Orientia tsutsugamushi Ikeda uid58869

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189182938|ref|YP_001936723.1| thioredoxin [Orientia tsutsugamushi str. Ikeda]
    MTKNITEINDEENFKQEVFLSPKLVLVDFYADWCGPCRQLSPILEQISEELSDKVKIVKVNIEKNIQVATDFKIQSIPTL
    ILFNNGEAVSREIGGKSKQDIIDWINNY

    >gi|189183182|ref|YP_001936967.1| thioredoxin peroxidase 1 [Orientia tsutsugamushi str. Ikeda]
    MEIFVGKSACDFTAPAVLPKNNINEKFNLKHELDGRKAVLFFYPLNFTFVCPTEIIAFNNRYGEFLKRNTEVIGISVDSH
    FCHKAWKLTPYNKGGIGDIQFPLVSDINKDISKTYNVLNQDGVAVRATFIIDQEFVLRHVTINDLSIGRNVEESLRIIDA
    IDFHKKYGDVCPAGWTPGTEGMEATSDGVCHYLTSNAEKL

    >gi|189183411|ref|YP_001937196.1| hypothetical protein OTT_0504 [Orientia tsutsugamushi str. Ikeda]
    MKYLHRNFYILAAICLMAIYHVFSKSDNLVERSISSTNDINQHDNSQQISSNDVQLATTSEDQDNNINEDNNISTNNSKE
    TINSVLKINKYDIVLGNKDSNIKIFEYFSYA
    CYHCARYHEKIFPTLKHKFIDTNKIAYITREFITAKQDLDGAMLSRCGG
    TLMWNKFHTTLLEQQDKWVFNKNYMNWLKDIGKIGGITTDQFLNCFKDEILAQQLMLNTVNISKFEIFDGTPCIIAVIND
    EHIIRIENVITEISDIVEKADNSKDKKNDITEAQEK

    >gi|189183478|ref|YP_001937263.1| HesB protein [Orientia tsutsugamushi str. Ikeda]
    MNAINSSQLQINKARKQVITISSRAAKRIKELLAKREKPSLGIKVGIKTGGCSGYSYYIEYADVKGDFDEVIIDKGVTVL
    VDQKAILYLVGTTMDYIEGKFNSGFEFSNPNEKHRCGCGKSANF

    >gi|189183707|ref|YP_001937492.1| peroxiredoxin, AhpC/TSA family protein [Orientia tsutsugamushi str. Ikeda]
    MKNLTINDDAPDFNMITTSNSIINLGHYEGKNLVLYFYPKDNTPGCTIEAQKFNEAISEFNKLNTIILGVSKDNIASHQK
    FKDKLCLKFELGYDETGKIFEDYGVLKEKSMFKNTFLAISRTTFLINQKAKIAAIWPKVNITQHSDEVLNMVKNTI

    >gi|189183802|ref|YP_001937587.1| glutaredoxin 3 [Orientia tsutsugamushi str. Ikeda]
    MKRILIIVILPIILSYFIIKKTGILEYMKKSELQDEDFMIYDDDNIYIYTKPTCPYCLNAKSLLNQKSVSFKEIDISNNQ
    QLHEKLKQATSQTTVPYIFIYGQFIGGYMQLQDLDNTDKLDELLAQK

    >gi|189183881|ref|YP_001937666.1| SufA protein [Orientia tsutsugamushi str. Ikeda]
    MSNSKFNVTISDTVYKRIHELNEEANEQQPLMLRIRVDAGGCSGFIYEYDLVMDYEPGDFIAEKDNAIVVIDSLSQNFIN
    GAIIEYIEELGRSYFKITNPAAQAKCGCGNSFAL

    >gi|189184133|ref|YP_001937918.1| peroxiredoxin, AhpC/TSA family protein [Orientia tsutsugamushi str. Ikeda]
    MKNLTINDDAPDFNMITTSNSIINLGHYEGKNLVLYFYPKDNTPGCTIEAQKFNEAISEFNKLNTIILGVSKDNIASHQK
    FKDKLCLKFELGYDETGKIFEDYGVLKEKSMFKNTFLAISRTTFLINQKGKIAAIWPKVNIAQHSDEVLNMVKNTI

    >gi|189184152|ref|YP_001937937.1| glutathione S-transferase [Orientia tsutsugamushi str. Ikeda]
    MRKVYYYPLCPFSRQLRIILKEVDSVFTLIKEEFWLKKKEFITLNPNGKLPVLIETSGLVVYDIFTIIEYLREIEPNFHF
    ICNEPEKNVAIRKLFTWFNDKFYHEVTKIILDEKLIKFLKNYGSPRSDLLKIAKTSQKAHFNFIANLLQSNSYLAGDQVT
    IADIAAASHISVIDYFNEVVWDYYPSVKNWYVLIKSRPSFKPLLQDYTPGFFPPKYYAELDF

    >gi|189184159|ref|YP_001937944.1| thiol:disulfide interchange protein [Orientia tsutsugamushi str. Ikeda]
    MMILSLYKKTVAIIILLIMILCNSISIVCAKLLKDASTTIELVPYQANELTPEKINDHIRQYILSHPEVIIESIEIMQQK
    QQQQEQEYLANAISEQLKILHNTHNLPTVGNTHGDIIITIFYDYN
    CKYCKLLNNIVNKLIVENEDIKIIWVPLTILGGLS
    EHAAKIALAVYEVAPSKFHIFHNKIMSLTKVTLQDIENILVEAEIDVDKVSNLTNSSNVQNILSMINNIASKCNLNGVPL
    TVIGNKVYTGLVDKLQQGVNEAREKNKAIVCHLK

    >gi|189184167|ref|YP_001937952.1| peroxiredoxin, AhpC/TSA family protein [Orientia tsutsugamushi str. Ikeda]
    MKNLTINDDAPDFNMITTSNSIINLGHYEGKNLVLYFYPKDNTPGCTIEAQKFNEAISEFNKLNTIILGVSKDNIASHQK
    FKDKLCLKFELGYDETGKIFEDYGVLKEKSMFKNTFLAISRTTFLINQKGKIAAIWPKVNIAQHSDEVLNMVKNTI

    >gi|189184229|ref|YP_001938014.1| thioredoxin reductase [Orientia tsutsugamushi str. Ikeda]
    MLSKNVHTTDVVIVGAGPVGLFAVFQAGMLEMKCHVVDALDCIGGQCVTLYPDKPIYDIPAYPVITAAELIEQLKQQSAP
    FDTVYHLGQQVIGCKIDNDMITITTSAEQVICAKSLIIAAGCGAFKYKRLTLDNIEAFENKTVFYSVKDKNKFINKKVVI
    AGGGDSAIDWTLLLSDVAEVIYLVHRRENFRCAPHSLNQIKKLAECGKVQMIVPYQLAKLTGENGLLQEVLVTNFDGGAQ
    TLPADYLLAFFGLAADLGPIHKWGLKTDLRRIEVNSITYETTIPGIYAIGDVASYPGKLKLILTGFAEAATAMSHCYQRV
    FGKKMHFQYSTVKGVLRS

    >gi|189184248|ref|YP_001938033.1| hypothetical protein OTT_1341 [Orientia tsutsugamushi str. Ikeda]
    MIDTILKGLILNSYRRFFIVLAIVPVVSLSFAYYVEYILEVAPCTLCTYQRWPYYMLFFLSILGISFSRLSNILHKVIIL
    NFVISALISGYHYGIEKEIFSEPKT
    CKVNTIMSENLSVKERIKLLETIPVVKSCKAVPFKIMNMSMAVMNFLWSILLLLF
    CCIVNLYYCKYAKANICSRSSC

    >gi|189184450|ref|YP_001938235.1| thioredoxin reductase [Orientia tsutsugamushi str. Ikeda]
    MIISRKVNVLIMGSGVAGSTAALYLARSHSNPVLLHGNQPGGQLMTTLEVENYPGFTNTVSGPWIMDQMHNQVKKFEVEV
    IDDHIKAVNFKTYPFEATGNKALYYANSVVICTGAQAKWLNIPSETTFRGYGVSS
    CATCDGFFFRNKRVVVVGGGNTAVE
    EALHLTNLTTQVTLIYRGDEKKGLKAEAILQKRLFKKKQEGKFTIIWNSTIEEILGNDNGAKTVTGVRIKNSKNNTISTL
    EVDGVFIAIGHAPNTSLFTNQLDMDSYGYIITKPNSTQTSIEGIFAAGDVQDNKYRQAVTAASSGCMAALDVQDFLKKIE


    >gi|189184453|ref|YP_001938238.1| dihydrolipoamide dehydrogenase precursor [Orientia tsutsugamushi str. Ikeda]
    MPESFDLVVIGGGPGGYTGAIRGAQLGMKVACVDNRNTLGGTCLNVGCIPSKFLLHVSKKYEDIKAGFDDLGINVGATKL
    NLANMLNSKNKRVQELGNGISGLFKKNKVSHFVGTGKIINSHEISVQTSSGSNTSITNIHAKNILIATGSEITTLPGIEI
    DEEYIVSSTGALSIKSVPKKMLVIGGGYIGLELGSVWRRLGADVTVVERSDRIASAMDNELGKLTQQALSKQGIKFKFNT
    KIISAVVKNQTVDVILQSVNGDNIQEEKINVDVVLISVGRKPYVKNLGLENIGIKLDKQHGTIEVDEKFTTNIKNIYAIG
    DVIKGPMLAHKAEEEAIAAVENMTGQAGHVNYNVMPSVIYTFPEVASVGYTEEQLKELGIQYVVGKFPFLANSRAKVIYN
    DVTGMVKILAHAKTDLILGVHIIGPEAGTLIAEAAVAMEFHASAEDIARTCHAHPTLSEALKEAALAVAKRSVNY

    >gi|189184810|ref|YP_001938595.1| peroxiredoxin, AhpC/TSA family protein [Orientia tsutsugamushi str. Ikeda]
    MKNLTINDDAPDFNMITTSNSIINLGHYEGKNLVLYFYPKDNTPGCTIEAQKFNEAISEFNKLNTIILGVSKDNIASHQK
    FKDKLCLKFELGYDETGKIFEDYGVLKEKSMFKNTFLAISRTTFLINQKGKIAAIWPKVNIAQHSDEVLNMVKNTI

    >gi|189184852|ref|YP_001938637.1| glutaredoxin-like protein GrlA [Orientia tsutsugamushi str. Ikeda]
    MNKDNIFQLIEQQIKSNDIVLYMKGTIHAPRCGFSAIVANIIQELTKDFKNINCTYIDVLCDDDLRQGIKEYTDWPTIPQ
    LYIQEEFIGGCDIVKEMYRNGELKALLLQKFKDIKDN