Orientia tsutsugamushi Boryong

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148284007|ref|YP_001248097.1| thioredoxin reductase [Orientia tsutsugamushi str. Boryong]
    MSRKVNVLIMGSGVAGSTAALYLARSHSNPVLLHGNQPGGQLMTTLEVENYPGFKNTVSGPWIMDQMHNQVKKFEAEVID
    DHIKAVNFKTYPFEATGNKALYYANSVVICTGAQAKWLNIPSETTFRGYGVSS
    CATCDGFFFRNKRVVVVGGGNTAVEEA
    LHLTNLTSQVTLIYRGDEKNGLKAEAILQKRLFKKKQEGKITIIWNSTIEEILGNDNGAKTVTGVRIKNSKNNTISTLEV
    DGVFIAIGHAPNTSLFTNQLDMDSYGYIITKPNSTQTSIEGIFAAGDVQDNKYRQAVTAASSGCMAALDVQDFLKK

    >gi|148284010|ref|YP_001248100.1| dihydrolipoamide dehydrogenase [Orientia tsutsugamushi str. Boryong]
    MPESFDLVVIGGGPGGYTGAIRGAQLGMKVACVDNRNTLGGTCLNVGCIPSKFLLHASKKYEDIKAGFDDLGINVGATKL
    NLATMLNSKNKRVQELGNGISGLFKKNKVSHFIGTGKIINSHEISVQTSSGSNTSITNIHAKNILIATGSEITTLPGIEI
    DEEYIVSSTGALSIKSVPKKMLVIGGGYIGLELGSVWRRLGADVTVVERSDRIASAMDNELGKLTQQALLKQGMKFKFNT
    KIISAVVRNQTVDVILQSVNGDNMQEEKINVDVVLISVGRKPYVRNLGLENIGIKLDKQHSTIEVDEKFTTNIKNIYAIG
    DVIKGPMLAHKAEEEAIAAVENMTGQAGHVNYNVMPSVIYTFPEVASVGYTEEQLKELGIQYVVGKFPFLANSRAKVIYN
    DVTGMVKILAHAKTDLILGVHIIGPEAGTLIAEAAVAMEFHAAAEDIARTCHAHPTLSEVFKEAALAVAKRSVNY

    >gi|148284064|ref|YP_001248154.1| disulfide bond formation protein [Orientia tsutsugamushi str. Boryong]
    MIDTILKGLILNSYRRFFIVLAIVPIVSLSFAYYVEYILGVVPCTLCTYQRWPYYILFFLSILGISFSRFSNILHKVIIL
    NFAISALISGYHYGIEKEIFSEPKT
    CKVNTIMSKNLSVKERIKLLETIPVVKSCKVVPFKIMDMSMAVMNFLWSILLLLF
    CCVVNLYYCKYAKANICSRSSC

    >gi|148284251|ref|YP_001248341.1| thioredoxin [Orientia tsutsugamushi str. Boryong]
    MTKNITEINDEENFKQEVLLSSKLVLVDFYADWCGPCRQLSPILEQISEELSDKVKIVKVNIEKNIQAATDFKIQSIPTL
    ILFNNGEAVSREIGGKSKQDIIDWINNY

    >gi|148284315|ref|YP_001248405.1| bacterioferritin comigratory protein [Orientia tsutsugamushi str. Boryong]
    MKNLTINDDAPDFNMITTSNSIINLGHYEGKNLVLYFYPKDNTPGCTIEAQKFNEAISEFNKLNTIILGVSKDNIASHQK
    FKDKLCLKFELGYDETGKIFEDYGVLKEKSMFKNTFLAISRTTFLINQKAKIAAIWPKVNITQHSNEVLNMVKNTI

    >gi|148284333|ref|YP_001248423.1| iron-binding protein IscA/HesB [Orientia tsutsugamushi str. Boryong]
    MSNSKFNITISDTVYKRIHELNEEANEQQPLMLRIRVDAGGCSGFIYEYDLVMEYEPGDFIAEKDNAIVVIDSLSQNFIN
    GAIIEYIEELGRSYFKITNPAAQAKCGCGNSFAL

    >gi|148284386|ref|YP_001248476.1| glutaredoxin [Orientia tsutsugamushi str. Boryong]
    MKRILIIVILPIILSYFIIEKTGILEYMKKSDLQDEDFMIYDDDNIYIYTKPTCPYCLNAKSLLNQKSVSFKEIDISNNQ
    QLHEKLKQATSQTTVPYIFIYGQFIGGYMQLQDLDNTDKLDELLAQK

    >gi|148284575|ref|YP_001248665.1| hypothetical protein OTBS_1026 [Orientia tsutsugamushi str. Boryong]
    MKYLHRNFYILAAICLIAVYHVFSKSDNLVERNISSTNDINQHDNSQQIGNNNVQLATTSEDQDNNINEDNNISTNNSKE
    TINSVLKINKYDIVLGNKDSNIKIFEYFSYA
    CYHCARYHEKIFPTIKHKFIDTNKIAYITREFITSKQDLDGAMLSRCGG
    TLMWNKFHTTLLEQQDKWVFNKNYMNWLKDIGKIGGITADQFLNCFKDEILAQQLMLNTVNISKFEIFDGTPCIIAVIND
    EHIIRIENVITEISDIVEKAANSKDKKNDITEAQEK

    >gi|148284615|ref|YP_001248705.1| iron-sulfur cluster assembly accessory protein [Orientia tsutsugamushi str. Boryong]
    MSAINSSQLQINEARKQVITISSRAAKRIKELLAKREKPSLGIKVGIKTGGCSGYSYYIEYADVKGDFDEVIIDKGVTVL
    VDQKAILYLVGTTMDYIEGKFNSGFEFSNPNEKNRCGCGKSANF

    >gi|148284626|ref|YP_001248716.1| thioredoxin peroxidase 1 [Orientia tsutsugamushi str. Boryong]
    MEIFVGKSACDFTAPAVLPKNNINEKFNLKHELDGRKAVLFFYPLNFTFVCPTEIIAFNNRYGEFLKRNTEVIGISVDSH
    FCHKAWKLTPYNKGGIGDIQFPLVSDINKDISKTYNVLNQAGVAVRATFIIDQEFVLRHVTINDLSIGRNVEESLRIIDA
    IDFHKKYGDVCPAGWTPGTEGIEATSDGICHYLTSNAEKL

    >gi|148284853|ref|YP_001248943.1| Thiol:disulfide interchange protein [Orientia tsutsugamushi str. Boryong]
    MVILSLYKKTVAIIILLIMILCNSISIVCAKLLKDASTTIELVPYQANELTPEKINDQIRQYILSHPEVILESIEIMQQK
    QQQQEQEYFAGAINEQLKILHDTHNLPMVGNIHGNVIITIFYDYN
    CKYCKLLNNIVNKLIIENEDIKIIWVPLAILEGLS
    EHAAKIALAVYEKAPSKFHIFHNKIMSLTKVTLQDIENILVEAEIDVDKVNDLTNSPNIQNILSMINNIASKCNLNGVPL
    TVIGNRVYTGLVDKLQQGVNEAREKNKAIVCPLK

    >gi|148284860|ref|YP_001248950.1| glutathione S-transferase [Orientia tsutsugamushi str. Boryong]
    MRKVYYYPLCPFSRQLRIILKEVDSVFTLIKEEFWLKKKEFITLNPNGKLPVLIETSGLVVYDIFTIIEYLREIEPNFHF
    ICNEPEKNVAIRKLFTWFNDKFYHEVTKIILDEKLIKFLKNYGSPRSDLLKIAKTSQKVHFNFIANLLQSNSYLAGDQVT
    IADIAAASHISVIDYFNEVIWDYYPSVKNWYVLIKSRPSFKPLLQDYTPGFFPPKYYAELDF

    >gi|148284928|ref|YP_001249018.1| glutaredoxin-related protein [Orientia tsutsugamushi str. Boryong]
    MILYIIPMNKDNIFQLIEQQIKSNDIVLYMKGTIHAPKCGFSAIVANIIQELTKDFKNINCTYIDVLCDDDLRQGIKEYT
    DWPTIPQLYIQEEFIGGCDIVKEMYRNGELKTLLLQKFKDIKDN

    >gi|148285001|ref|YP_001249091.1| thioredoxin reductase [Orientia tsutsugamushi str. Boryong]
    MLSKNVHTADVVIVGAGPVGLFAVFQAGMLEMKCHVVDALDCIGGQCVTLYPDKPIYDIPAYPVITAAKLIEQLKQQVAP
    FDTVYHLGQQVIGCKIDNDIITITTSAEQVICSKSLIIAAGCGAFKYKRLILDNIEAFENKTVFYSVKDKNKFINKKVVI
    AGGGDSAIDWTLLLSDVAEVIYLVHRRENFRCAPHSLNQIKQLAEYGKVQMIVPYQLAKLTGENGLLQEVLVTNFNGGTQ
    TLPADYLLAFFGLAADLGPIHKWGLKTDLRRIEVNSITYETTIPGIYAIGDVASYPGKLKLILTGFAEAATAMSHCYQRV
    FGKKMHFQYSTVKGVLRS