNVIGIPIAALGFLAPWLAGAAMA
    FSSVSVVLNALRLQRVKL

    >gi|308067289|ref|YP_003868894.1| Coenzyme A disulfide reductase (CoA-disulfide reductase) [Paenibacillus polymyxa E681]
    MGRKIIIIGGVAGGASAAARLRRWNEEDEIILFERGEHVSFANCGLPYYIGGAIHAREKLFLQTPQGIRDRFNIDVRVLK
    EVIQIDREQKLVHFRDMITGETDEQPYDIVVLSPGAKPMIPDIPGLHEAMNVFTLRNIHDTDVIKAYVDERLPKHVTVIG
    AGFIGLEMAENLRERGLAVTIIDMGQQLLNPLDPEMAKWVEQHMRLNGVEVRLEEGVTVFEEQGTQLRLTSGGVLQTDMV
    ILAIGVVPENDLAKQSGLELGFRGAIQVNAQLQTSDPAIYAVGDAIQVKDRNHGFATMVSLAWGANRQGRLAADHINGQA
    ISYDGALGTSVIKTFALTSASTGNNEKTLQRLGVPYQAVHIHPGSHAGYYPGASPIAMKLLFNPQNGMIYGAQAVGADGA
    DKRIDVIATAIRGHLNVRELADIELAYAPPYSSAKDPVNMAGYVASNIMDGLVQTIQWHEVDDFHRNGGLIIDVRDAVEL
    QAGAIPGSIHIPLAEIRERMAEIPSDLEIAVS
    CQVGLRGYIAARILTQYGYRVRNVDGGYKTYSVMAERE

    >gi|308067354|ref|YP_003868959.1| Alkylhydroperoxidase like protein, AhpD family [Paenibacillus polymyxa E681]
    MSLRFNHRAVSPSTFKAMMEMEKYISGRFADKVLYELLKIRVSQINGCSYCLDMHAKDLLKLGDYADHILQLALWREVPL
    FTEKERVMLELAEAVTRISEQGVPTDLYNRVREHFTEEEYVDLITAVNVINSWNRIAIATGMYPGSL

    >gi|308067491|ref|YP_003869096.1| hypothetical protein PPE_00704 [Paenibacillus polymyxa E681]
    MQRGLTQAAAGTASTWASLKQEIIEAAPGLGIDSIGFASADPFLSLKAILEEHRAKGYESGFEEPDIDKRIYPELYGSQP
    ASLIAIAVAYPSKMKDPPKSDKGKYRGILARSAWGKDYHLVLREAMEKLEAFISERVPDAILKNMVDTGELSDRAVAERA
    GIGFSGKNTMMISPTLGSWIYLGELLTNIPFQPDEPVTDGCGECTKCLDACPTGALVGPGQLNAQRCVSFLTQTKGFLDE
    EFMRKIGNRLYGCDTCQIVCPKNRGLNWDHHPELTPDPEIVKPLLLPLLDLSNREFKDRFGQSAAAWRGKKPIQRNAVIG
    LGNFKDISAVPKLTEILLDDPRPELRGTAAWALSRIGGENAMTAIKQASEKEQHEQVREMIAQAHSKLEEQEQTEQLKAS
    ELSKSEVTAGDSQGPTTIYYDEMETPVGTLTLCATDRGLCRIDYGVFHAKEALLQQWARIWIGEYVYVQEPEKLREAADQ
    LREYFAGERREFSIAYDLRGTPFQEQVWRALQNIPYGQSVSYKDIAESIGRAKAVRAVGGANNKNPLPILFP
    CHRVSGAN
    GSLVGYAGGLPVKTKLLDLEKQ

    >gi|308067522|ref|YP_003869127.1| Putative peroxiredoxin bcp (Thioredoxin reductase) [Paenibacillus polymyxa E681]
    MSATFTVIGQSAPDFELPGSEGKRVKLSDYRGSRVLLYFYPKDLTSSCSTQACDFRDKHTEFEDLNTVILGISPDPLKQH
    DKFIAKYGLPFQLLSDEEHQVAETYGVWQQKQMYGKQYMGIVRSTFLIDENGILIHEWRGLRVKGHIDAALAYIQDMA

    >gi|308067560|ref|YP_003869165.1| Predicted redox protein, regulator of disulfide bond formation [Paenibacillus polymyxa E681]
    MERRPLNMKVSTTWHGKRAFTSEGPSGYSVGMDATAAYGGDGKGMTPMELLLAGLAGCMGIDITMILDRFLSDITRIDID
    AEGTRKEEMPTGFTAIDLTFHVDGDIPDYRVWKAIQMGKEKY
    CAVSDSLKAEIRMHLILNGTEVPYPA

    >gi|308067630|ref|YP_003869235.1| hypothetical protein PPE_00847 [Paenibacillus polymyxa E681]
    MTEKKEIADEIGWNFDNSYSRLPESLFTKLNLTPVRSPKLIILNHPLAASLGLNGTALQRNDGVAELAGNQIPEGATPLA
    QAYAGHQFGHFNMLGDGRALLLGEQITPLGERVDIQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHALGIATTRSLA
    VVSTGESIIRETEQPGAILTRVAGSHLRVGTFQYVSAWGTSQDLRALADYTLERHYPEVANDENRYLQLLQEVIKRQAEL
    IAKWQLVGFIHGVMNTDNMTLSGETIDYGPCAFMDTYNPETVFSSIDRQGRYDYANQPHIAAWNLARFAETLLPLLHDNR
    EQAVTLAEDAISDFAKMFHHHWLGGMRAKLGIFNEEQEDESLIEDLLSIMQKHRDDYTNTFRALTLNKLEDTVLFSTAEF
    TQWHEQWQARLGRQQESQASSYQLMRSSNPAIIPRNHRVEEALEAAVEREDYRVMEQLLEVLSNPYAYSTEQEMYSTLPE
    ESTCPYRTY
    CGT

    >gi|308067709|ref|YP_003869314.1| hypothetical protein PPE_00927 [Paenibacillus polymyxa E681]
    MSIHLELDSLSVERLELALSGRPGMFKLFYDTEDCGCNGVLVILVVTTPNATDKAVQSEPYSFWVDRQQQQQFDGRMRLE
    ADPGYPSFKLSSDAGIFSSNIRIKDVRIKSSEE

    >gi|308067770|ref|YP_003869375.1| hypothetical protein PPE_00988 [Paenibacillus polymyxa E681]
    MRGVLLTADWCGDAALNVPIVQKIAEHSNIELRFLNRDEMDQYLTNGTSRAIPIFIFITESGEMQDVWGPRSPEVQELAT
    EVRKQLPASDASDFAEQQKIVFGNFKENITTDPAIWRTVIDSVKAKLKAD

    >gi|308068013|ref|YP_003869618.1| Glutathione peroxidase-like protein [Paenibacillus polymyxa E681]
    MTVYEYDAHTLQGKQIPLSTYEGNVLLIVNTASKCGLTPQYKALQELYDQYHEQGLEILGFPSNQFAKQEPGSSEEISEF
    CQINYGVTFPMFAKTDVNGNQAHPLFRYLTQTAPGVLGSKAIKWNFTKFLITREGNVFKRYAPQTTPDKLAVDIEKLLQQ
    N

    >gi|308068021|ref|YP_003869626.1| Organic hydroperoxide resistance protein [Paenibacillus polymyxa E681]
    MEALYTASATVHGGRDGSVASSDGVLKHKLSTPKELGGAGGEATNPEQLFAAGYGACYESALANVARKAKVKVDNVEVTS
    HVSIGKDPSDGGFQLAVRLDVKIPGIERAQAEDLARQAHDF
    CPYSKATRGNIDVELNVI

    >gi|308068149|ref|YP_003869754.1| Putative peroxiredoxin in rubredoxin operon (Thioredoxin peroxidase) [Paenibacillus polymyxa E681]
    MAERLVGRPAPDFALETVTGDGQEFGSVKLSDYRGKWLVFFFYPLDFTFVCPTEITALSDAADQFKELDTEILGISVDSV
    HSHKAWINTAKENNGLGKLNFPLASDITKKTASDYGVLIEEEGVALRGLFIIDPEGELKYQVVNHNDVGRSVEETLRVLQ
    ALQSGGLCPMNWKPGDKNL

    >gi|308068173|ref|YP_003869778.1| hypothetical protein PPE_01400 [Paenibacillus polymyxa E681]
    MSQLKVYQYSKCSTCRNAVKWLQNKGHETELIPIFEQPPGPEELEDLIRKSGLELKKFFNTSGEVYKELKLKDKLGDMSR
    EEQISLLSSNGRLIKRPIVTDGNKVTIGFKEETFEGTWGAQ

    >gi|308068380|ref|YP_003869985.1| Dihydrolipoyl dehydrogenase (E3 component of pyruvate complex) [Paenibacillus polymyxa E681]
    MSKLESVETLVIGSGPGGYVAALRSSQLGMKTAIVERSQLGGVCTHVGCIPSKALIAEAHRYEILRQVNPADAAVSFVNA
    QAFKQGIVNKQAGGVGFLMKTAGVSILEGEASLVDGHTAIINQNGAEQTISFKYAILATGSRPIELKAFPFGGRILSSTE
    ALSLPEVPSSLIVIGGGYIGIELGQMYAKFGTKVTILEGGERVLPGFEMDLVAPVVKQLKTDGVSIVTGAVAEKVVQNTD
    TITLHYSKDQEQHHVTAEFVLVTVGRKPNTDGRLGLEHIGLPLTSRGLIETDEQCRTVIPHIFAIGDITEGPALAHKASY
    EAKIAAEAIAGQAAKVDYKAMPLVVFSEPELASVGLSETEAKEKALPIVIGRASFAVNGRALALRAAEGYIKIVAKQGSG
    IVLGAQIVGVEASTLISELALAIEMGATVEDLALTIHPHPTLGEVIMEAAENAVRKMDRPK

    >gi|308068480|ref|YP_003870085.1| Probable thiol peroxidase (Superoxide-inducible protein 8) (SOI8) [Paenibacillus polymyxa E681]
    MAQERTGAATFKGNPLTLLGPELKVGDQAPDFKLQKDLLETATLQDFAGKVKLISVVPSLDTGVCDAQTRRFNQEADSLG
    DQVVVLTVSVDLPFAQARWCGAAGIDRVLTLSDYKDHSFGEAYGVFIKEFHLDHRAIFVIDQNDKIAYVEYLSEMSEHPD
    YEQAIAAVKKLV

    >gi|308068488|ref|YP_003870093.1| thioredoxin-like thiol-disulfide isomerase [Paenibacillus polymyxa E681]
    MKRFLFIRAMVMLVVVGASCGVIANTTYAASQSMKNLPLKVGYGIERLEAEKEVEAKTHAVEVMKKIKPGQRLPSMILKG
    LNGKSYDVGATRNKALVISFWASW
    CDPCRLEAPMLNELYSKYKDDVDVYGINVTRYDRLEDVQKFSRSLDLQFPILLDEQ
    GALFERFGGVAFPTHVLVDHHGQVREIIIGMLDEQELERKIKTLQKKKVSLGAE

    >gi|308068496|ref|YP_003870101.1| hypothetical protein PPE_01726 [Paenibacillus polymyxa E681]
    MNAQKSNKKKLIPVIGFFVVLVILLGVLLALNSGTKNKLYGVSTASLNPATQELLNDPNYQQIIKPEDLQSKIDKKENFF
    VYHFASD
    CVHCRATTPKLLPLSKQENITMHEFNLREYEDGWDKYKIEYTPTLIYYEKGVEKERMVGGLKESPSDNGYTLD
    DFKAFFEKYKKNVTS

    >gi|308068506|ref|YP_003870111.1| gamma-carboxymuconolactone decarboxylase subunit-like protein [Paenibacillus polymyxa E681]
    MTVMDEKVHAYKDQISHLEDQLPEVVHAYHRFTGECFQAGSLDEKTKQLIALGIGLFANNEVCTFYHVDEARSKGASDQE
    IMETIAVAAAVGGGHALSQGVTRVQKALQ

    >gi|308068508|ref|YP_003870113.1| Peptide methionine sulfoxide reductase msrA (Protein-methionine-S-oxide reductase) [Paenibacillus polymyxa E681]
    MEKATFAGGCFWCMVTPFEEQPGIHGIVSGYTGGTIPDPTYEQVKTGTTGHYEVVQITFEPELFPYEKLLELYWPQTDPT
    DGEGQFQDRGTQYKPAIFYHTEQQRELAQQSKEQLAQSGRFDKPIVTEILPASIFYPAEDYHQDYHKKNVKHYKEDRAQS
    GRDEFIDKNW

    >gi|308068640|ref|YP_003870245.1| Organic hydroperoxide resistance protein [Paenibacillus polymyxa E681]
    MMTIQQKMYETTVKAVGGRNGYIESSSPELRLDIDTPKEMGGAGGAGTNPEQLFAAGYSACFDSALNMVARMQRVKHEGT
    EVTATVHFGKVEDGGFGIGVNLDVLVKGVDHETAVKLVEGAHEQ
    CPYSRATRGNIEVKLNVL

    >gi|308068801|ref|YP_003870406.1| Predicted redox protein, regulator of disulfide bond formation [Paenibacillus polymyxa E681]
    MEHTFLLKADWNGGRNSDGRIEAGQLRTAISIPAEMGGPGVGTNPDEMLLGAAATCYLITLAAMMERASLPVASLALESE
    GIVDVTNNIFTYRRIVHRPQVQLAADATESQIEQALRLAEQAETS
    CMISRAVAGNVALSTEPVVERAS

    >gi|308068841|ref|YP_003870446.1| hypothetical protein PPE_02072 [Paenibacillus polymyxa E681]
    MSSKPKVVLWSKTGCHFCGEIKSYLESQNQPYENIQVDGNDALRDVLETKYGIRYVPVVEVGGDNKYEALLNPNLEELGK
    VLESYNQVV

    >gi|308068981|ref|YP_003870586.1| hypothetical protein PPE_02215 [Paenibacillus polymyxa E681]
    MCEHAYRILLFYKYVNIEDPATFTAEHLAYCKELGVKGRILIAAEGINGTLSGTVEQTEQYMRDLRANPKFHDIVIKIDE
    SDGHAFKKIFVRHRQELVTLRHEDELDPNEISGKRLSPKEFYEQLQDEDVVVLDGRNDYEYDIGHFRGAIRPEVESFREF
    PQWIRDNMTQFKDKKILTY
    CTGGIRCEKLSGLLIKEGFNDVGQLDGGIVTYSKDPEVQGRLFDGKCYVFDERISIPINHT
    DEDVIVGKCFHCETPSDHYINCPVCNLQHIVCTDCKEQHQHYCSDDCRTKAETVATA

    >gi|308069056|ref|YP_003870661.1| hypothetical protein PPE_02290 [Paenibacillus polymyxa E681]
    MTTSSKPNRLAKEKSPYLLQHAHNPVNWFPWSDEAFEIAKRDNKPIFLSVGYSTCHWCHVMGRESFEDEEVAEVLNRDYV
    SIKVDREERPDVDHIYMSICQTMTGHGGWPLTILMTPDQKPFFAGTYLPKEQKFGRVGLLELLDKVGTRWKEQPEELVEL
    SEQVLTEHERQDLLAGYRGELDEQSLNKAFHEYSHTFDKEYGGFGEAPKFPSPHNLSFLLRYAQHTGNQQALEMAEKTLD
    AMSRGGIYDHIGMGFSRYSVDEKWLVPHFEKMLYDNALLAIAYTEAWQMTGKELYRRITEQIFTYLARDMTDAGGAFYSA
    EDADSEGEEGRFYVWDDSEVRAVLGDEDAAFFNDLYGITPYGNFEGHNIPNLIDINLEAYGIKHDLTEQELEQRVSELRA
    KLFAAREQRVHPHKDDKILTSWNGLMIAALAKAGQAFGDMRYTEQARKAETFLWNHLRQENGRLLARYRDGEAAYPGYVD
    DYVFYVWGLIELYQATFDIVYLQRALTLNQNMIDLFWDEERDGLFFYGSDSEQLIAKPKEIDDGAIPSGNSIAAYNFVRL
    ARLTGESRLENYAAKQFKAFGGMVAHYPSGHSALLSALLYATGTTKEIVIVGHRDDPQTGQFIRAVRAGFRPNTVVILKD
    EGQSEIAETVSYIRDYDLVEGKPAVYVCEHFTCQAPVTRLEDLKVLLD

    >gi|308069080|ref|YP_003870685.1| hypothetical protein PPE_02314 [Paenibacillus polymyxa E681]
    MSSTNNIQADHILDCKGLACPMPIVKTKKAMNELVPGKIMEVQATDKGSLADFQSWAKNTGHQYLGTLQEGDVMRHYLRK
    ANPAEVKNKQIFSSTISHEELQAKCSGKENFILLDVREPAEFALKHIPGSKHIPLGELENRLSELNLEEEIVVI
    CQAGAR
    SEMASQLLVSKGAKKVKSVLSGISEWAGETKGSESI

    >gi|308069252|ref|YP_003870857.1| Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Paenibacillus polymyxa E681]
    MNIEVWSDYMCPFCYIGKRRLEQVLQQFPHRDEVQLTFKSFELNPGAVRDSGKTINEELSAKYGVSLQEAQAMNDRMNEN
    ARSAGLDYNIHAMVPTNSLDAHRLTLWAQTQGKMLELSERLFQAVFIEGKHTGDHEVLVALATEVGLDQKEAAAILASDR
    FTDEVRADEAEGAELGVQGVPFFVFDRKFAVSGAQPEEVFHDALQKAWDERSPFTMISGSSSKQDAGGICTDEGCELPGR
    EG

    >gi|308069292|ref|YP_003870897.1| Dihydrolipoyl dehydrogenase (E3 component of pyruvate complex) [Paenibacillus polymyxa E681]
    MVVGDASLDIDTLVIGAGPGGYVAAIRAAQLGQSVLIVDKSELGGVCLNRGCIPSKALISAAHQYEAAKHGESFGITAEN
    VKVDFAKTQEFKNGVVKKMTGGVSGLLKGNKVEVFNGECMFINENEARVFNEHESPRYRFKNAIIATGSRPIELKPFPFG
    GRILSSTEALNLPEIPKSLIVIGGGYIGAELGQMYSKFGSKVTIIEGMDTVLPGFDKDMTSIVAKSMKKTGIEIFTGAKA
    ESAEQTDKDVTVKFSVNGESKEVTADYLLVTVGRRPNTDGELGLDLIGVELDDRGMVKVDHQGRTSIPHIFAIGDIVAGL
    ALAHKASYEGKVAAEAIAGEPSVVDYKCMPAVVFTDPECSSVGYTETQAKEKGYNVKVGKFSYGANGRAVSLNAAEGFVK
    IVADADTGLVLGTQIVGLEASNLIAELGLAIEMGATLEDISLTIHAHPTLGEIVMEAAEVVLGHPIHALAPRR

    >gi|308069301|ref|YP_003870906.1| Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Paenibacillus polymyxa E681]
    MKVTDKSGAGGTHPSDRYSRQERFAPFGPIGQRRLASSHVLIIGVGALGTGIAETLVRGGVGTVSLVDRDYVEWSNLQRQ
    QLFQESDAAQRCPKSVAAQRRLKDINSETVIHAHVLDVRVEELEELIQGVDLIMDATDNFDTRLLMNDMALKHRIPWIYG
    GCVGSYGITYTILPGQTPCLHCLLGTVPFGGET
    CDTAGIIPQAVQMVTANQTTEAFKLLGGYPEDLRGKLLSFDLWKNEY
    VAIAVDSVKKENCPSCGSQPTYPYLSASHRQKTDVLCGRDTVQIRPANLTHLNLAETADRFASLGEGKVERNSFLVSFST
    SEHRLVIFADGRALIHGTKDVAKARSLYQRYLG

    >gi|308069318|ref|YP_003870923.1| Thiol-disulfide isomerase [Paenibacillus polymyxa E681]
    MKEIGQKELRRAIWEGCKLALFVYTPMCGTCAAARKMLEVAEHLLPEEVVVQSNINYIPELVQEYRISSVPALLIYNGEN
    KNPEIIYKMESVGHLLSKIRSVME

    >gi|308069583|ref|YP_003871188.1| Dihydrolipoyl dehydrogenase (E3 component of pyruvate complex) [Paenibacillus polymyxa E681]
    MTIHCDVAILGGGTGGYVAAIRAAQLGKEVVIIEKDKLGGTCLHRGCIPSKALLRSAEVYATIKESAQYGIETSGAQLVF
    PKVQERKEAVVEQLHQGVQFLMRKNKITVLSGKGRVIGPSIFSPKSGAVAVELEDGEMETIVPAHLIIATGSRPRVLSGL
    EPDGEFILSSDEALTMAELPASLIIVGGGVIGVEWASMLNDFGVEVTVVEAANQLIPTEDEDVSREMQRLLTKRGVKVLT
    GSQVLAKTYGKDEESVQIDVQKGEETETLSASKLLISVGRQANVENIGLENTDIRVERGFISVNEHLQTNEPHIYAIGDC
    IGGLQLAHAASHEGLQAVHHLAGEEFHSVPNHLIPRCIYTRPEAASVGLTEQEARERGHQVKTGKFPFQAIGKSLVYGSR
    DGFVKVVADEKTNDILGVHMIGTHVTDLISEAALAQLLDATPWEVGQLIHPHPTLSEILGEAMLAVDGQAIGI

    >gi|308069652|ref|YP_003871257.1| Peptide methionine sulfoxide reductase msrA/msrB [Paenibacillus polymyxa E681]
    MSTNNPHTVEKATFAGGCFWCMVSPFEELPGILKVRSGYTGGHTENPTYEEVCSETTGHVEAVQITFDPQVFPYEKLLEL
    FWQQIDPTDEGGQFHDRGSSYQTAIFYHNEDQRIKAEASKEALAQSGRFDKPIATPILPAATFYEAEEYHQDYHKKNPAH
    YKRYRKGSGREDFIEQNWSGKIDKSDLKDRLTPIQYEVTQKNATERPFQNEFWDHEGEGIYVDIVSGEPLFSSLDKYDAG
    CGWPSFTRPLRSYNVKEKTDLSHFMIRTEVRSREADSHLGHVFDDGPGPDGLRY
    CINSAALRFVPQEDLEREGYGAYKSL
    FEK

    >gi|308069723|ref|YP_003871328.1| Rhodanese-related sulfurtransferase [Paenibacillus polymyxa E681]
    MTQIALIEPSELRARLQAGEQLQLIDVREAEEVAEGMIEGAKHIPLGQLPGRLEEIERTGEIIFICRSGYRSERACEYLQ
    QLGYEGCTNMTGGMLQWSQEQ

    >gi|308069735|ref|YP_003871340.1| Nitrite reductase (NAD(P)H) [Paenibacillus polymyxa E681]
    MNDIQKLVLVGNGMAGIRTLEHLLKLAPGSYEITVFGAEPHPNYNRIMLSSVLAGGAGLQDIVINDWSWYEDNNIRLYTD
    DPVTAIDTEKQQVTSRSGICISYDLLLLATGSKAFMLPLPGADKEGVIGFRDIRD
    CETMMETAKTHKKAAVIGGGLLGLE
    AARGLLNLGMNVTVIHINGYIMDRQLDEAASLMLRRELEEQGMTFLVNKRTAAITGRRRVEGLKFADGSELEADLIVMAV
    GIRPDIELAVSAGIPVNRGIVVNDYMETNIPGIYAVGECAEHQGITYGLVAPLYEQGGVLAQRLAGMETPGYSGSVTSTR
    LKVSGVDVFSGGVYKDEPETRSLRYQDDIGGVYKKIVIKDEKLIGAVLFGDTSDGAMLFSLIKSGESVVGREKELLLGFN
    PGQPEASGVMMLEQMPDDEIVCGCNGVSKGDIGEAVAAGCRSVGEIKACTKASASCGGCKPLVEGLLQLYAGAEAGETMK
    EGICSCTTLDREAIIDGIREMGLKSVKEVMNVLGWNEPEGCTKCRPALNYYLGMLWPLDYEDEKESRFTNERYHANIQKD
    GTYSVVPRIYGGVTSPADLKKIAAVAEKYNVPLVKFTGGQRLDLLGVKKEDLPGIWAELDMPSGYAYGKTLRTVKTCVGN
    TFCRFGTQDAMGMGIRLEKAFERLNAPSKVKLAVSGCPRNCAEATIKDLGVVAIDGGWGIYVGGNGGIKVRAAELLCTVK
    TEDEVMEWIGAYLQYYREQANWNERTAHWVERVGVESIKQALANTETRKQLVTRIEETLSTTTDPWHEIIHNEELRKNFV
    QLPELKPAME

    >gi|308069739|ref|YP_003871344.1| Nitrite reductase (NAD(P)H) [Paenibacillus polymyxa E681]
    MMKKLVVVGNGMAGIKCVEEILDLEPERFQITIFGAEPRPGYNRVLLSKMLQEESSFKHIVTHDWDWYEENGVKLYAGER
    VCRIDAAAGMVETESGMKEPYDMLILAMGSLPFMPPIPGARKQGVIAFRDVND
    CETMARYAKTYRKATVIGGGLLGLEAA
    QGLLNLGMETEVVHNAQYVMNRQLDRTAAVLLQRKLEQQGMRFHLAKDTVNIIGRNRVQGLMFADGGRLETDLVVLAVGI
    RPNIELAQDSGLTINRAIVVDDYMRTSIPGIYAVGECAEHRGISYGLVAPLYEQGKVLAKVICGRETAPYEGTVPYAQLK
    VAGIHVFSAGDIRDEENETAVMEYNGMLKVYKKVMMHGGAVTGAILFGDTAESTSLLALVRRGAPAIELTSRDNGGSKAE
    DAAAALPEEETVCACNGVSKGAILRAIATDKLKTVEEVKSRTKASGSCGGCRPLVAALVKNSLSRSTVSGPLVTPTAQEV
    VPVCGCTHYDHDSLKTAMVDAVCQTPDEVVSRLGWTRQQGCELCRPVVLYYLESLGLRDRSATNPLGAGVAVQVTPQYGG
    EAHSAGLRFTNINAENRAFVESDLMDQAFVEVAWLRERLTTLWGSLALPALVTVAICPGSAYPGGVLVHDIGISRSPAGW
    EVYAGGHAEHPVRQGQLLGLEEGPAEAVLMAAACLQIYRHSARYGEKVWEWMERTGVLALRESVHDAALRSGLAGSLRTT
    MLTG

    >gi|308070032|ref|YP_003871637.1| Adenylyltransferase thiF [Paenibacillus polymyxa E681]
    MSEMDKIQEIEVAAQAHAHASHARYSRQELFSKIGPTGQQNIRSKHVLMVGAGALGTANADMLVRAGIGRLTLVDRDYVD
    WSNLQRQQLYDEADARDQIPKAVAAQKRLQQINSDVDVRALVRDVSLDEIDDIAAGVDLIVDATDNFDTRLLMNDYAVKH
    RIPWIYGACVGSYGTTFTIVPGQTPCLHCLLGTVPLGGAT
    CDTVGVISPAVQMVAAYQSAEALKLLTGDESALQGKLISF
    DLWNNQHQAIQISAMKKADCPTCGEYPVYPFLQSEHQAKTAVLCGRDTVQIRPAPGTVRDLNEAARLLSRQGGKVEHNPY
    LVSVVIGTHRIVLFQDGRVLIHGTKDIAEARSIYHKYLG

    >gi|308070057|ref|YP_003871662.1| Probable 3-mercaptopyruvate sulfurtransferase (Rhodanese-like protein) [Paenibacillus polymyxa E681]
    MKSIVSKRWLLARLYEPDMIIADCRSLLGQAGAGRTQFNEDHIPGAVHFDLEEDLTAPLGEHGGRHPLPDADTLAARLSR
    AGINASSRIVAYDDQGGMMASRFWWLLRYLGHEQVYVLEEGYSAWKEAKFPVTADQPIRIPSTFVANVQQQMLTSMKEIQ
    HISEDSAPVGSYIGFSPILIDSRERPRYLGLEEPIDQAAGHIPGAVNYFWKEVLDEKGSFKNAEQLQQHFADLDPNAEII
    VY
    CGSGVSACPNVLALNEAGFSKVRLYPGSWSDWISYEENPVATGEE

    >gi|308070130|ref|YP_003871735.1| Adenylyltransferase thiF [Paenibacillus polymyxa E681]
    MNERYSRQILFRPIGGEGQRNLSAAVVTIIGCGALGSAIAETLVRAGVGELHLVDRDYVEMSNLQRQQLFTEQDAAEMQP
    KVMAAEKRLNAIREDVRLHTYLDNLDAELVQELASKSILLMDATDNFETRLLINDAALKAGIPWIYGACVGSIGVVFPFV
    PGESACLRCLLPSLPAINQT
    CDTAGIISPAVQVTAALQCAEAMKWLSGRRGKMRSKVHLFDLWENTQMDIGISRIRNQDC
    PTCGEHPTFPALTASRRSAYAALCGRNVVQVLPDPHRPITLDDAEKMGRLIADRVKRTPYFVEFYAFKHRMILFKNGRLL
    IHGARSVANGQKLYHQLFG

    >gi|308070160|ref|YP_003871765.1| Methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) [Paenibacillus polymyxa E681]
    MSELYVMKYVSPIGEIEIQGTNEAVYSIMFSNRNELLTRAIGEVPIRVLAECAIQLDEYFKGERFEFTFPYAFEGTDFQQ
    KVWNALVSVGYGKTTAYKDIALAIGNEKAIRAVGSANGKNKLSIVIP
    CHRIIGSNQKLTGYAGGLWRKEWLLQHEKRCLR
    T

    >gi|308070453|ref|YP_003872058.1| Thiol-disulfide isomerase [Paenibacillus polymyxa E681]
    MKKGYIAGLSVIVLLVIGIAISAVVKFQDLEQVVQQKDKEIQASKSNYPEIYDHLNAVTFDGFKRLIQQDQSVFVYVGRP
    S
    CGDCNRFEPNFNKMIEQYNLGSKITFLNVHKIHKDKPQWNKFKEDYNVKYTPTIAEFRNGKLVDKIEWTPKRDLSTDAV
    KEWLTSKKIIL

    >gi|308070539|ref|YP_003872144.1| Thioredoxin reductase [Paenibacillus polymyxa E681]
    MLYDCAIIGGGPAGLNAALVLGRARRSVALIDNNRPRNAVTHASHAFITRDGVTPAEFRRVAYEEVLRYPSVHHLQTEVV
    SIMKKESGFEVLDSSGLRVQARKLILATGVKEIFPEIEGFYPLYGKSLFN
    CPYCDGWELRDQPLVLVSESAAIFHTAKLL
    LNWSKDLIVCTNGHASLSDEQKERLQSKGIVVMEQSVSAFIGHNGKLEHVRFTDGTQVPRVGGFVSPQFVQSASFGERLG
    CERTESGGIKTDEAGRTSIPGVYAAGDSSYFMPSQLIFAAADGSRTAASVNMDLTEEDFNE

    >gi|308070606|ref|YP_003872211.1| Thioredoxin (TRX) [Paenibacillus polymyxa E681]
    MAIVHVSDQSFNAEVEGTGTVLVDFWAPWCGPCKMIAPILEDLSTEVGDSVKIAKVNVDENPESASRFGVMSIPTLIVFK
    DGQPVDKVVGLNSKEALKSMLTKHQ

    >gi|308070634|ref|YP_003872239.1| hypothetical protein PPE_03904 [Paenibacillus polymyxa E681]
    MINITDSAAERLKDMLEQQETPNMFLRLGVTPGGCTGFSYAMGFDDNETDQDIYMNVQDMKIVVEKESIRYLDGLEIDFE
    ESGMSGGFTIHNPNAVATCGCGSSFRTATDAGKPNEEPC

    >gi|308070646|ref|YP_003872251.1| Thiol-disulfide isomerase [Paenibacillus polymyxa E681]
    MQKIVSHEDFNKAISTSGVTVAVFKADWCGDCHFIDPFMPDVEQQYADKLTLIEIDVEQAESVSQEQNVLGIPSFIAYSE
    GRELVRLVNRLRKSREEIEQFLDRAVEVHASLAK

    >gi|308070679|ref|YP_003872284.1| Methylated-DNA--protein-cysteine methyltransferase (O-6-methylguanine-DNA alkyltransferase) [Paenibacillus polymyxa E681]
    MAQQINKTIYWSLLTHEDWNLYIAATSEGLCYVGSPNQPVEELFSWAGSRFPGSPLVEEDAALQPYAKELIEYLQGERTQ
    FTLPFDFHGTAFQMAVWNALCDIPYGETLSYSDIANAIQKPASVRAVGAAIGANPILVTVP
    CHRVIGKNGAMTGYRGGLD
    MKVKLLQLEQESVASVQYEK

    >gi|308070770|ref|YP_003872375.1| Glutaredoxin [Paenibacillus polymyxa E681]
    MEKAIVYTSTNCPHCRQVKSYLSEKGVEYEERNIETNEAFAQEVWDMGIRAVPLTLIGEERISGMNKTKFEKVLNT

    >gi|308070771|ref|YP_003872376.1| Thioredoxin reductase (NADPH-dependent thioredoxin reductase) [Paenibacillus polymyxa E681]
    MYKSIIIGTGPAGLTAAIYLARANMSPLVIEGPQPGGQLTTTTEVENFPGFPEGIMGPDLMDNMRKQAERFGAEFRTGWV
    NKVDTTARPFTLDVEGLGELVTDTLIISTGATAKYLGIPGEQDNIGRGVST
    CATCDGFFFRGKEIVVIGGGDSALEEANF
    LTRFASKVTLVHRREEMRASKIMQDRARANNKIEWALNRTPVEVIADENGVTGLKVLNNATGEEEVITVSGVFVAIGHHP
    NTGFLEGQITTDANGYIVVNPGTSETNVPGVFACGDVQDTRYRQAITAAGSGCMAAMDSEKYIESLEHSALAL

    >gi|308070780|ref|YP_003872385.1| Zinc-transporting ATPase (Zn(2+)-translocating P-type ATPase) [Paenibacillus polymyxa E681]
    MDALKRTERHEWILEGLDCANCALKIENGVSKIEGVMDCSVNFVTKTLRMTTSSDQKEEVFRQTERKVHRLEPHVRMVVK
    NARGRLHEDSRSNAGAVQSDSTEDCACGHEHDGEGEGHTHEVGQHAAHSHAGHHHGAYGKQAHAHDGHNHGDHGHEHHNH
    HAEHEHGEATHAHSHSHGDDGHAGHTHDHGTDGLRRMIARLAIGAVVAAIAWWLPVEGVGKLALFLLAYIIVGGDVVLQA
    ARSLVRGMAFDEYFLMTLATVGAFAIGEYPEGVAVMFFYQIGELFQGIAVNRSRKSISDLMDIRPDYANLKTAESVRRVS
    PEDVRIGDLIVIKPGEKIPLDGKVIDGKSHVDTSALTGESVPRTVEPGSSVLSGFINTNGLLTVEVSKEFSESAVSKILE
    LVQNASAKKAPTEKFITKFSRYYTPVVVIVALLLAVVPPLVVPGAQFADWVYRALVFLVISCPCALVVSIPLGFFGGIGA
    ASRSGVLIKGGNYLEALNHVKYAVFDKTGTLTKGVFRVTGIYPAGDYTNETLLETAALAELHSTHPIAASLRESYGKELR
    AERVQQYSEISGHGIQAQIDGRLVSAGNAKLMEREHVAFNAAQQAGTLDEGTVVHVAVDGTYAGCILISDEVKTDAAQTV
    ASLKKLGVVKTIMLTGDNRTVAEAVGRQLGLDEVRAELLPQHKAEAIEQLSASKKTSDKILFVGDGINDTPVLALADVGV
    AMGGLGSDAAIEAADIVIMNDEPSRLVTAIHIAKRTRRIVWQNIIFALGVKAVFLTLGAFGIATMWEAVFSDVGVTLLAV
    LNVMRVLKVRSYE

    >gi|308070811|ref|YP_003872416.1| Thiol-disulfide isomerase [Paenibacillus polymyxa E681]
    MERIESQQQYQDLINGDGLTVVKFDTTWCPDCKTLDKFMDGIIEENADKRFFALDAEKFQPIAEENQVRGIPSLLVFRNG
    EKIAHLHSKYAKTPAQISEYLTTLESKQ

    >gi|308071194|ref|YP_003872799.1| NADH oxidase (NOXase) [Paenibacillus polymyxa E681]
    MKVAVIGCTHAGTAAIVNTAKCYPDAEITVYERNDNISFLSCGIALYVGGVVKDPHGLFYSSPDQLADLGVETKMLHEVT
    SVDTAGKTLHARNLQTGEEFTDTFDKLIVTTGSWPIIPKLEGIELDHILLCKNYNHSNDIIEKAQHVQNITVVGAGYIGV
    ELVEAFQMNGKNVTLIDSADRILNKYLDHEYTDRIESSLKEHGIKLVLGETVSRFEGTNGKVSKVVTSKGEYETELVILC
    IGFRPQTDLLKGQVDMLPNGAIIVDNYMQSSCPDVFAAGDSCAIRYNPTGKTAYIPLATNAVRMGTLVARNLVQPTIAYM
    GTQGTSGIKIYEDNIAGTGMTEAAATDEGMTVEAVTIEDSYRPEFMPTSEKVLLKVVYEQETRRILGAQIMSKVDLTQSI
    NTLSVAIQNHMTIDQLAFVDFFFQPHYNKPWNFLNAAGLQALPTISERNPVTV

    >gi|308071196|ref|YP_003872801.1| Glutathione peroxidase [Paenibacillus polymyxa E681]
    MSVYSHNAVTPANQEVSLDTYIGKMLVIANTASKCGLTPQYGDLQKLYDEYKDRGLVVLGFPCNQFGGQEPGSSEEAAEF
    CQLNYGVNFPVFAKVDVNGPNTAPLFEYLKKQQPGEQEDGTIQWNFTKFIVNREGVPVGRFEPKESPEAMKAAIEQLL

    >gi|308071473|ref|YP_003873078.1| Glutathione peroxidase [Paenibacillus polymyxa E681]
    MSVYDFQATSINGDLIELSDYRGKILLIVNTASMCSFSSQFTDLQKLYEKRREQGFEILAFPCNQFNEKEPGSHSEVQGF
    CQINHGVTFPLFEKTDVRGSSPHPLFQYLTQQAPFQGFDTQTKDGQWMEDFLRDRYPEIYAGDGIKWNFSKFLVDRDGQV
    KGRFEVTTEPSAIDPVIESLL

    >gi|308071574|ref|YP_003873179.1| Peroxiredoxin [Paenibacillus polymyxa E681]
    MPTTTLTSALEKVTAANPFEVQAIHQRVIQQLQEEGKATGLPVGAKAKDFELPDSLGNQINLADELAKGPVVLTFYRGGW
    CPYCNRQLRAYQEILPDIQALGAQLIAVSPQLPDYTLSDQEKAELSFKVLSDPKGIVATKYNLLYEVPDYLKSMYLSHNI
    DLHEYNGTDHWLLPVTGTFMIDEYSVIRSAYVNPDFTKRMEPEDILWELRKL

    >gi|308071583|ref|YP_003873188.1| Thioredoxin reductase [Paenibacillus polymyxa E681]
    MESGIVKSVTGSDEDFHQLLESPGAAASSRKILFATGMKDVLPNIEGLVEVYGTSAFVCPFCDGWELRDKHICVIAPNDL
    NLHFVKMISGWTKYVTLLTNGSQFLSSDQLADLELHGVYAVQDEIERIESIQGYVNLITFRSNAPVKCDGIFFSPTLIQS
    TTLPERLGCELSDNGTIVKIVTDPMGRTNVPGVYSAGDAAGAQYQLISAASSGATTAAAIQLDLLDIEWKSVQ